SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20083
         (676 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P48735 Cluster: Isocitrate dehydrogenase [NADP], mitoch...   136   5e-31
UniRef50_Q9SRZ6 Cluster: F12P19.10 protein; n=26; cellular organ...   136   6e-31
UniRef50_UPI0000F1EC8D Cluster: PREDICTED: similar to Isocitrate...   133   4e-30
UniRef50_Q8LPJ5 Cluster: Isocitrate dehydrogenase-like protein; ...   132   6e-30
UniRef50_A5N5L9 Cluster: Idh; n=2; Bacteria|Rep: Idh - Clostridi...   114   2e-24
UniRef50_A5ZVX5 Cluster: Putative uncharacterized protein; n=1; ...   113   4e-24
UniRef50_A2WMU2 Cluster: Putative uncharacterized protein; n=5; ...   111   1e-23
UniRef50_Q0CXI1 Cluster: Isocitrate dehydrogenase, mitochondrial...    99   5e-20
UniRef50_Q5DBI8 Cluster: SJCHGC09598 protein; n=1; Schistosoma j...    90   5e-17
UniRef50_A4VDP7 Cluster: Putative uncharacterized protein; n=1; ...    86   8e-16
UniRef50_Q2K7T8 Cluster: NADP-dependent isocitrate dehydrogenase...    57   3e-07
UniRef50_A3K670 Cluster: NADP-dependent isocitrate dehydrogenase...    52   2e-05
UniRef50_Q00WM7 Cluster: COG0538: Isocitrate dehydrogenases; n=3...    51   3e-05
UniRef50_A2XVE4 Cluster: Putative uncharacterized protein; n=2; ...    48   3e-04
UniRef50_A3JDN6 Cluster: Isocitrate dehydrogenase; n=5; Gammapro...    46   6e-04
UniRef50_Q40658 Cluster: Isocitrate dehydrogenase; n=1; Oryza sa...    46   0.001
UniRef50_Q67N12 Cluster: 3-isopropylmalate dehydrogenase; n=5; B...    40   0.042

>UniRef50_P48735 Cluster: Isocitrate dehydrogenase [NADP],
           mitochondrial precursor (EC 1.1.1.42) (Oxalosuccinate
           decarboxylase) (IDH) (NADP(+)-specific ICDH); n=493;
           cellular organisms|Rep: Isocitrate dehydrogenase [NADP],
           mitochondrial precursor (EC 1.1.1.42) (Oxalosuccinate
           decarboxylase) (IDH) (NADP(+)-specific ICDH) - Homo
           sapiens (Human)
          Length = 452

 Score =  136 bits (329), Expect = 5e-31
 Identities = 62/84 (73%), Positives = 70/84 (83%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTRI+W  IKE+LI P+V +   YFDLGLP+RD TDDQVTIDSA A  K++V +KC
Sbjct: 54  DGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKC 113

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RVEEFKLKKMW SPNG
Sbjct: 114 ATITPDEARVEEFKLKKMWKSPNG 137



 Score =  101 bits (243), Expect = 1e-20
 Identities = 43/56 (76%), Positives = 48/56 (85%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPG 665
           P   IRNILGGTVFREPI+C++IPR+VPGWTKPI IGRHAHGDQYKA DFV  + G
Sbjct: 135 PNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAG 190


>UniRef50_Q9SRZ6 Cluster: F12P19.10 protein; n=26; cellular
           organisms|Rep: F12P19.10 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 410

 Score =  136 bits (328), Expect = 6e-31
 Identities = 60/84 (71%), Positives = 71/84 (84%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTR++W  IK++LI P+V++D  YFDLGLPHRDATDD+VTI+SA A  K+NV IKC
Sbjct: 16  DGDEMTRVIWKSIKDKLITPFVELDIKYFDLGLPHRDATDDKVTIESAEATKKYNVAIKC 75

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RV EF LK+MW SPNG
Sbjct: 76  ATITPDEGRVTEFGLKQMWRSPNG 99



 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 39/58 (67%), Positives = 48/58 (82%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKV 671
           P   IRNIL GTVFREPI+C+++P++VPGWTKPI IGRHA GDQY+A D V+  PGK+
Sbjct: 97  PNGTIRNILNGTVFREPIICKNVPKLVPGWTKPICIGRHAFGDQYRATDAVIKGPGKL 154


>UniRef50_UPI0000F1EC8D Cluster: PREDICTED: similar to Isocitrate
           dehydrogenase 1 (NADP+), soluble; n=2; Danio rerio|Rep:
           PREDICTED: similar to Isocitrate dehydrogenase 1
           (NADP+), soluble - Danio rerio
          Length = 206

 Score =  133 bits (321), Expect = 4e-30
 Identities = 56/83 (67%), Positives = 74/83 (89%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEMTR++W  IKE+LIFPY+++D   +DLG+ +RDATDD+VT+++A A+ ++NVGIKCA
Sbjct: 22  GDEMTRVIWELIKEKLIFPYLELDLHSYDLGMENRDATDDKVTVEAAEAVRRYNVGIKCA 81

Query: 439 TITPDEQRVEEFKLKKMWLSPNG 507
           TITPDE+RVEEFKLK+MW SPNG
Sbjct: 82  TITPDEKRVEEFKLKQMWRSPNG 104



 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 34/44 (77%), Positives = 39/44 (88%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQ 629
           P   IRNILGGTVFRE I+C++IPR+VPGW KPI+IGRHAHGDQ
Sbjct: 102 PNGTIRNILGGTVFREAIICKNIPRLVPGWIKPIIIGRHAHGDQ 145


>UniRef50_Q8LPJ5 Cluster: Isocitrate dehydrogenase-like protein;
           n=6; core eudicotyledons|Rep: Isocitrate
           dehydrogenase-like protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 485

 Score =  132 bits (320), Expect = 6e-30
 Identities = 58/84 (69%), Positives = 71/84 (84%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTR++W+ IKE+LI PY+ +D  YFDLG+ +RDATDD+VT++SA A LK+NV IKC
Sbjct: 86  DGDEMTRVIWSMIKEKLILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKC 145

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RV+EF LK MW SPNG
Sbjct: 146 ATITPDEGRVKEFGLKSMWRSPNG 169



 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 40/59 (67%), Positives = 47/59 (79%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNIL GTVFREPI+C +IPR+VPGW KPI IGRHA GDQY+A D V+  PGK++
Sbjct: 167 PNGTIRNILDGTVFREPIMCSNIPRLVPGWEKPICIGRHAFGDQYRATDTVIKGPGKLK 225


>UniRef50_A5N5L9 Cluster: Idh; n=2; Bacteria|Rep: Idh - Clostridium
           kluyveri DSM 555
          Length = 401

 Score =  114 bits (275), Expect = 2e-24
 Identities = 49/84 (58%), Positives = 67/84 (79%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTRI+W  IKE L+ PY+ +   Y+DLGL  R+ T+D++TI++A+AI K+ VG+KC
Sbjct: 15  DGDEMTRIIWKMIKELLLEPYIDLKTEYYDLGLVKRNETNDEITIEAANAIKKYGVGVKC 74

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITP+ +RV+E+ LK MW SPNG
Sbjct: 75  ATITPNAKRVKEYNLKSMWKSPNG 98



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/59 (49%), Positives = 39/59 (66%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IR IL GTVFR PI+  SI  ++  W KPI + RHA+GD Y+  ++ V +PGK+E
Sbjct: 96  PNGTIRAILDGTVFRTPIIVNSIRPLMRTWEKPITVARHAYGDVYRDVEYKVEEPGKME 154


>UniRef50_A5ZVX5 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 417

 Score =  113 bits (272), Expect = 4e-24
 Identities = 48/84 (57%), Positives = 66/84 (78%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTRI+W  IK+ L+ P++ ++  Y+DLGL +R+ TDDQVTID+A A  K+ V +KC
Sbjct: 29  DGDEMTRILWKMIKDELLLPFIDLNTEYYDLGLNYRNETDDQVTIDAAEATKKYGVAVKC 88

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITP+  R++E+ LKKM+ SPNG
Sbjct: 89  ATITPNHARMDEYDLKKMYKSPNG 112



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 31/59 (52%), Positives = 37/59 (62%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IR IL GTVFR PI+ + I   V  W KPI + RHA+GD YK  +  + KPGKVE
Sbjct: 110 PNGTIRAILDGTVFRAPIVVKGIEPCVRNWKKPITLARHAYGDIYKNTEMYIDKPGKVE 168


>UniRef50_A2WMU2 Cluster: Putative uncharacterized protein; n=5;
           Eukaryota|Rep: Putative uncharacterized protein - Oryza
           sativa subsp. indica (Rice)
          Length = 475

 Score =  111 bits (268), Expect = 1e-23
 Identities = 57/104 (54%), Positives = 70/104 (67%), Gaps = 18/104 (17%)
 Frame = +1

Query: 250 REDGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGI 429
           R  GDEMTR++W  IK++LIFP++ +D  Y+DLGLP+RDAT D+VTI+SA A LK+NV I
Sbjct: 39  RNSGDEMTRVIWKWIKDKLIFPFLDLDIKYYDLGLPNRDATGDKVTIESAEATLKYNVAI 98

Query: 430 KCATITP------------------DEQRVEEFKLKKMWLSPNG 507
           KCATITP                  DE RV+EF L  MW SPNG
Sbjct: 99  KCATITPVLDTQFKFDFGRTIHEPTDEGRVKEFNLSAMWKSPNG 142



 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 40/59 (67%), Positives = 48/59 (81%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNIL GTVFREPI+C++IPR+VPGW KPI IGRHA GDQY+A D V+  PGK++
Sbjct: 140 PNGTIRNILNGTVFREPIICKNIPRLVPGWIKPICIGRHAFGDQYRATDTVIKGPGKLK 198


>UniRef50_Q0CXI1 Cluster: Isocitrate dehydrogenase, mitochondrial;
           n=2; Eurotiomycetidae|Rep: Isocitrate dehydrogenase,
           mitochondrial - Aspergillus terreus (strain NIH 2624)
          Length = 466

 Score =   99 bits (238), Expect = 5e-20
 Identities = 43/59 (72%), Positives = 50/59 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFREPI+  +IPR+VPGWTKPI+IGRHA GDQY+A D V+P PGK+E
Sbjct: 151 PNGTIRNILGGTVFREPIVIPAIPRLVPGWTKPIIIGRHAFGDQYRATDRVIPGPGKLE 209



 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 39/53 (73%), Positives = 47/53 (88%)
 Frame = +1

Query: 349 GLPHRDATDDQVTIDSAHAILKHNVGIKCATITPDEQRVEEFKLKKMWLSPNG 507
           G+ +RD TDD+VT+++A AI K+ VG+KCATITPDE RVEEFKLKKMWLSPNG
Sbjct: 101 GIEYRDQTDDKVTVEAAEAIKKYGVGVKCATITPDEARVEEFKLKKMWLSPNG 153


>UniRef50_Q5DBI8 Cluster: SJCHGC09598 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC09598 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 129

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 48/73 (65%), Positives = 53/73 (72%)
 Frame = -3

Query: 509 LPFGLSHIFFNLNSSTLCSSGVIVAHLMPTLCFRMACAESMVT*SSVASRCGRPKSK*RQ 330
           +PFG SHIFF LNS T CSSGV+VAHL+PTL F +A A S+VT S V SR GRPKSK  Q
Sbjct: 15  VPFGDSHIFFKLNSLTRCSSGVMVAHLIPTLYFLIASAPSIVTWSLVRSRLGRPKSKYLQ 74

Query: 329 STLTYGNISLSLI 291
           ST   GNIS   I
Sbjct: 75  STSINGNISCCFI 87


>UniRef50_A4VDP7 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 141

 Score = 85.8 bits (203), Expect = 8e-16
 Identities = 49/85 (57%), Positives = 58/85 (68%)
 Frame = -3

Query: 509 LPFGLSHIFFNLNSSTLCSSGVIVAHLMPTLCFRMACAESMVT*SSVASRCGRPKSK*RQ 330
           +P G  HIF +LNS T  SS VIVAHL+PTLC R+A A S VT S VASR    +S+   
Sbjct: 5   VPLGEGHIFLSLNSLTRASSAVIVAHLIPTLCSRIAQAASKVTQSLVASRFSIERSQYLI 64

Query: 329 STLTYGNISLSLILAHMMRVISSPS 255
           S    GN+SLSLI+  M+RVISSPS
Sbjct: 65  SAEINGNMSLSLIIFQMIRVISSPS 89


>UniRef50_Q2K7T8 Cluster: NADP-dependent isocitrate dehydrogenase
           protein; n=1; Rhizobium etli CFN 42|Rep: NADP-dependent
           isocitrate dehydrogenase protein - Rhizobium etli
           (strain CFN 42 / ATCC 51251)
          Length = 437

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 30/80 (37%), Positives = 45/80 (56%)
 Frame = -2

Query: 507 SVRA*PHFLQLELFYSLFIRCDSSAFDAHIML*NGMR*VDGDLIISGVTMREAQVKVKTI 328
           +VRA PHFL++E   + FIR D  A D   +  +G+  VD  L++ GV + + +V +  I
Sbjct: 326 AVRALPHFLEIEFLDAGFIRRDRCALDTDAVFLDGVGGVDRHLVVGGVAIFDREVVIVDI 385

Query: 327 HLNIWKYQSLFDLSPHDACH 268
            + I   Q + D  P DACH
Sbjct: 386 EVEIRMDQLILDELPDDACH 405


>UniRef50_A3K670 Cluster: NADP-dependent isocitrate dehydrogenase
           protein; n=2; Rhodobacteraceae|Rep: NADP-dependent
           isocitrate dehydrogenase protein - Sagittula stellata
           E-37
          Length = 459

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = -2

Query: 492 PHFLQLELFYSLFIRCDSSAFDAHIML*NGMR*VDGDLIISGVTMREAQVKVKTIHLNIW 313
           PH L+ E   +L +R D  AFD    L      VDGDL+   V + + ++ VK + + + 
Sbjct: 362 PHLLETEFLDTLLVRGDRRAFDRDANLLRLFGGVDGDLVPGPVPLLDPEIVVKQVQVEVR 421

Query: 312 KYQSLFDLSPHDACH 268
           + Q   D SPHDA H
Sbjct: 422 QDQLFLDESPHDAGH 436



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -3

Query: 647 KILRLVLVAVRMTAYHNRFRPTRHNPRDTLTQYRFAEYCTAQNVTDLPFG-LSHI 486
           +I  LVLVA  + A+H+   P RH  R      R AE   AQ+V D   G L H+
Sbjct: 310 EIRGLVLVAEGVPAHHDGRGPARHEARHVAADDRLAEDDAAQDVADRAVGRLPHL 364


>UniRef50_Q00WM7 Cluster: COG0538: Isocitrate dehydrogenases; n=3;
           Ostreococcus|Rep: COG0538: Isocitrate dehydrogenases -
           Ostreococcus tauri
          Length = 429

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 33/90 (36%), Positives = 44/90 (48%), Gaps = 1/90 (1%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLY-FDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           G+EMT  +   I+ R I P V V     FDL   +RD T+D+V  D   A  +     K 
Sbjct: 36  GEEMTAYVMDLIRSRWIEPRVDVGGWETFDLRAKNRDDTEDRVLRDVIEAGKRIKAIFKE 95

Query: 436 ATITPDEQRVEEFKLKKMWLSPNGRSVTFW 525
            T+TP   +V+   L+K W SPNG     W
Sbjct: 96  PTVTPTADQVKRLGLRKSWGSPNGAMRRGW 125


>UniRef50_A2XVE4 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 371

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 2/36 (5%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRV--VPGWTKPI 599
           P   IRNIL GTVFREPILC+++PR+  VP   +P+
Sbjct: 5   PNGTIRNILNGTVFREPILCKNVPRILSVPDGAEPV 40


>UniRef50_A3JDN6 Cluster: Isocitrate dehydrogenase; n=5;
           Gammaproteobacteria|Rep: Isocitrate dehydrogenase -
           Marinobacter sp. ELB17
          Length = 582

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/80 (27%), Positives = 45/80 (56%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCA 438
           GDEM ++ + +I ++ +   + ++ +  DL   HR  T+ QV  ++  A+ K+ VG+K A
Sbjct: 16  GDEMAQVAFEEILKKFVTTRLAIELIEIDLSAEHRFLTNGQVIFEAIEALKKYGVGVKNA 75

Query: 439 TITPDEQRVEEFKLKKMWLS 498
            +T + ++++    K   LS
Sbjct: 76  GMTVNREQLDAMLEKHPELS 95


>UniRef50_Q40658 Cluster: Isocitrate dehydrogenase; n=1; Oryza
           sativa|Rep: Isocitrate dehydrogenase - Oryza sativa
           (Rice)
          Length = 61

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 17/27 (62%), Positives = 23/27 (85%)
 Frame = +1

Query: 250 REDGDEMTRIMWAKIKERLIFPYVKVD 330
           R+DGDEMTRI W  IK++LIFP++ +D
Sbjct: 33  RDDGDEMTRIFWQSIKDKLIFPFLDLD 59


>UniRef50_Q67N12 Cluster: 3-isopropylmalate dehydrogenase; n=5;
           Bacteria|Rep: 3-isopropylmalate dehydrogenase -
           Symbiobacterium thermophilum
          Length = 357

 Score = 40.3 bits (90), Expect = 0.042
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +1

Query: 340 FDLGLPHRDATDDQVTIDSAHAILKHNVGIKCATITPD 453
           +DL L +R AT ++V  ++A A+ +H  G+K ATITP+
Sbjct: 41  YDLSLENRRATSNRVVYEAAAAMREHGYGLKAATITPE 78


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 665,507,013
Number of Sequences: 1657284
Number of extensions: 13007695
Number of successful extensions: 30393
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 29634
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30392
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52066120554
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -