GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000008-TA|BGIBMGA000008-PA|IPR012464|Protein of unknown
function DUF1676
         (253 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ069332-1|AAZ32217.1|  296|Apis mellifera RNA polymerase II lar...    23   2.7  

>DQ069332-1|AAZ32217.1|  296|Apis mellifera RNA polymerase II large
           subunit protein.
          Length = 296

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 97  VDKYLQDATSKLMQTHRVVIAP-------QTFGEDVGRSINEARGK 135
           + K  +D    + + H + + P       QTF   V R +N+AR K
Sbjct: 167 IKKAKEDVIEVIQKAHNMELEPTPGNTLRQTFENQVNRILNDARDK 212


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 52,967
Number of Sequences: 429
Number of extensions: 1756
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 253
length of database: 140,377
effective HSP length: 56
effective length of query: 197
effective length of database: 116,353
effective search space: 22921541
effective search space used: 22921541
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)