GeneModel BLAST Result against fruitfly

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000007-TA|BGIBMGA000007-PA|undefined
         (92 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-456|AAF51219.1|  521|Drosophila melanogaster CG2843-PA ...    26   5.6  

>AE014134-456|AAF51219.1|  521|Drosophila melanogaster CG2843-PA
           protein.
          Length = 521

 Score = 26.2 bits (55), Expect = 5.6
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 24  RRKMVLKHRRMKAFFNNHN-----PTDYITKGVRKMIGRIYSVSDRVR---DKIAESTMA 75
           R ++V KHR   A     N       ++I K V+K I    S+ DR+R   + I  +  +
Sbjct: 454 RSQVVRKHREAYAREEAQNRERDFDKEFINKEVKKAIANHNSIGDRIRANLNNIQRTASS 513

Query: 76  LDNPFS 81
           +D+ F+
Sbjct: 514 MDSNFA 519


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.329    0.139    0.416 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,582,602
Number of Sequences: 52641
Number of extensions: 108651
Number of successful extensions: 398
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 398
Number of HSP's gapped (non-prelim): 1
length of query: 92
length of database: 24,830,863
effective HSP length: 71
effective length of query: 21
effective length of database: 21,093,352
effective search space: 442960392
effective search space used: 442960392
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 53 (25.4 bits)