BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000008-TA|BGIBMGA000008-PA|IPR012464|Protein of unknown function DUF1676 (253 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 1.7 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 23 3.0 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 23 3.0 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 21 6.9 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 6.9 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/30 (36%), Positives = 13/30 (43%) Query: 204 HPQVSQSHTYSSSHYGGDFDSTGPGGHYRR 233 HP S+ YSS G +D P G R Sbjct: 126 HPYTVISNGYSSPMSSGSYDPYSPNGKIGR 155 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 95 DQVDKYLQDATSKLMQTHRVVI 116 D VDK LQDA H +V+ Sbjct: 143 DPVDKVLQDAKIGKSAVHEIVL 164 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 95 DQVDKYLQDATSKLMQTHRVVI 116 D VDK LQDA H +V+ Sbjct: 143 DPVDKVLQDAKIGKSAVHEIVL 164 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 195 EKTTYEIVKHPQVSQSHTYSSSHY 218 EKTTYE ++ Q TY S + Sbjct: 29 EKTTYEYYENNQALPPITYPPSDW 52 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 195 EKTTYEIVKHPQVSQSHTYSSSHY 218 EKTTYE ++ Q TY S + Sbjct: 20 EKTTYEYYENNQALPPITYPPSDW 43 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.134 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,827 Number of Sequences: 317 Number of extensions: 1378 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 253 length of database: 114,650 effective HSP length: 55 effective length of query: 198 effective length of database: 97,215 effective search space: 19248570 effective search space used: 19248570 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -