GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000007-TA|BGIBMGA000007-PA|undefined
         (92 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ300461-1|CAC32454.1|  981|Homo sapiens hypothetical protein pr...    28   5.2  

>AJ300461-1|CAC32454.1|  981|Homo sapiens hypothetical protein
           protein.
          Length = 981

 Score = 27.9 bits (59), Expect = 5.2
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 46  YITKGVRKMIGRIYSVSDRVRDKIAESTMALD 77
           Y T G  K +GR+ +   R++D +A++ M LD
Sbjct: 235 YYTDGRSKSMGRMQTYFRRIKDWMAQNPMVLD 266


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.329    0.139    0.416 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,119,833
Number of Sequences: 224733
Number of extensions: 291124
Number of successful extensions: 638
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 637
Number of HSP's gapped (non-prelim): 1
length of query: 92
length of database: 73,234,838
effective HSP length: 70
effective length of query: 22
effective length of database: 57,503,528
effective search space: 1265077616
effective search space used: 1265077616
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 57 (27.1 bits)