BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000010-TA|BGIBMGA000010-PA|IPR012464|Protein of unknown function DUF1676 (240 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024809-3|AAF59541.3| 455|Caenorhabditis elegans Hypothetical ... 30 1.7 U40415-10|AAK39254.1| 215|Caenorhabditis elegans Dnaj domain (p... 28 5.2 >AC024809-3|AAF59541.3| 455|Caenorhabditis elegans Hypothetical protein Y53G8AR.8 protein. Length = 455 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 58 LRSKREITLVDGVTLDSKGSPRSARALEPLPEEPKAREAQVESRLVDGVADFLEN 112 L + E+ L D V D K PR R LPE ++R +++ + DF EN Sbjct: 393 LEHEAELNLTDNVITDPKMLPRGKRPEFELPEH-RSRLEDAKAQFLKEFGDFEEN 446 >U40415-10|AAK39254.1| 215|Caenorhabditis elegans Dnaj domain (prokaryotic heat shockprotein) protein 14 protein. Length = 215 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Query: 17 PAAEQDSDPNI---LGSVLGVVKECVDGDVTLCLKEKALRY 54 PAA+ DP L +VLG+ K D ++ ++ ALRY Sbjct: 25 PAADHSHDPKKGLHLYNVLGIQKNATDDEIKKAYRKLALRY 65 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,437,263 Number of Sequences: 27539 Number of extensions: 150086 Number of successful extensions: 483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 483 Number of HSP's gapped (non-prelim): 2 length of query: 240 length of database: 12,573,161 effective HSP length: 79 effective length of query: 161 effective length of database: 10,397,580 effective search space: 1674010380 effective search space used: 1674010380 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -