BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000007-TA|BGIBMGA000007-PA|undefined (92 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-456|AAF51219.1| 521|Drosophila melanogaster CG2843-PA ... 26 5.6 >AE014134-456|AAF51219.1| 521|Drosophila melanogaster CG2843-PA protein. Length = 521 Score = 26.2 bits (55), Expect = 5.6 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 8/66 (12%) Query: 24 RRKMVLKHRRMKAFFNNHN-----PTDYITKGVRKMIGRIYSVSDRVR---DKIAESTMA 75 R ++V KHR A N ++I K V+K I S+ DR+R + I + + Sbjct: 454 RSQVVRKHREAYAREEAQNRERDFDKEFINKEVKKAIANHNSIGDRIRANLNNIQRTASS 513 Query: 76 LDNPFS 81 +D+ F+ Sbjct: 514 MDSNFA 519 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.329 0.139 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,582,602 Number of Sequences: 52641 Number of extensions: 108651 Number of successful extensions: 398 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 398 Number of HSP's gapped (non-prelim): 1 length of query: 92 length of database: 24,830,863 effective HSP length: 71 effective length of query: 21 effective length of database: 21,093,352 effective search space: 442960392 effective search space used: 442960392 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -