BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000006-TA|BGIBMGA000006-PA|IPR012464|Protein of unknown function DUF1676 (270 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46098| Best HMM Match : RnaseH (HMM E-Value=0.089) 37 0.015 SB_5693| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 0.76 SB_19994| Best HMM Match : Pox_J1 (HMM E-Value=7.6) 31 0.76 SB_38437| Best HMM Match : VWA (HMM E-Value=0) 30 2.3 SB_21445| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 29 5.3 SB_24365| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_2835| Best HMM Match : Spectrin (HMM E-Value=0.14) 28 7.0 SB_24364| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_46098| Best HMM Match : RnaseH (HMM E-Value=0.089) Length = 822 Score = 37.1 bits (82), Expect = 0.015 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Query: 21 SKLVKNIYNECLSQYSVECVKPRTLQWMSSVANDDEIKITEDLSIVKTGTVEDDESADPR 80 SKLVK Y L + +KP Q +SS+ DDEI TE+ I++T T + PR Sbjct: 15 SKLVKQRYRTELRSRILASIKPEISQALSSLL-DDEIHGTEEEKIMRTATRSFTKGLKPR 73 Query: 81 LAKDP 85 + P Sbjct: 74 SSTHP 78 >SB_5693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1429 Score = 32.3 bits (70), Expect = 0.43 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Query: 22 KLVKNIYNECLSQYSVECVKPRTLQWMSSVANDDEIKITEDLSIVKTGTVEDDESADPRL 81 KLVK Y L ++ +KP Q +S + DEI TE+ I++T T + PR Sbjct: 460 KLVKRRYGTELRSRTLALIKPEISQALSLLL--DEIHGTEEAKIMRTATQSFTKGPKPRS 517 Query: 82 AKDP 85 + P Sbjct: 518 STHP 521 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 31.5 bits (68), Expect = 0.76 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 2/69 (2%) Query: 24 VKNIYNECLSQYSVECVKPRTLQWMSSV-ANDDEI-KITEDLSIVKTGTVEDDESADPRL 81 +K+ N+ L + + KP++ QW + +EI K TED + G ++ E D + Sbjct: 497 LKDSLNKTLGAHVAQHQKPKSQQWRERLNLKKEEIPKKTEDTKSEEVGGNDEPEEEDAHV 556 Query: 82 AKDPAYEMF 90 K P F Sbjct: 557 VKHPTMPFF 565 >SB_19994| Best HMM Match : Pox_J1 (HMM E-Value=7.6) Length = 348 Score = 31.5 bits (68), Expect = 0.76 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 11/69 (15%) Query: 62 DLSIVKTGTVEDDESADPRLAKDPAYEMFDK--VDKFLQSHTLRVKVPEEITKSAASEYV 119 D+SIV G V D +DPR+ KDP ++F VD FL + VP+ + S + Sbjct: 34 DVSIVLNGAVAD---SDPRVLKDPKRKVFKTGGVDAFL------LTVPQSLDPSEEMKEA 84 Query: 120 PRSLLTDLP 128 P++ +P Sbjct: 85 PKTKKEGIP 93 >SB_38437| Best HMM Match : VWA (HMM E-Value=0) Length = 3445 Score = 29.9 bits (64), Expect = 2.3 Identities = 25/98 (25%), Positives = 40/98 (40%), Gaps = 4/98 (4%) Query: 41 KPRTLQWMSSVANDDEIKITEDLSIVKTGTVEDDESADPRLAKDPAYEMFDKVDKFLQSH 100 K +T+ S+V D E + + V T P + P D+VD +H Sbjct: 227 KSKTILDESTVKPDSEDIVVPGIIDVDADTPRPTAVTKPTMMATPTMSRIDQVDFIPAAH 286 Query: 101 TLRVKVPEEI-TKSAASEY--VPRSLLTDLPSEL-DMP 134 K EE+ T +EY P S + D+ ++ D+P Sbjct: 287 EKEDKNDEEVPTVKITAEYAPTPASRIPDIQKDINDIP 324 >SB_21445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/31 (41%), Positives = 20/31 (64%) Query: 72 EDDESADPRLAKDPAYEMFDKVDKFLQSHTL 102 ED +SA R+A DPAY+ +D + L++ L Sbjct: 45 EDKDSAPSRIAIDPAYDYYDIHQEILRARCL 75 >SB_41021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/28 (39%), Positives = 19/28 (67%) Query: 47 WMSSVANDDEIKITEDLSIVKTGTVEDD 74 W++ V N+D +K+TE+ S+V T + D Sbjct: 3 WINVVDNEDLVKLTEESSVVILATYDGD 30 >SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/34 (38%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 100 HTLRVKVPEEITKSAASEYVPRSLLTDL-PSELD 132 H + V + +++AA +YVPR++L DL P+ +D Sbjct: 954 HCKEIGVGSKTSEAAAGKYVPRAVLVDLEPTVID 987 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/47 (34%), Positives = 22/47 (46%) Query: 94 DKFLQSHTLRVKVPEEITKSAASEYVPRSLLTDLPSELDMPLDGEDE 140 +K SH + K + A E + L P+ELD+P D EDE Sbjct: 155 NKASASHYTQKKTTGSSSTEALREDISYMLEAVTPAELDVPTDNEDE 201 >SB_24365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 28.7 bits (61), Expect = 5.3 Identities = 24/97 (24%), Positives = 37/97 (38%), Gaps = 11/97 (11%) Query: 49 SSVANDDEIKITEDLSIVKTGTVEDDESADPRLAKDPAYEMFDKVDKFLQSHTLRVKVPE 108 S N+D++ T D K T DD+ D E F++++K P Sbjct: 323 SQTVNEDKVPTTNDDDEDKASTTNDDDQDKASTTND--NEEFEEIEK---------NPPV 371 Query: 109 EITKSAASEYVPRSLLTDLPSELDMPLDGEDEAEVVE 145 E + SE + LL + E P ED+ + E Sbjct: 372 EPAEYTISEEKRKDLLRQIIEEESTPSSDEDDGDYEE 408 >SB_2835| Best HMM Match : Spectrin (HMM E-Value=0.14) Length = 1089 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/48 (27%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Query: 51 VANDDEIKITEDLSIVKTGTVEDDESADPRLAKDPAY-EMFDKVDKFL 97 + +DD+I +D++ T EDD +++ + +PA E+ D+ ++ L Sbjct: 114 ITSDDDITSDDDITSDDDITSEDDITSEDNITTEPAIKEVIDRANELL 161 >SB_24364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 27.9 bits (59), Expect = 9.3 Identities = 20/97 (20%), Positives = 34/97 (35%) Query: 49 SSVANDDEIKITEDLSIVKTGTVEDDESADPRLAKDPAYEMFDKVDKFLQSHTLRVKVPE 108 S N+D++ T D K T DD+ D + + + + P Sbjct: 79 SQTVNEDKVPTTNDDDEDKASTTNDDDKDKASTTNDDDQDKASTTNDNEEFGEIEKNPPV 138 Query: 109 EITKSAASEYVPRSLLTDLPSELDMPLDGEDEAEVVE 145 E + SE + LL + E P +D+ + E Sbjct: 139 EPAEYPISEDKRKDLLRQIIEEERTPSSDDDDGDYEE 175 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.132 0.378 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,101,050 Number of Sequences: 59808 Number of extensions: 234505 Number of successful extensions: 613 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 605 Number of HSP's gapped (non-prelim): 14 length of query: 270 length of database: 16,821,457 effective HSP length: 81 effective length of query: 189 effective length of database: 11,977,009 effective search space: 2263654701 effective search space used: 2263654701 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -