SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20081
         (635 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q08473 Cluster: RNA-binding protein squid; n=22; Endopt...   152   8e-36
UniRef50_UPI0000DB6DF2 Cluster: PREDICTED: similar to squid CG16...   122   1e-26
UniRef50_Q14103 Cluster: Heterogeneous nuclear ribonucleoprotein...   107   3e-22
UniRef50_O14979 Cluster: Heterogeneous nuclear ribonucleoprotein...   100   3e-20
UniRef50_Q9VVE5 Cluster: CG32169-PA; n=9; Endopterygota|Rep: CG3...    99   4e-20
UniRef50_Q21911 Cluster: Putative uncharacterized protein msi-1;...    95   1e-18
UniRef50_Q4WHA5 Cluster: Heterogeneous nuclear ribonucleoprotein...    92   1e-17
UniRef50_Q32LZ4 Cluster: Msi2h protein; n=4; Eutheria|Rep: Msi2h...    91   2e-17
UniRef50_Q5DH48 Cluster: SJCHGC06087 protein; n=1; Schistosoma j...    91   2e-17
UniRef50_Q7XDI5 Cluster: RNA recognition motif family protein, e...    91   3e-17
UniRef50_Q99383 Cluster: Nuclear polyadenylated RNA-binding prot...    91   3e-17
UniRef50_Q8CD63 Cluster: 13 days embryo male testis cDNA, RIKEN ...    90   5e-17
UniRef50_A4V6K2 Cluster: PRM10 protein; n=1; Dugesia japonica|Re...    89   6e-17
UniRef50_O94432 Cluster: mRNA cleavage factor complex subunit; n...    89   6e-17
UniRef50_Q6BL35 Cluster: Debaryomyces hansenii chromosome F of s...    89   8e-17
UniRef50_O43347 Cluster: RNA-binding protein Musashi homolog 1; ...    89   1e-16
UniRef50_Q9HEH4 Cluster: Related to heterogeneous nuclear ribonu...    87   3e-16
UniRef50_Q8MS04 Cluster: RH49436p; n=9; Endopterygota|Rep: RH494...    86   6e-16
UniRef50_Q5K6W6 Cluster: Putative uncharacterized protein; n=1; ...    85   1e-15
UniRef50_A3LZT4 Cluster: Predicted protein; n=1; Pichia stipitis...    85   1e-15
UniRef50_UPI00015560CE Cluster: PREDICTED: similar to heterogene...    85   2e-15
UniRef50_Q8W034 Cluster: Ribonucleoprotein 1; n=5; core eudicoty...    85   2e-15
UniRef50_P09651 Cluster: Heterogeneous nuclear ribonucleoprotein...    85   2e-15
UniRef50_P51991 Cluster: Heterogeneous nuclear ribonucleoprotein...    84   2e-15
UniRef50_Q6PNM9 Cluster: AUF1 similar protein; n=3; Paracentrotu...    84   3e-15
UniRef50_UPI000023D975 Cluster: hypothetical protein FG10273.1; ...    81   2e-14
UniRef50_Q96EP5 Cluster: DAZ-associated protein 1; n=39; Euteleo...    81   2e-14
UniRef50_Q9D3U4 Cluster: Adult male testis cDNA, RIKEN full-leng...    81   2e-14
UniRef50_Q22037 Cluster: Heterogeneous nuclear ribonucleoprotein...    81   2e-14
UniRef50_Q6CC04 Cluster: Yarrowia lipolytica chromosome C of str...    81   3e-14
UniRef50_Q4PBU3 Cluster: Putative uncharacterized protein; n=1; ...    80   4e-14
UniRef50_Q5CS11 Cluster: Musashi. RRM domain containing protein,...    80   5e-14
UniRef50_Q4W5P0 Cluster: Homologous to drosophila sqd (Squid) pr...    79   7e-14
UniRef50_Q4S8N9 Cluster: Chromosome 7 SCAF14703, whole genome sh...    79   1e-13
UniRef50_A7SCX6 Cluster: Predicted protein; n=1; Nematostella ve...    79   1e-13
UniRef50_P48809 Cluster: Heterogeneous nuclear ribonucleoprotein...    78   2e-13
UniRef50_Q1ENZ5 Cluster: RNA-binding protein, putative; n=2; Mag...    78   2e-13
UniRef50_Q66IT0 Cluster: MGC84815 protein; n=1; Xenopus laevis|R...    77   3e-13
UniRef50_UPI0000F1F0C3 Cluster: PREDICTED: similar to LOC561459 ...    77   4e-13
UniRef50_Q4SEZ3 Cluster: Chromosome 1 SCAF14609, whole genome sh...    77   4e-13
UniRef50_UPI0001560FCC Cluster: PREDICTED: hypothetical protein;...    76   6e-13
UniRef50_Q9SU99 Cluster: HnRNP-like protein; n=10; core eudicoty...    76   6e-13
UniRef50_P48810 Cluster: Heterogeneous nuclear ribonucleoprotein...    76   6e-13
UniRef50_Q4SQV2 Cluster: Chromosome 1 SCAF14529, whole genome sh...    76   8e-13
UniRef50_A7NUC5 Cluster: Chromosome chr18 scaffold_1, whole geno...    76   8e-13
UniRef50_Q9UAF2 Cluster: Musashi; n=1; Halocynthia roretzi|Rep: ...    75   1e-12
UniRef50_UPI00005A10B6 Cluster: PREDICTED: similar to Heterogene...    54   2e-12
UniRef50_Q86ER1 Cluster: Clone ZZD1516 mRNA sequence; n=2; Schis...    75   2e-12
UniRef50_UPI00005A4DCF Cluster: PREDICTED: similar to Heterogene...    74   3e-12
UniRef50_Q8W555 Cluster: AT3g07810/F17A17_15; n=11; Magnoliophyt...    74   3e-12
UniRef50_Q9U5E3 Cluster: CiMsi; n=1; Ciona intestinalis|Rep: CiM...    73   4e-12
UniRef50_UPI0000DB6D53 Cluster: PREDICTED: similar to CG32169-PA...    73   8e-12
UniRef50_Q5TTQ2 Cluster: ENSANGP00000026814; n=3; Endopterygota|...    73   8e-12
UniRef50_UPI0000E4626F Cluster: PREDICTED: similar to heterogene...    72   1e-11
UniRef50_A7SSE1 Cluster: Predicted protein; n=3; Nematostella ve...    72   1e-11
UniRef50_A7RG33 Cluster: Predicted protein; n=1; Nematostella ve...    72   1e-11
UniRef50_UPI00005A196B Cluster: PREDICTED: similar to Heterogene...    71   2e-11
UniRef50_A7PIB0 Cluster: Chromosome chr13 scaffold_17, whole gen...    71   2e-11
UniRef50_A4V6N1 Cluster: HnRNP A2/B1 protein; n=1; Dugesia japon...    71   2e-11
UniRef50_Q9LNP1 Cluster: F1L3.34; n=2; Arabidopsis thaliana|Rep:...    71   2e-11
UniRef50_Q0DXG2 Cluster: Os02g0755400 protein; n=2; Oryza sativa...    71   2e-11
UniRef50_A2YHR7 Cluster: Putative uncharacterized protein; n=2; ...    71   2e-11
UniRef50_A2X9R7 Cluster: Putative uncharacterized protein; n=1; ...    71   2e-11
UniRef50_UPI0000D5737C Cluster: PREDICTED: similar to RNA bindin...    71   3e-11
UniRef50_UPI0000E4934F Cluster: PREDICTED: similar to musashi nr...    70   4e-11
UniRef50_Q9LHL2 Cluster: Similarity to RNA binding protein; n=13...    70   5e-11
UniRef50_Q9FM47 Cluster: Similarity to RNA binding protein; n=5;...    70   5e-11
UniRef50_Q8W4A6 Cluster: Putative uncharacterized protein MJH23....    70   5e-11
UniRef50_A4V6K1 Cluster: DAZ-associated protein; n=2; Platyhelmi...    70   5e-11
UniRef50_A4R1M8 Cluster: Putative uncharacterized protein; n=1; ...    70   5e-11
UniRef50_Q9SM01 Cluster: RNA binding protein; n=2; Arabidopsis t...    69   7e-11
UniRef50_UPI000156016B Cluster: PREDICTED: hypothetical protein;...    69   9e-11
UniRef50_A7PL41 Cluster: Chromosome chr7 scaffold_20, whole geno...    69   9e-11
UniRef50_A5BLC5 Cluster: Putative uncharacterized protein; n=1; ...    69   9e-11
UniRef50_Q9SYP9 Cluster: F9H16.14 protein; n=6; core eudicotyled...    69   1e-10
UniRef50_Q8WSM6 Cluster: Putative uncharacterized protein; n=4; ...    69   1e-10
UniRef50_Q1LVU9 Cluster: Cold inducible RNA binding protein; n=8...    68   2e-10
UniRef50_Q9VFT3 Cluster: CG9654-PA; n=4; Drosophila melanogaster...    68   2e-10
UniRef50_A4RXB1 Cluster: Predicted protein; n=2; Ostreococcus|Re...    68   2e-10
UniRef50_A3BDN9 Cluster: Putative uncharacterized protein; n=3; ...    68   2e-10
UniRef50_Q2UQ21 Cluster: Predicted protein; n=3; Pezizomycotina|...    67   3e-10
UniRef50_Q13151 Cluster: Heterogeneous nuclear ribonucleoprotein...    67   3e-10
UniRef50_A7PG81 Cluster: Chromosome chr6 scaffold_15, whole geno...    67   4e-10
UniRef50_Q9M9E6 Cluster: F3F9.20; n=8; Arabidopsis thaliana|Rep:...    66   5e-10
UniRef50_Q4UI71 Cluster: RNA-binding (SR) protein, putative; n=2...    66   5e-10
UniRef50_Q8LPB0 Cluster: Glycine-rich RNA-binding protein; n=1; ...    66   7e-10
UniRef50_Q7XI13 Cluster: Glycine-rich RNA-binding protein-like; ...    66   7e-10
UniRef50_A1CJX8 Cluster: Glycine-rich RNA-binding protein, putat...    66   7e-10
UniRef50_A7PG82 Cluster: Chromosome chr6 scaffold_15, whole geno...    66   9e-10
UniRef50_A5BSV4 Cluster: Putative uncharacterized protein; n=1; ...    66   9e-10
UniRef50_A7ART3 Cluster: Ribonucleoprotein, putative; n=1; Babes...    65   1e-09
UniRef50_UPI0000F2CBBE Cluster: PREDICTED: similar to musashi ho...    65   2e-09
UniRef50_UPI0000E4615D Cluster: PREDICTED: similar to heterogene...    65   2e-09
UniRef50_A3FQK0 Cluster: RNA recognition motif (RRM)-containing ...    65   2e-09
UniRef50_UPI00005A129E Cluster: PREDICTED: similar to Heterogene...    64   2e-09
UniRef50_A7SIF0 Cluster: Predicted protein; n=1; Nematostella ve...    64   2e-09
UniRef50_Q02926 Cluster: Ribonucleoprotein RB97D; n=7; Sophophor...    64   2e-09
UniRef50_Q6ZZX5 Cluster: Heterogeneous nuclear ribonucleoprotein...    64   3e-09
UniRef50_Q75KB4 Cluster: Putative RNA binding protein; n=4; Oryz...    64   3e-09
UniRef50_A2YWJ2 Cluster: Putative uncharacterized protein; n=3; ...    64   3e-09
UniRef50_Q26658 Cluster: Stage specific activator protein; n=3; ...    64   3e-09
UniRef50_Q5JK61 Cluster: RNA recognition motif (RRM)-containing ...    64   4e-09
UniRef50_Q4PBV1 Cluster: Putative uncharacterized protein; n=1; ...    63   5e-09
UniRef50_Q40437 Cluster: RGP-3; n=2; Nicotiana|Rep: RGP-3 - Nico...    63   6e-09
UniRef50_UPI0000E4A54D Cluster: PREDICTED: hypothetical protein;...    62   8e-09
UniRef50_Q10N14 Cluster: RNA recognition motif family protein, e...    62   8e-09
UniRef50_Q6VYI5 Cluster: TARDBP S8; n=8; Coelomata|Rep: TARDBP S...    62   1e-08
UniRef50_Q5PPI5 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_Q05C33 Cluster: Tardbp protein; n=14; Coelomata|Rep: Ta...    62   1e-08
UniRef50_A5KRV2 Cluster: RNP-1 like RNA-binding protein; n=1; ca...    62   1e-08
UniRef50_Q501B0 Cluster: At2g46780; n=3; core eudicotyledons|Rep...    62   1e-08
UniRef50_Q6X9Z2 Cluster: HnRNP core protein A1; n=2; Laurasiathe...    62   1e-08
UniRef50_O75526 Cluster: RNA-binding motif protein, X-linked-lik...    62   1e-08
UniRef50_UPI0000211FC5 Cluster: PREDICTED: RNA binding motif pro...    62   1e-08
UniRef50_UPI0000EB42F3 Cluster: UPI0000EB42F3 related cluster; n...    62   1e-08
UniRef50_Q94AC3 Cluster: AT4g36960/C7A10_400; n=11; Magnoliophyt...    62   1e-08
UniRef50_Q2V9B8 Cluster: RNA-binding protein AKIP1-like; n=1; So...    61   2e-08
UniRef50_O64571 Cluster: Putative RNA-binding protein; n=3; Arab...    61   2e-08
UniRef50_A7RU25 Cluster: Predicted protein; n=1; Nematostella ve...    61   2e-08
UniRef50_Q1DPW0 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_Q13148 Cluster: TAR DNA-binding protein 43; n=36; Coelo...    61   2e-08
UniRef50_Q4SJ02 Cluster: Chromosome 21 SCAF14577, whole genome s...    61   3e-08
UniRef50_Q94BU4 Cluster: At1g33470/F10C21_14; n=2; Arabidopsis t...    61   3e-08
UniRef50_Q8LLE6 Cluster: RNA-binding protein AKIP1; n=7; core eu...    61   3e-08
UniRef50_UPI0000D9F579 Cluster: PREDICTED: similar to testes-spe...    60   3e-08
UniRef50_Q8VXC4 Cluster: Glycine rich RNA binding protein; n=20;...    60   3e-08
UniRef50_Q8RYD4 Cluster: UBP1 interacting protein 1a; n=5; Arabi...    60   3e-08
UniRef50_Q5K249 Cluster: Putative glycine-rich RNA-binding prote...    60   3e-08
UniRef50_A7PVU6 Cluster: Chromosome chr8 scaffold_34, whole geno...    60   3e-08
UniRef50_Q6MCT2 Cluster: Probable nucleic acid-binding protein; ...    60   4e-08
UniRef50_Q67W00 Cluster: Putative RRM-containing protein; n=2; O...    60   4e-08
UniRef50_Q54D98 Cluster: Putative uncharacterized protein; n=1; ...    60   4e-08
UniRef50_Q8GU29 Cluster: Glycin-rich RNA binding protein; n=6; c...    60   6e-08
UniRef50_Q5ZAN1 Cluster: Putative uncharacterized protein OSJNBb...    60   6e-08
UniRef50_Q5CT90 Cluster: RRM domain containing protein; n=1; Cry...    60   6e-08
UniRef50_A7RRA7 Cluster: Predicted protein; n=1; Nematostella ve...    60   6e-08
UniRef50_Q9SVM8 Cluster: Glycine-rich RNA-binding protein 2, mit...    60   6e-08
UniRef50_A5BGN9 Cluster: Putative uncharacterized protein; n=1; ...    59   8e-08
UniRef50_Q4D4H5 Cluster: Putative uncharacterized protein; n=2; ...    59   8e-08
UniRef50_Q03250 Cluster: Glycine-rich RNA-binding protein 7; n=1...    59   8e-08
UniRef50_UPI0000E4A88D Cluster: PREDICTED: similar to MGC88935 p...    59   1e-07
UniRef50_Q8RWN5 Cluster: RNA-binding protein-like; n=3; Arabidop...    59   1e-07
UniRef50_O45189 Cluster: Suppressor protein 12; n=2; Caenorhabdi...    59   1e-07
UniRef50_Q09100 Cluster: RNA-binding protein rnp24; n=1; Schizos...    59   1e-07
UniRef50_Q83CD7 Cluster: Nucleic acid binding domain protein; n=...    58   1e-07
UniRef50_A0H648 Cluster: RNA-binding region RNP-1; n=3; Chlorofl...    58   1e-07
UniRef50_Q3ED69 Cluster: Uncharacterized protein At1g22910.3; n=...    58   1e-07
UniRef50_Q10RZ0 Cluster: RNA recognition motif family protein, e...    58   1e-07
UniRef50_A2WN71 Cluster: Putative uncharacterized protein; n=2; ...    58   1e-07
UniRef50_A7APD8 Cluster: RNA recognition motif domain containing...    58   1e-07
UniRef50_A0C337 Cluster: Chromosome undetermined scaffold_146, w...    58   1e-07
UniRef50_Q9BX46 Cluster: RNA-binding protein 24; n=52; Eumetazoa...    58   1e-07
UniRef50_A7QJF1 Cluster: Chromosome chr8 scaffold_106, whole gen...    58   2e-07
UniRef50_Q4XN28 Cluster: RNA binding protein, putative; n=6; Pla...    58   2e-07
UniRef50_Q4QAH4 Cluster: Putative uncharacterized protein; n=3; ...    58   2e-07
UniRef50_Q14011 Cluster: Cold-inducible RNA-binding protein; n=6...    58   2e-07
UniRef50_UPI0000E47947 Cluster: PREDICTED: similar to GA10247-PA...    58   2e-07
UniRef50_UPI00005A96C6 Cluster: PREDICTED: similar to Heterogene...    58   2e-07
UniRef50_Q6IRQ4 Cluster: MGC82187 protein; n=6; Tetrapoda|Rep: M...    58   2e-07
UniRef50_A3QQP3 Cluster: Chloroplast single strand DNA binding p...    58   2e-07
UniRef50_A7SHQ6 Cluster: Predicted protein; n=1; Nematostella ve...    58   2e-07
UniRef50_Q7NHK5 Cluster: RNA-binding protein; n=10; cellular org...    57   3e-07
UniRef50_A2FQN0 Cluster: Putative uncharacterized protein; n=1; ...    57   3e-07
UniRef50_Q0U9M6 Cluster: Putative uncharacterized protein; n=1; ...    57   3e-07
UniRef50_UPI000065DEA8 Cluster: RNA-binding protein 24 (RNA-bind...    57   4e-07
UniRef50_Q8LFQ5 Cluster: RNA binding protein-like; n=4; Arabidop...    57   4e-07
UniRef50_O23189 Cluster: RNA-binding like protein; n=1; Arabidop...    57   4e-07
UniRef50_Q7SGB3 Cluster: Predicted protein; n=5; Eukaryota|Rep: ...    57   4e-07
UniRef50_Q9H0Z9 Cluster: RNA-binding protein 38; n=16; Eutheria|...    57   4e-07
UniRef50_P41891 Cluster: Protein gar2; n=12; Ascomycota|Rep: Pro...    57   4e-07
UniRef50_Q5EUH9 Cluster: Putative uncharacterized protein; n=1; ...    56   5e-07
UniRef50_Q9FI04 Cluster: Arabidopsis thaliana genomic DNA, chrom...    56   5e-07
UniRef50_A2AX49 Cluster: RNA recognition motif 1; n=1; Guillardi...    56   5e-07
UniRef50_P80350 Cluster: Heterogeneous nuclear ribonucleoprotein...    56   5e-07
UniRef50_Q03251 Cluster: Glycine-rich RNA-binding protein 8; n=7...    56   5e-07
UniRef50_UPI000049A3A1 Cluster: RNA-binding protein; n=1; Entamo...    56   7e-07
UniRef50_Q7XTU5 Cluster: OSJNBb0034I13.9 protein; n=4; Oryza sat...    56   7e-07
UniRef50_Q109W0 Cluster: RNA recognition motif family protein, e...    56   7e-07
UniRef50_Q18724 Cluster: Putative uncharacterized protein; n=2; ...    56   7e-07
UniRef50_Q13595 Cluster: Transformer-2 protein homolog; n=57; Eu...    56   7e-07
UniRef50_Q4T824 Cluster: Chromosome undetermined SCAF7912, whole...    56   9e-07
UniRef50_Q9C5A7 Cluster: Putative uncharacterized protein At5g08...    56   9e-07
UniRef50_Q552K5 Cluster: Putative uncharacterized protein; n=1; ...    56   9e-07
UniRef50_Q4U8S8 Cluster: RNA-binding protein, putative; n=2; The...    56   9e-07
UniRef50_A5K494 Cluster: Nucleic acid binding factor, putative; ...    56   9e-07
UniRef50_A0E382 Cluster: Chromosome undetermined scaffold_76, wh...    56   9e-07
UniRef50_UPI0000E4A86C Cluster: PREDICTED: hypothetical protein,...    55   1e-06
UniRef50_UPI0000E4800D Cluster: PREDICTED: similar to RNA bindin...    55   1e-06
UniRef50_Q9FI08 Cluster: Similarity to RNA-binding protein; n=1;...    55   1e-06
UniRef50_Q012A5 Cluster: Ps16 protein; n=2; Ostreococcus|Rep: Ps...    55   1e-06
UniRef50_Q6ZR81 Cluster: CDNA FLJ46566 fis, clone THYMU3040829, ...    55   1e-06
UniRef50_A7TPL8 Cluster: Putative uncharacterized protein; n=1; ...    55   1e-06
UniRef50_Q9D8T7 Cluster: SRA stem-loop-interacting RNA-binding p...    55   1e-06
UniRef50_Q83D11 Cluster: RNA-binding protein; n=3; Coxiella burn...    55   2e-06
UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; ce...    55   2e-06
UniRef50_A7PMT7 Cluster: Chromosome chr14 scaffold_21, whole gen...    55   2e-06
UniRef50_A3AAN7 Cluster: Putative uncharacterized protein; n=2; ...    55   2e-06
UniRef50_Q5BXS3 Cluster: SJCHGC01369 protein; n=2; Schistosoma j...    55   2e-06
UniRef50_Q4PI99 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_A6RGV4 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_Q6DHU2 Cluster: Zgc:92062; n=4; Clupeocephala|Rep: Zgc:...    54   2e-06
UniRef50_Q1PES4 Cluster: RNA recognition motif-containing protei...    54   2e-06
UniRef50_A7PA84 Cluster: Chromosome chr14 scaffold_9, whole geno...    54   2e-06
UniRef50_Q0KHQ1 Cluster: CG33714-PA, isoform A; n=2; Diptera|Rep...    54   2e-06
UniRef50_A7SIE8 Cluster: Predicted protein; n=2; Nematostella ve...    54   2e-06
UniRef50_UPI000065FE7B Cluster: RNA-binding protein 38 (RNA-bind...    54   3e-06
UniRef50_A0KJ75 Cluster: RNA-binding protein; n=5; Bacteria|Rep:...    54   3e-06
UniRef50_Q5JJM4 Cluster: Peptidylprolyl cis-trans isomerase-like...    54   3e-06
UniRef50_Q8IIT2 Cluster: Nucleic acid binding factor, putative; ...    54   3e-06
UniRef50_Q5BW90 Cluster: SJCHGC05136 protein; n=1; Schistosoma j...    54   3e-06
UniRef50_Q553V5 Cluster: Putative uncharacterized protein; n=4; ...    54   3e-06
UniRef50_Q4MZK1 Cluster: Nucleic acid binding factor, putative; ...    54   3e-06
UniRef50_A2QQZ9 Cluster: Similarity to oligouridylate binding pr...    54   3e-06
UniRef50_Q08208 Cluster: Nucleolar protein 12; n=5; Saccharomyce...    54   3e-06
UniRef50_UPI00015B48C0 Cluster: PREDICTED: similar to LOC443584 ...    54   4e-06
UniRef50_UPI0000E45D7B Cluster: PREDICTED: similar to heterogene...    54   4e-06
UniRef50_Q11SF1 Cluster: RNA binding protein; n=6; Bacteria|Rep:...    54   4e-06
UniRef50_Q015S2 Cluster: Single-stranded DNA binding protein, pu...    54   4e-06
UniRef50_Q5KP81 Cluster: Transformer-2-beta isoform 3, putative;...    54   4e-06
UniRef50_Q4S5L6 Cluster: Chromosome 9 SCAF14729, whole genome sh...    53   5e-06
UniRef50_Q01L95 Cluster: OSIGBa0137L20.5 protein; n=7; Oryza sat...    53   5e-06
UniRef50_Q5I705 Cluster: Transformer 2; n=2; Endopterygota|Rep: ...    53   5e-06
UniRef50_Q32P59 Cluster: SRA stem-loop-interacting RNA-binding p...    53   5e-06
UniRef50_A6GJJ1 Cluster: Probable nucleic acid-binding protein; ...    53   7e-06
UniRef50_Q9LES2 Cluster: Putative uncharacterized protein T8M16_...    53   7e-06
UniRef50_O24306 Cluster: Ribonucleoprotein; n=3; Pisum sativum|R...    53   7e-06
UniRef50_A7NXI6 Cluster: Chromosome chr5 scaffold_2, whole genom...    53   7e-06
UniRef50_Q8IE99 Cluster: Splicing factor, putative; n=1; Plasmod...    53   7e-06
UniRef50_Q5D9L3 Cluster: SJCHGC09366 protein; n=1; Schistosoma j...    53   7e-06
UniRef50_A2EKZ8 Cluster: Putative uncharacterized protein; n=2; ...    53   7e-06
UniRef50_Q6BQ88 Cluster: Debaryomyces hansenii chromosome E of s...    53   7e-06
UniRef50_Q15414 Cluster: RNA-binding motif protein, Y chromosome...    53   7e-06
UniRef50_Q14498 Cluster: RNA-binding protein 39; n=55; Euteleost...    53   7e-06
UniRef50_UPI0000DB7056 Cluster: PREDICTED: similar to RNA bindin...    52   9e-06
UniRef50_Q1LV83 Cluster: Novel protein; n=4; Danio rerio|Rep: No...    52   9e-06
UniRef50_Q1IV44 Cluster: RNA-binding protein, RNP-1; n=2; Bacter...    52   9e-06
UniRef50_A7CQC8 Cluster: RNP-1 like RNA-binding protein; n=1; Op...    52   9e-06
UniRef50_Q4Q941 Cluster: Putative uncharacterized protein; n=5; ...    52   9e-06
UniRef50_Q4H2Q6 Cluster: Ci-Tardbp protein; n=1; Ciona intestina...    52   9e-06
UniRef50_Q75AJ0 Cluster: ADL063Wp; n=1; Eremothecium gossypii|Re...    52   9e-06
UniRef50_Q2GTP8 Cluster: Putative uncharacterized protein; n=1; ...    52   9e-06
UniRef50_Q5KBW2 Cluster: Polyadenylate-binding protein, cytoplas...    52   9e-06
UniRef50_Q4RJP2 Cluster: Chromosome 13 SCAF15035, whole genome s...    52   1e-05
UniRef50_Q9SIX3 Cluster: Putative glycine-rich RNA-binding prote...    52   1e-05
UniRef50_A7QX84 Cluster: Chromosome undetermined scaffold_215, w...    52   1e-05
UniRef50_A7PX80 Cluster: Chromosome chr12 scaffold_36, whole gen...    52   1e-05
UniRef50_A2XEH7 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q95QL3 Cluster: Putative uncharacterized protein; n=2; ...    52   1e-05
UniRef50_Q8IMX4 Cluster: CG5422-PD, isoform D; n=14; Endopterygo...    52   1e-05
UniRef50_Q8I2Y5 Cluster: RNA-binding protein, putative; n=4; Pla...    52   1e-05
UniRef50_A7RFA9 Cluster: Predicted protein; n=1; Nematostella ve...    52   1e-05
UniRef50_A6N9V7 Cluster: RNA binding protein; n=1; Ornithodoros ...    52   1e-05
UniRef50_Q01085 Cluster: Nucleolysin TIAR; n=67; Euteleostomi|Re...    52   1e-05
UniRef50_Q6C2Q7 Cluster: Nucleolar protein 12; n=1; Yarrowia lip...    52   1e-05
UniRef50_Q9LNV4 Cluster: F22G5.31; n=12; Magnoliophyta|Rep: F22G...    52   2e-05
UniRef50_Q9VHP3 Cluster: CG8021-PA; n=3; Diptera|Rep: CG8021-PA ...    52   2e-05
UniRef50_O44530 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_A2EQG8 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_Q4PFD1 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_A3LZJ7 Cluster: Predicted protein; n=2; Pichia|Rep: Pre...    52   2e-05
UniRef50_UPI0000E806AC Cluster: PREDICTED: hypothetical protein;...    51   2e-05
UniRef50_Q7NCQ3 Cluster: RNA-binding protein; n=1; Gloeobacter v...    51   2e-05
UniRef50_A1ZVR6 Cluster: RNA-binding protein, RNP-1; n=1; Micros...    51   2e-05
UniRef50_Q9FX45 Cluster: RNA-binding glycine-rich protein, putat...    51   2e-05
UniRef50_A7S6X1 Cluster: Predicted protein; n=1; Nematostella ve...    51   2e-05
UniRef50_Q75E07 Cluster: ABL134Cp; n=1; Eremothecium gossypii|Re...    51   2e-05
UniRef50_Q6CHZ9 Cluster: Similar to tr|Q9C232 Neurospora crassa ...    51   2e-05
UniRef50_Q6BMT1 Cluster: Similar to CA5935|IPF2798 Candida albic...    51   2e-05
UniRef50_Q2URK9 Cluster: Predicted protein; n=1; Aspergillus ory...    51   2e-05
UniRef50_A5E774 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_Q00916 Cluster: U1 small nuclear ribonucleoprotein 70 k...    51   2e-05
UniRef50_P39697 Cluster: 40S ribosomal protein S19, mitochondria...    51   2e-05
UniRef50_Q24207 Cluster: Protein boule; n=8; Diptera|Rep: Protei...    51   2e-05
UniRef50_Q8N9W6 Cluster: Protein boule-like; n=35; Eumetazoa|Rep...    51   2e-05
UniRef50_O35698 Cluster: RNA-binding protein; n=7; Mus musculus|...    51   3e-05
UniRef50_A7QJZ9 Cluster: Chromosome undetermined scaffold_109, w...    51   3e-05
UniRef50_A7NYH5 Cluster: Chromosome chr6 scaffold_3, whole genom...    51   3e-05
UniRef50_Q9N3S4 Cluster: Rnp (Rrm rna binding domain) containing...    51   3e-05
UniRef50_Q54RW5 Cluster: Putative uncharacterized protein; n=1; ...    51   3e-05
UniRef50_Q54PB2 Cluster: RNA-binding region-containing protein; ...    51   3e-05
UniRef50_Q4U9D6 Cluster: RNA binding protein, putative; n=2; The...    51   3e-05
UniRef50_A7SUY1 Cluster: Predicted protein; n=1; Nematostella ve...    51   3e-05
UniRef50_A7AV01 Cluster: RNA binding protein, putative; n=1; Bab...    51   3e-05
UniRef50_A7EHY4 Cluster: Putative uncharacterized protein; n=1; ...    51   3e-05
UniRef50_P62995 Cluster: Splicing factor, arginine/serine-rich 1...    51   3e-05
UniRef50_P40561 Cluster: RNA-binding protein SGN1; n=2; Saccharo...    51   3e-05
UniRef50_P53883 Cluster: Nucleolar protein 13; n=5; Saccharomyce...    51   3e-05
UniRef50_UPI0000E46272 Cluster: PREDICTED: hypothetical protein;...    50   4e-05
UniRef50_UPI0000D567E5 Cluster: PREDICTED: similar to CG5422-PB,...    50   4e-05
UniRef50_UPI000023E598 Cluster: hypothetical protein FG10156.1; ...    50   4e-05
UniRef50_UPI000065D989 Cluster: RNA-binding protein 28 (RNA-bind...    50   4e-05
UniRef50_Q3J7I0 Cluster: RNA-binding protein, RNP-1; n=1; Nitros...    50   4e-05
UniRef50_O25501 Cluster: Ss-DNA binding protein 12RNP2; n=4; Hel...    50   4e-05
UniRef50_A2XBX0 Cluster: Putative uncharacterized protein; n=2; ...    50   4e-05
UniRef50_Q5CXY1 Cluster: T8M16_190 RRM protein of possible plant...    50   4e-05
UniRef50_Q55C97 Cluster: Putative uncharacterized protein; n=1; ...    50   4e-05
UniRef50_Q6C747 Cluster: Yarrowia lipolytica chromosome E of str...    50   4e-05
UniRef50_Q5KHU8 Cluster: MRNA catabolism, nonsense-mediated-rela...    50   4e-05
UniRef50_A6QZK0 Cluster: Predicted protein; n=1; Ajellomyces cap...    50   4e-05
UniRef50_Q9HEQ9 Cluster: Single-stranded TG1-3 DNA-binding prote...    50   4e-05
UniRef50_O14327 Cluster: Polyadenylate-binding protein 2 (Poly(A...    50   4e-05
UniRef50_O13741 Cluster: Nucleolar protein 12; n=1; Schizosaccha...    50   4e-05
UniRef50_UPI00015B552E Cluster: PREDICTED: similar to bruno; n=1...    50   5e-05
UniRef50_A3J4E6 Cluster: RNA binding protein; n=4; cellular orga...    50   5e-05
UniRef50_A2Y1R0 Cluster: Putative uncharacterized protein; n=7; ...    50   5e-05
UniRef50_Q57U22 Cluster: Putative uncharacterized protein; n=1; ...    50   5e-05
UniRef50_A7AQD9 Cluster: RNA recognition motif containing protei...    50   5e-05
UniRef50_Q76IQ0 Cluster: Putative uncharacterized protein SGN1; ...    50   5e-05
UniRef50_Q5KP11 Cluster: Single-stranded DNA binding protein, pu...    50   5e-05
UniRef50_Q4P2L3 Cluster: Putative uncharacterized protein; n=1; ...    50   5e-05
UniRef50_Q2HG12 Cluster: Putative uncharacterized protein; n=2; ...    50   5e-05
UniRef50_A1C467 Cluster: RNA binding domain protein; n=1; Asperg...    50   5e-05
UniRef50_UPI0000E49AC7 Cluster: PREDICTED: similar to Snrp70 pro...    50   6e-05
UniRef50_UPI0000D578A0 Cluster: PREDICTED: similar to CG12870-PA...    50   6e-05
UniRef50_UPI00006CFFFC Cluster: RNA binding protein; n=1; Tetrah...    50   6e-05
UniRef50_UPI00004996C0 Cluster: RNA-binding protein; n=1; Entamo...    50   6e-05
UniRef50_Q569S7 Cluster: LOC443584 protein; n=5; Xenopus|Rep: LO...    50   6e-05
UniRef50_Q8DIY8 Cluster: RNA binding protein; n=3; Cyanobacteria...    50   6e-05
UniRef50_A6VVI5 Cluster: RNP-1 like RNA-binding protein; n=3; Ga...    50   6e-05
UniRef50_A6E8T2 Cluster: RNA-binding protein; n=1; Pedobacter sp...    50   6e-05
UniRef50_Q9FZ84 Cluster: F26I16.3 protein; n=2; Arabidopsis thal...    50   6e-05
UniRef50_Q0ITI7 Cluster: Os11g0250000 protein; n=5; Oryza sativa...    50   6e-05
UniRef50_Q0D9E5 Cluster: Os06g0724600 protein; n=3; Oryza sativa...    50   6e-05
UniRef50_A7QT40 Cluster: Chromosome undetermined scaffold_165, w...    50   6e-05
UniRef50_A3BFI4 Cluster: Putative uncharacterized protein; n=4; ...    50   6e-05
UniRef50_Q7RIJ3 Cluster: RNA recognition motif, putative; n=3; P...    50   6e-05
UniRef50_Q70TB2 Cluster: Transformer-2 protein; n=1; Bactrocera ...    50   6e-05
UniRef50_Q18318 Cluster: Putative uncharacterized protein C30B5....    50   6e-05
UniRef50_A0BM94 Cluster: Chromosome undetermined scaffold_116, w...    50   6e-05
UniRef50_A0BHN3 Cluster: Chromosome undetermined scaffold_108, w...    50   6e-05
UniRef50_Q5KBA9 Cluster: Putative uncharacterized protein; n=1; ...    50   6e-05
UniRef50_A6SJV1 Cluster: Putative uncharacterized protein; n=2; ...    50   6e-05
UniRef50_P19684 Cluster: 33 kDa ribonucleoprotein, chloroplast p...    50   6e-05
UniRef50_UPI0000E1183F Cluster: hypothetical protein OM2255_1662...    49   8e-05
UniRef50_UPI0000587D6B Cluster: PREDICTED: similar to 2410104I19...    49   8e-05
UniRef50_UPI0000498349 Cluster: RNA-binding protein; n=1; Entamo...    49   8e-05
UniRef50_Q3B6Q3 Cluster: RNA-binding region RNP-1; n=6; Chlorobi...    49   8e-05
UniRef50_O83375 Cluster: RNA-binding protein, putative; n=1; Tre...    49   8e-05
UniRef50_A6E971 Cluster: RNA binding protein; n=1; Pedobacter sp...    49   8e-05
UniRef50_A5GEF6 Cluster: RNP-1 like RNA-binding protein; n=1; Ge...    49   8e-05
UniRef50_Q9LKA4 Cluster: Similarity to RNA-binding protein; n=5;...    49   8e-05
UniRef50_Q9FIB8 Cluster: Splicing factor-like protein; n=12; Mag...    49   8e-05
UniRef50_Q9FFZ6 Cluster: Similarity to RNA-binding protein; n=2;...    49   8e-05
UniRef50_Q93233 Cluster: Putative uncharacterized protein pabp-2...    49   8e-05
UniRef50_Q5CSH1 Cluster: Ro ribonucleoprotein-binding protein 1,...    49   8e-05
UniRef50_Q57TU8 Cluster: RNA-binding protein, putative; n=1; Try...    49   8e-05
UniRef50_Q54G90 Cluster: Putative uncharacterized protein; n=1; ...    49   8e-05
UniRef50_A7RZJ6 Cluster: Predicted protein; n=1; Nematostella ve...    49   8e-05
UniRef50_A7RTC5 Cluster: Predicted protein; n=1; Nematostella ve...    49   8e-05
UniRef50_A0CBK1 Cluster: Chromosome undetermined scaffold_164, w...    49   8e-05
UniRef50_Q9Y7Y3 Cluster: RNA-binding protein; n=1; Schizosacchar...    49   8e-05
UniRef50_Q7SFZ5 Cluster: Putative uncharacterized protein NCU030...    49   8e-05
UniRef50_Q5KIS6 Cluster: Putative uncharacterized protein; n=1; ...    49   8e-05
UniRef50_A5DZJ4 Cluster: Putative uncharacterized protein; n=1; ...    49   8e-05
UniRef50_P49314 Cluster: 31 kDa ribonucleoprotein, chloroplast p...    49   8e-05
UniRef50_Q44560 Cluster: Putative RNA-binding protein rbpA; n=4;...    49   8e-05
UniRef50_Q9Y388 Cluster: RNA-binding motif protein, X-linked 2; ...    49   8e-05
UniRef50_UPI00015B621E Cluster: PREDICTED: hypothetical protein;...    49   1e-04
UniRef50_Q74DJ2 Cluster: RNA-binding protein; n=2; Geobacter|Rep...    49   1e-04
UniRef50_Q72SG0 Cluster: Glycine rich RNA-binding protein; n=4; ...    49   1e-04
UniRef50_Q9ZUJ3 Cluster: T2K10.5 protein; n=3; Magnoliophyta|Rep...    49   1e-04
UniRef50_Q10N84 Cluster: RNA-binding protein, putative, expresse...    49   1e-04
UniRef50_A5BIG2 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_A2YI08 Cluster: Putative uncharacterized protein; n=2; ...    49   1e-04
UniRef50_Q59G98 Cluster: TIA1 protein variant; n=5; Euteleostomi...    49   1e-04
UniRef50_Q9C222 Cluster: Putative uncharacterized protein B8L3.0...    49   1e-04
UniRef50_Q8SRE5 Cluster: CLEAVAGE STIMULATION FACTOR; n=2; Micro...    49   1e-04
UniRef50_Q5KC60 Cluster: Polyadenylation factor 64 kDa subunit, ...    49   1e-04
UniRef50_Q2VAZ4 Cluster: Grp1p; n=3; Pezizomycotina|Rep: Grp1p -...    49   1e-04
UniRef50_Q00880 Cluster: Cutinase negative acting protein; n=2; ...    49   1e-04
UniRef50_A6S9X8 Cluster: Putative uncharacterized protein; n=2; ...    49   1e-04
UniRef50_Q43349 Cluster: 29 kDa ribonucleoprotein, chloroplast p...    49   1e-04
UniRef50_Q9WX39 Cluster: Putative RNA-binding protein rbpF; n=10...    49   1e-04
UniRef50_Q9NW13 Cluster: RNA-binding protein 28; n=26; Euteleost...    49   1e-04
UniRef50_Q8T6B9 Cluster: Poly(U)-binding-splicing factor half pi...    49   1e-04
UniRef50_UPI0000E45F82 Cluster: PREDICTED: hypothetical protein;...    48   1e-04
UniRef50_UPI00006CBFBB Cluster: probable RNA-binding protein; n=...    48   1e-04
UniRef50_UPI000049956B Cluster: RNA-binding protein; n=1; Entamo...    48   1e-04
UniRef50_Q9D8T7-2 Cluster: Isoform 2 of Q9D8T7 ; n=2; Euarchonto...    48   1e-04
UniRef50_Q4TA11 Cluster: Chromosome undetermined SCAF7478, whole...    48   1e-04
UniRef50_Q4QRG7 Cluster: Zgc:113884; n=5; Danio rerio|Rep: Zgc:1...    48   1e-04
UniRef50_Q5ZYW0 Cluster: RNA binding protein, cold-inducible rrm...    48   1e-04
UniRef50_Q48A10 Cluster: RNA-binding protein; n=2; Alteromonadal...    48   1e-04
UniRef50_A7MXD2 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_Q84T66 Cluster: Expressed protein; n=2; Oryza sativa|Re...    48   1e-04
UniRef50_Q2HTD6 Cluster: RNA-binding region RNP-1 (RNA recogniti...    48   1e-04
UniRef50_A7QLH7 Cluster: Chromosome undetermined scaffold_119, w...    48   1e-04
UniRef50_A7PZY6 Cluster: Chromosome chr8 scaffold_41, whole geno...    48   1e-04
UniRef50_Q9VJG2 Cluster: CG12288-PA; n=2; Drosophila melanogaste...    48   1e-04
UniRef50_Q5CRM8 Cluster: T8M16_190-plant like protein with RRM d...    48   1e-04
UniRef50_Q57XH6 Cluster: RNA-binding protein, putative; n=1; Try...    48   1e-04
UniRef50_Q54LV5 Cluster: RNA-binding region-containing protein; ...    48   1e-04
UniRef50_Q1JSB7 Cluster: RNA binding protein, putative; n=1; Tox...    48   1e-04
UniRef50_A7SSV8 Cluster: Predicted protein; n=1; Nematostella ve...    48   1e-04
UniRef50_A7RM72 Cluster: Predicted protein; n=1; Nematostella ve...    48   1e-04
UniRef50_A7APK1 Cluster: RNA recognition motif domain containing...    48   1e-04
UniRef50_A2EWD1 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_A2DHF2 Cluster: Putative uncharacterized protein; n=2; ...    48   1e-04
UniRef50_Q6CHX5 Cluster: Similar to sp|P53883 Saccharomyces cere...    48   1e-04
UniRef50_Q0TVC9 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_Q1DXH0 Cluster: Polyadenylate-binding protein, cytoplas...    48   1e-04
UniRef50_UPI0000D5678A Cluster: PREDICTED: similar to CG10466-PA...    48   2e-04
UniRef50_P73557 Cluster: RNA-binding protein; n=2; Chroococcales...    48   2e-04
UniRef50_Q6ID29 Cluster: At4g13860; n=9; cellular organisms|Rep:...    48   2e-04
UniRef50_Q552N9 Cluster: RNA-binding region-containing protein; ...    48   2e-04
UniRef50_Q54ZV8 Cluster: RNA-binding region-containing protein; ...    48   2e-04
UniRef50_Q4UHB5 Cluster: RNA-binding protein, putative; n=2; The...    48   2e-04
UniRef50_Q6CQW2 Cluster: Similarities with sp|Q8J1F4 Ashbya goss...    48   2e-04
UniRef50_Q6C1T7 Cluster: Similar to DEHA0A13563g Debaryomyces ha...    48   2e-04
UniRef50_Q6CEK8 Cluster: Histone-lysine N-methyltransferase, H3 ...    48   2e-04
UniRef50_Q5AJS6 Cluster: Multiple RNA-binding domain-containing ...    48   2e-04
UniRef50_UPI0000E476D6 Cluster: PREDICTED: hypothetical protein;...    48   2e-04
UniRef50_UPI000049910F Cluster: RNA-binding protein; n=3; Entamo...    48   2e-04
UniRef50_Q01B63 Cluster: RNA recognition motif; n=2; Ostreococcu...    48   2e-04
UniRef50_A7PXT7 Cluster: Chromosome chr15 scaffold_37, whole gen...    48   2e-04
UniRef50_A3C5F0 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_Q9XTZ2 Cluster: Putative uncharacterized protein rsp-8;...    48   2e-04
UniRef50_Q9U2F5 Cluster: Putative uncharacterized protein; n=2; ...    48   2e-04
UniRef50_Q95QV8 Cluster: Putative uncharacterized protein; n=6; ...    48   2e-04
UniRef50_Q4N6Y8 Cluster: RNA-binding protein, putative; n=2; The...    48   2e-04
UniRef50_A7SMA3 Cluster: Predicted protein; n=3; Nematostella ve...    48   2e-04
UniRef50_A7AWX7 Cluster: RNA recognition motif. (A.k.a. RRM, RBD...    48   2e-04
UniRef50_A5K320 Cluster: Splicing factor, putative; n=5; Plasmod...    48   2e-04
UniRef50_A5DDT0 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_P31483 Cluster: Nucleolysin TIA-1 isoform p40 (RNA-bind...    48   2e-04
UniRef50_P82277 Cluster: Plastid-specific 30S ribosomal protein ...    48   2e-04
UniRef50_Q86U42 Cluster: Polyadenylate-binding protein 2 (Poly(A...    48   2e-04
UniRef50_P15771 Cluster: Nucleolin; n=25; Deuterostomia|Rep: Nuc...    48   2e-04
UniRef50_UPI0001555B84 Cluster: PREDICTED: similar to PP239 prot...    47   3e-04
UniRef50_UPI000065D37A Cluster: ELAV-like protein 3 (Hu-antigen ...    47   3e-04
UniRef50_Q9KVI6 Cluster: RNA-binding protein; n=17; Vibrionaceae...    47   3e-04
UniRef50_Q7U7Q8 Cluster: PutativeRNA-binding protein RbpD; n=9; ...    47   3e-04
UniRef50_Q8W2K5 Cluster: Phragmoplastin-interacting protein PHIP...    47   3e-04
UniRef50_Q6YWP9 Cluster: RNA recognition motif (RRM)-containing ...    47   3e-04
UniRef50_Q69IN4 Cluster: Ribonucleoprotein antigen-like; n=5; Ma...    47   3e-04
UniRef50_A5B3Z9 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_Q291D2 Cluster: GA10094-PA; n=1; Drosophila pseudoobscu...    47   3e-04
UniRef50_A0BZZ4 Cluster: Chromosome undetermined scaffold_14, wh...    47   3e-04
UniRef50_Q5KPK3 Cluster: Putative uncharacterized protein; n=2; ...    47   3e-04
UniRef50_Q5KLP3 Cluster: Poly(A) binding protein, putative; n=1;...    47   3e-04
UniRef50_A4QRR2 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_Q57014 Cluster: Putative RNA-binding protein rbpA; n=70...    47   3e-04
UniRef50_Q9UHX1 Cluster: Poly(U)-binding-splicing factor PUF60 (...    47   3e-04
UniRef50_Q06106 Cluster: Multiple RNA-binding domain-containing ...    47   3e-04
UniRef50_UPI00015B5342 Cluster: PREDICTED: hypothetical protein;...    47   4e-04
UniRef50_UPI000051A8B9 Cluster: PREDICTED: similar to CG1316-PA;...    47   4e-04
UniRef50_Q8EZU3 Cluster: RNA-binding protein; n=4; Leptospira|Re...    47   4e-04
UniRef50_Q9LJH8 Cluster: RNA binding protein nucleolysin; oligou...    47   4e-04
UniRef50_Q9FJE9 Cluster: Similarity to RNA binding protein; n=2;...    47   4e-04
UniRef50_Q1ECN0 Cluster: At2g27330; n=2; Arabidopsis thaliana|Re...    47   4e-04
UniRef50_Q10BX7 Cluster: RNA recognition motif family protein, e...    47   4e-04
UniRef50_A2YQN8 Cluster: Putative uncharacterized protein; n=4; ...    47   4e-04
UniRef50_Q55D63 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_Q54NB8 Cluster: RNA-binding region-containing protein; ...    47   4e-04
UniRef50_Q54ER1 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_Q4UCX7 Cluster: RNA poly(A)-binding protein, putative; ...    47   4e-04
UniRef50_Q3HM26 Cluster: Sex-lethal isoform 1; n=4; Bombyx mori|...    47   4e-04
UniRef50_Q245K5 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_Q22Z94 Cluster: RNA-binding motif protein 8; n=1; Tetra...    47   4e-04
UniRef50_Q16LK7 Cluster: Putative uncharacterized protein; n=2; ...    47   4e-04
UniRef50_O45577 Cluster: Putative uncharacterized protein cpf-2;...    47   4e-04
UniRef50_A7ARN5 Cluster: Ser/Arg-rich splicing factor, putative;...    47   4e-04
UniRef50_A5DNJ5 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_Q10422 Cluster: Uncharacterized RNA-binding protein C25...    47   4e-04
UniRef50_UPI0000E47D9B Cluster: PREDICTED: similar to TIA1 cytot...    46   6e-04
UniRef50_UPI0000DA279E Cluster: PREDICTED: similar to Heterogene...    46   6e-04
UniRef50_UPI00006CB36A Cluster: RNA binding motif protein; n=1; ...    46   6e-04
UniRef50_UPI000049A266 Cluster: RNA-binding protein; n=1; Entamo...    46   6e-04
UniRef50_UPI0000498DFA Cluster: splicing factor; n=2; Entamoeba ...    46   6e-04
UniRef50_Q6NWB3 Cluster: Splicing factor 3b, subunit 4; n=16; Eu...    46   6e-04
UniRef50_A4CFR2 Cluster: Putative uncharacterized protein; n=3; ...    46   6e-04
UniRef50_Q9SJT4 Cluster: Expressed protein; n=1; Arabidopsis tha...    46   6e-04
UniRef50_Q9LIH1 Cluster: Genomic DNA, chromosome 3, P1 clone:MFD...    46   6e-04
UniRef50_Q7XGR3 Cluster: RNA recognition motif family protein, e...    46   6e-04
UniRef50_Q10KP0 Cluster: RNA recognition motif family protein, e...    46   6e-04
UniRef50_A7P705 Cluster: Chromosome chr9 scaffold_7, whole genom...    46   6e-04
UniRef50_A3AVD4 Cluster: Putative uncharacterized protein; n=3; ...    46   6e-04
UniRef50_Q54CU2 Cluster: RNA-binding region-containing protein; ...    46   6e-04
UniRef50_Q4FXR7 Cluster: RNA binding protein, putative; n=3; Lei...    46   6e-04
UniRef50_A7SM09 Cluster: Predicted protein; n=4; Eumetazoa|Rep: ...    46   6e-04
UniRef50_A4V6M6 Cluster: Ras-GTPase-activating protein SH3-domai...    46   6e-04
UniRef50_A3FQ51 Cluster: Cutinase negative acting protein, putat...    46   6e-04
UniRef50_Q6BY19 Cluster: Debaryomyces hansenii chromosome A of s...    46   6e-04
UniRef50_Q5KP68 Cluster: Putative uncharacterized protein; n=3; ...    46   6e-04
UniRef50_Q5A297 Cluster: Potential RNA binding protein; n=2; Sac...    46   6e-04
UniRef50_Q0U8L8 Cluster: Putative uncharacterized protein; n=1; ...    46   6e-04
UniRef50_O74400 Cluster: RNA-binding protein; n=1; Schizosacchar...    46   6e-04
UniRef50_A5DUI5 Cluster: Putative uncharacterized protein; n=1; ...    46   6e-04
UniRef50_A3M0M8 Cluster: Predicted protein; n=2; Pichia|Rep: Pre...    46   6e-04
UniRef50_A3LV28 Cluster: Predicted protein; n=2; Saccharomycetal...    46   6e-04
UniRef50_Q15427 Cluster: Splicing factor 3B subunit 4; n=37; Euk...    46   6e-04
UniRef50_Q9UNP9 Cluster: Peptidyl-prolyl cis-trans isomerase E; ...    46   6e-04
UniRef50_Q2GSX8 Cluster: Polyadenylate-binding protein, cytoplas...    46   6e-04
UniRef50_Q4RX96 Cluster: Chromosome 11 SCAF14979, whole genome s...    42   7e-04
UniRef50_UPI0000515DAB Cluster: PREDICTED: similar to Polyadenyl...    46   8e-04
UniRef50_A1SSM5 Cluster: RNP-1 like RNA-binding protein precurso...    46   8e-04
UniRef50_Q9FIU6 Cluster: Similarity to RNA-binding protein; n=4;...    46   8e-04
UniRef50_Q84ZS8 Cluster: Putative uncharacterized protein OJ1127...    46   8e-04
UniRef50_Q6ZLD1 Cluster: Putative RRM RNA binding protein NSAP1;...    46   8e-04
UniRef50_Q494N5 Cluster: At4g35785; n=6; Embryophyta|Rep: At4g35...    46   8e-04

>UniRef50_Q08473 Cluster: RNA-binding protein squid; n=22;
           Endopterygota|Rep: RNA-binding protein squid -
           Drosophila melanogaster (Fruit fly)
          Length = 344

 Score =  152 bits (368), Expect = 8e-36
 Identities = 71/82 (86%), Positives = 74/82 (90%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+KELRDHFG YGEIESINVKTDP TGRSRGFAFIVF   E+IDKV AA
Sbjct: 57  KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAA 116

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
            EH IN+KKVDPKKAKARHGKI
Sbjct: 117 DEHIINSKKVDPKKAKARHGKI 138



 Score =  136 bits (330), Expect = 3e-31
 Identities = 62/89 (69%), Positives = 76/89 (85%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+  +   + FVGGL++EISD+EI+ +F +FG I+EVEMPFDK K+QRKGFCFITF+SE
Sbjct: 128 PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE 187

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           QVV DLLKTPK+ I GKEVDVKRATPKP+
Sbjct: 188 QVVTDLLKTPKQKIAGKEVDVKRATPKPE 216



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH K+FVGGL+ E +D+E++ +FG +G I  + +  D    + +GF FI F + + +  +
Sbjct: 134 RHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDL 193

Query: 181 MAAGEHTINNKKVDPKKA 234
           +   +  I  K+VD K+A
Sbjct: 194 LKTPKQKIAGKEVDVKRA 211



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ E+R+ F ++G I  + +  D    + +GF FI F + + ++ +    +
Sbjct: 59  FVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Query: 435 RTIGGKEVDVKRA 473
             I  K+VD K+A
Sbjct: 119 HIINSKKVDPKKA 131


>UniRef50_UPI0000DB6DF2 Cluster: PREDICTED: similar to squid
           CG16901-PC, isoform C; n=2; Apocrita|Rep: PREDICTED:
           similar to squid CG16901-PC, isoform C - Apis mellifera
          Length = 320

 Score =  122 bits (293), Expect = 1e-26
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 2/84 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLS  TTDKELRDHF  +GEIESI+VK DP TG SRGFAF+VF  P++IDK++A+
Sbjct: 60  KLFVGGLSRNTTDKELRDHFSKFGEIESISVKIDPYTGISRGFAFMVFTNPKTIDKLLAS 119

Query: 190 GEHTINNKKVDPKKA--KARHGKI 255
           GEH IN +KVDPK+   K +HGKI
Sbjct: 120 GEHYINKRKVDPKRVSKKPQHGKI 143



 Score =  117 bits (282), Expect = 2e-25
 Identities = 50/78 (64%), Positives = 66/78 (84%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ EI+D++I+ +F ++GTI+E++ PFDK KNQRKGFCFITF+S++VV  LLKTPK
Sbjct: 144 FVGGLTPEITDEDIKTYFGQYGTIVELQAPFDKVKNQRKGFCFITFDSKEVVYKLLKTPK 203

Query: 435 RTIGGKEVDVKRATPKPD 488
           +TI GKEVDVK+    PD
Sbjct: 204 QTINGKEVDVKKVKVNPD 221



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 32/79 (40%), Positives = 49/79 (62%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +H K+FVGGL+ E TD++++ +FG YG I  +    D    + +GF FI F + E + K+
Sbjct: 139 QHGKIFVGGLTPEITDEDIKTYFGQYGTIVELQAPFDKVKNQRKGFCFITFDSKEVVYKL 198

Query: 181 MAAGEHTINNKKVDPKKAK 237
           +   + TIN K+VD KK K
Sbjct: 199 LKTPKQTINGKEVDVKKVK 217



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 32/94 (34%), Positives = 51/94 (54%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           QQQ +    G     + FVGGLS   +D E+R+ FS+FG I  + +  D      +GF F
Sbjct: 45  QQQATAGIPGKDDERKLFVGGLSRNTTDKELRDHFSKFGEIESISVKIDPYTGISRGFAF 104

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 485
           + F + + ++ LL + +  I  ++VD KR + KP
Sbjct: 105 MVFTNPKTIDKLLASGEHYINKRKVDPKRVSKKP 138


>UniRef50_Q14103 Cluster: Heterogeneous nuclear ribonucleoprotein
           D0; n=123; Deuterostomia|Rep: Heterogeneous nuclear
           ribonucleoprotein D0 - Homo sapiens (Human)
          Length = 355

 Score =  107 bits (256), Expect = 3e-22
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT K+L+D+F  +GE+    +K DP TGRSRGF F++FK  ES+DKVM  
Sbjct: 98  KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ 157

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH +N K +DPK+AKA   K
Sbjct: 158 KEHKLNGKVIDPKRAKAMKTK 178



 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 32/79 (40%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T ++++R++FG +GE+ESI +  D  T + RGF FI FK  E + K+M 
Sbjct: 182 KKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIME 241

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   K + K A ++
Sbjct: 242 KKYHNVGLSKCEIKVAMSK 260



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 29/76 (38%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +  +++IR +F  FG +  +E+P D   N+R+GFCFITF+ E+ V  +++   
Sbjct: 185 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKY 244

Query: 435 RTIGGKEVDVKRATPK 482
             +G  + ++K A  K
Sbjct: 245 HNVGLSKCEIKVAMSK 260



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 26/100 (26%), Positives = 55/100 (55%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +GH      H +  +  +E     W+ F+GGLS + +  +++++FS+FG +++  +  D 
Sbjct: 77  EGHSNSSPRHSEAATAQRE----EWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 132

Query: 354 TKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
              + +GF F+ F+  + V+ ++   +  + GK +D KRA
Sbjct: 133 ITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA 172


>UniRef50_O14979 Cluster: Heterogeneous nuclear ribonucleoprotein
           D-like; n=24; Mammalia|Rep: Heterogeneous nuclear
           ribonucleoprotein D-like - Homo sapiens (Human)
          Length = 420

 Score =  100 bits (240), Expect = 3e-20
 Identities = 41/81 (50%), Positives = 59/81 (72%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ K+L ++   +GE+    +KTDP TGRSRGF F++FK   S+DKV+  
Sbjct: 149 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLEL 208

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            EH ++ K +DPK+AKA  GK
Sbjct: 209 KEHKLDGKLIDPKRAKALKGK 229



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S+++I+ +F  FG I  +E+P D   N+R+GFCFIT+  E+ V  LL++  
Sbjct: 236 FVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRY 295

Query: 435 RTIGGKEVDVKRATPK 482
             IG  + ++K A PK
Sbjct: 296 HQIGSGKCEIKVAQPK 311



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 30/79 (37%), Positives = 53/79 (67%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS +T++++++++FGA+GEIE+I +  D  T   RGF FI +   E + K++ 
Sbjct: 233 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLE 292

Query: 187 AGEHTINNKKVDPKKAKAR 243
           +  H I + K + K A+ +
Sbjct: 293 SRYHQIGSGKCEIKVAQPK 311



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S  ++  + S FG +++  +  D    + +GF F+ F+    V+ +L+  +
Sbjct: 151 FIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 210

Query: 435 RTIGGKEVDVKRA 473
             + GK +D KRA
Sbjct: 211 HKLDGKLIDPKRA 223


>UniRef50_Q9VVE5 Cluster: CG32169-PA; n=9; Endopterygota|Rep:
           CG32169-PA - Drosophila melanogaster (Fruit fly)
          Length = 369

 Score =   99 bits (238), Expect = 4e-20
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+ + LRD+FG YG+I    V  DP T RSRGF F+ F  P S+DKV+  
Sbjct: 30  KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQ 89

Query: 190 GEHTINNKKVDPKKAKAR--HGKILSEDSAV 276
           G H ++ KKVDPK A  R  H K+++    +
Sbjct: 90  GTHELDGKKVDPKVAFPRRAHPKMVTRTKKI 120



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/81 (41%), Positives = 51/81 (62%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++ +F  +G IE   +  D  T R RGF F+ F++ + +DKV
Sbjct: 116 RTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKV 175

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 176 CEIHFHEINNKMVECKKAQPK 196



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/76 (39%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS+  + ++++++F +FG I +  + FDK  N+ +GF F+TF+SE VV+ + +   
Sbjct: 121 FVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHF 180

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 181 HEINNKMVECKKAQPK 196



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 28/80 (35%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S + +R++F  +G I E  +  D T  + +GF F+TF     V+ +L    
Sbjct: 32  FIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGT 91

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + GK+VD K A P+   P
Sbjct: 92  HELDGKKVDPKVAFPRRAHP 111


>UniRef50_Q21911 Cluster: Putative uncharacterized protein msi-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein msi-1 - Caenorhabditis elegans
          Length = 320

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT + LRD+FG +GE+    V  DP T R+RGF FI F  P S+DKV+  
Sbjct: 46  KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN 105

Query: 190 GEHTINNKKVDPKKA--KARHGKILSEDSAV 276
            EH ++ KK+DPK A  K    K++++   V
Sbjct: 106 REHELDGKKIDPKVAFPKRTQAKLVTKTKKV 136



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 31/79 (39%), Positives = 48/79 (60%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+F+GGLS  +T ++++ +F  YG++E   +  D  T R RGF F+ F + E  DKV  
Sbjct: 134 KKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCE 193

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H IN K V+ KKA+ +
Sbjct: 194 IHFHEINGKMVECKKAQPK 212



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS+  + ++++ +F  +G + +  + FDK   + +GF F+TF+S++V + + +   
Sbjct: 137 FIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHF 196

Query: 435 RTIGGKEVDVKRATPK 482
             I GK V+ K+A PK
Sbjct: 197 HEINGKMVECKKAQPK 212



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 26/76 (34%), Positives = 43/76 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + + + +R++F  FG + E  +  D    + +GF FITF     V+ +L   +
Sbjct: 48  FIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNRE 107

Query: 435 RTIGGKEVDVKRATPK 482
             + GK++D K A PK
Sbjct: 108 HELDGKKIDPKVAFPK 123


>UniRef50_Q4WHA5 Cluster: Heterogeneous nuclear ribonucleoprotein
           HRP1; n=1; Aspergillus fumigatus|Rep: Heterogeneous
           nuclear ribonucleoprotein HRP1 - Aspergillus fumigatus
           (Sartorya fumigata)
          Length = 608

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 39/78 (50%), Positives = 56/78 (71%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL+WETTD+ LRD+F  +GE++   V  D  TGRSRGF F+ FK P++++ VM  
Sbjct: 106 KMFIGGLNWETTDQSLRDYFSQFGEVQECTVMRDSATGRSRGFGFLTFKDPKTVNTVMVK 165

Query: 190 GEHTINNKKVDPKKAKAR 243
            EH ++ K +DPK+A  R
Sbjct: 166 -EHYLDGKIIDPKRAIPR 182



 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 32/87 (36%), Positives = 53/87 (60%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P++    T + FVGG+S E ++ E + FF++FG +++  +  DK   + +GF F+TF+SE
Sbjct: 181 PRDEQEKTSKIFVGGVSQEATEQEFKEFFTQFGRVIDATLMIDKDTGRPRGFGFVTFDSE 240

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPK 482
             V   L  P   I GK ++VK+A P+
Sbjct: 241 AAVEAALSRP-LAICGKPIEVKKAQPR 266



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/78 (34%), Positives = 48/78 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E +D  +R++FS+FG + E  +  D    + +GF F+TF+  + VN ++   +
Sbjct: 108 FIGGLNWETTDQSLRDYFSQFGEVQECTVMRDSATGRSRGFGFLTFKDPKTVNTVM-VKE 166

Query: 435 RTIGGKEVDVKRATPKPD 488
             + GK +D KRA P+ +
Sbjct: 167 HYLDGKIIDPKRAIPRDE 184



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 28/86 (32%), Positives = 50/86 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+S E T++E ++ F  +G +    +  D +TGR RGF F+ F +  +++  ++ 
Sbjct: 190 KIFVGGVSQEATEQEFKEFFTQFGRVIDATLMIDKDTGRPRGFGFVTFDSEAAVEAALSR 249

Query: 190 GEHTINNKKVDPKKAKARHGKILSED 267
               I  K ++ KKA+ R G +  E+
Sbjct: 250 -PLAICGKPIEVKKAQPR-GNLRDEE 273


>UniRef50_Q32LZ4 Cluster: Msi2h protein; n=4; Eutheria|Rep: Msi2h
           protein - Mus musculus (Mouse)
          Length = 193

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 39/86 (45%), Positives = 55/86 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+   LRD+F  +GEI    V  DP T RSRGF F+ F  P S+DKV+  
Sbjct: 22  KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQ 81

Query: 190 GEHTINNKKVDPKKAKARHGKILSED 267
             H +++K +DPK A  R  +  S++
Sbjct: 82  PHHELDSKTIDPKVAFPRRAQPKSQE 107



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 30/80 (37%), Positives = 45/80 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S D +R++FS+FG I E  +  D T  + +GF F+TF     V+ +L  P 
Sbjct: 24  FIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPH 83

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             +  K +D K A P+   P
Sbjct: 84  HELDSKTIDPKVAFPRRAQP 103


>UniRef50_Q5DH48 Cluster: SJCHGC06087 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC06087 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 390

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 36/76 (47%), Positives = 54/76 (71%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWET + +L+++F  +G++    +K D  TG SRGF F+  ++ + + KV++ 
Sbjct: 60  KLFVGGLSWETNESDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSV 119

Query: 190 GEHTINNKKVDPKKAK 237
            EH + NKK+DPKKAK
Sbjct: 120 SEHWLKNKKIDPKKAK 135



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  E+++D+IR +FS FG +  +++P+D  K +RK + F++F +E      +   +
Sbjct: 145 FVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAARKAISKER 204

Query: 435 RTIGGKEVDVKRATPK 482
           + I G++ DV+ A  +
Sbjct: 205 QEIFGRQCDVRVAVTR 220



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 25/75 (33%), Positives = 45/75 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++ +++ +FS +G + +  +  D+     +GF F+T ESE  V+ +L   +
Sbjct: 62  FVGGLSWETNESDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVSE 121

Query: 435 RTIGGKEVDVKRATP 479
             +  K++D K+A P
Sbjct: 122 HWLKNKKIDPKKAKP 136



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+  E T+ ++R++F ++G++ES+++  D   G+ + + F+ F    +  K ++ 
Sbjct: 143 KIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAARKAISK 202

Query: 190 GEHTINNKKVDPKKAKAR 243
               I  ++ D + A  R
Sbjct: 203 ERQEIFGRQCDVRVAVTR 220


>UniRef50_Q7XDI5 Cluster: RNA recognition motif family protein,
           expressed; n=5; Magnoliophyta|Rep: RNA recognition motif
           family protein, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 464

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 39/78 (50%), Positives = 54/78 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GG+SWETT+++LRDHF AYG++    V  D  TGR RGF F+VF  P S+D  +  
Sbjct: 7   KLFIGGISWETTEEKLRDHFAAYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVDAAL-V 65

Query: 190 GEHTINNKKVDPKKAKAR 243
             HT++ + VD K+A +R
Sbjct: 66  DPHTLDGRTVDVKRALSR 83



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 34/90 (37%), Positives = 56/90 (62%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G + T + FVGGL S +++DE R +F  +G + +V + +D+   + +GF FITF++E  V
Sbjct: 123 GGARTKKIFVGGLPSNLTEDEFRQYFQTYGVVTDVVVMYDQNTQRPRGFGFITFDAEDAV 182

Query: 411 NDLLKTPKRTIGGKEVDVKRATPKPDGPGA 500
           + +L      + GK V+VKRA P+   PG+
Sbjct: 183 DRVLHKTFHDLSGKMVEVKRALPREANPGS 212



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 33/81 (40%), Positives = 48/81 (59%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGL    T+ E R +F  YG +  + V  D NT R RGF FI F A +++D+V
Sbjct: 126 RTKKIFVGGLPSNLTEDEFRQYFQTYGVVTDVVVMYDQNTQRPRGFGFITFDAEDAVDRV 185

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
           +    H ++ K V+ K+A  R
Sbjct: 186 LHKTFHDLSGKMVEVKRALPR 206



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/82 (31%), Positives = 47/82 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GG+S E +++++R+ F+ +G + +  +  DK   + +GF F+ F     V+  L  P 
Sbjct: 9   FIGGISWETTEEKLRDHFAAYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVDAALVDP- 67

Query: 435 RTIGGKEVDVKRATPKPDGPGA 500
            T+ G+ VDVKRA  + +   A
Sbjct: 68  HTLDGRTVDVKRALSREEQQAA 89


>UniRef50_Q99383 Cluster: Nuclear polyadenylated RNA-binding protein
           4; n=7; Saccharomycetales|Rep: Nuclear polyadenylated
           RNA-binding protein 4 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 534

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 36/78 (46%), Positives = 56/78 (71%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL+W+TT+  LR++FG YG +  + +  DP TGRSRGF F+ F+ P S+D+V+  
Sbjct: 160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKT 219

Query: 190 GEHTINNKKVDPKKAKAR 243
            +H ++ K +DPK+A  R
Sbjct: 220 -QHILDGKVIDPKRAIPR 236



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 30/96 (31%), Positives = 60/96 (62%), Gaps = 1/96 (1%)
 Frame = +3

Query: 204 QQQESRPKEG*ST-TWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFC 380
           Q +E R K   S  + + F+GGL+ + ++D +R +F ++GT+ ++++  D    + +GF 
Sbjct: 144 QTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFG 203

Query: 381 FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           F++FE    V++++KT +  + GK +D KRA P+ +
Sbjct: 204 FLSFEKPSSVDEVVKT-QHILDGKVIDPKRAIPRDE 238



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 26/87 (29%), Positives = 51/87 (58%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P++    T + FVGG+  ++   E   FFS++GTI++ ++  DK   Q +GF F+T++S 
Sbjct: 235 PRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSA 294

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPK 482
             V+ + +        +++++KRA P+
Sbjct: 295 DAVDRVCQNKFIDFKDRKIEIKRAEPR 321



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 25/79 (31%), Positives = 46/79 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+  +   KE  + F  +G I    +  D +TG+SRGF F+ + + +++D+V   
Sbjct: 244 KIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQN 303

Query: 190 GEHTINNKKVDPKKAKARH 246
                 ++K++ K+A+ RH
Sbjct: 304 KFIDFKDRKIEIKRAEPRH 322


>UniRef50_Q8CD63 Cluster: 13 days embryo male testis cDNA, RIKEN
           full-length enriched library, clone:6030413L18
           product:Musashi homolog 2 (Drosophila), full insert
           sequence; n=3; Deuterostomia|Rep: 13 days embryo male
           testis cDNA, RIKEN full-length enriched library,
           clone:6030413L18 product:Musashi homolog 2 (Drosophila),
           full insert sequence - Mus musculus (Mouse)
          Length = 192

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 38/81 (46%), Positives = 52/81 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+   LRD+F  +GEI    V  DP T RSRGF F+ F  P S+DKV+  
Sbjct: 22  KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDPASVDKVLGQ 81

Query: 190 GEHTINNKKVDPKKAKARHGK 252
             H +++K +DPK A  R  +
Sbjct: 82  PHHELDSKTIDPKVAFPRRAQ 102



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 30/80 (37%), Positives = 45/80 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S D +R++FS+FG I E  +  D T  + +GF F+TF     V+ +L  P 
Sbjct: 24  FIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDPASVDKVLGQPH 83

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             +  K +D K A P+   P
Sbjct: 84  HELDSKTIDPKVAFPRRAQP 103



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 15/40 (37%), Positives = 27/40 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKG 374
           FVGGLS+    ++++ +F +FG + +  + FDKT N+ +G
Sbjct: 113 FVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRG 152



 Score = 39.9 bits (89), Expect = 0.050
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRG 135
           R +K+FVGGLS  T  ++++ +F  +G++E   +  D  T R RG
Sbjct: 108 RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRG 152


>UniRef50_A4V6K2 Cluster: PRM10 protein; n=1; Dugesia japonica|Rep:
           PRM10 protein - Dugesia japonica (Planarian)
          Length = 325

 Score = 89.4 bits (212), Expect = 6e-17
 Identities = 37/76 (48%), Positives = 53/76 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT+++L+++F  +G++    +K D  TG SRGF F+     +S+ KV+  
Sbjct: 73  KLFVGGLSWETTEEDLKNYFETWGKVAHCVIKLDKMTGNSRGFGFVTMDTEDSLKKVLEV 132

Query: 190 GEHTINNKKVDPKKAK 237
            EH + NKK+DPK AK
Sbjct: 133 PEHRLKNKKIDPKPAK 148



 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 28/76 (36%), Positives = 53/76 (69%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E+++++I+ +FS++G++  V++PFD +K +RK + F++F +E    + +   K
Sbjct: 158 FVGGLSPEVTEEQIKEYFSQYGSVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIINEK 217

Query: 435 RTIGGKEVDVKRATPK 482
           + + G + DV+ A PK
Sbjct: 218 QDVLGSKCDVRMAVPK 233



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 24/75 (32%), Positives = 45/75 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E ++++++N+F  +G +    +  DK     +GF F+T ++E  +  +L+ P+
Sbjct: 75  FVGGLSWETTEEDLKNYFETWGKVAHCVIKLDKMTGNSRGFGFVTMDTEDSLKKVLEVPE 134

Query: 435 RTIGGKEVDVKRATP 479
             +  K++D K A P
Sbjct: 135 HRLKNKKIDPKPAKP 149



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 21/77 (27%), Positives = 46/77 (59%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++K+FVGGLS E T+++++++F  YG +ES+++  D + G+ + + F+ F   ++    +
Sbjct: 154 NKKIFVGGLSPEVTEEQIKEYFSQYGSVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAI 213

Query: 184 AAGEHTINNKKVDPKKA 234
              +  +   K D + A
Sbjct: 214 INEKQDVLGSKCDVRMA 230


>UniRef50_O94432 Cluster: mRNA cleavage factor complex subunit; n=1;
           Schizosaccharomyces pombe|Rep: mRNA cleavage factor
           complex subunit - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 474

 Score = 89.4 bits (212), Expect = 6e-17
 Identities = 39/78 (50%), Positives = 55/78 (70%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL+WETTD  LRD+F  +GE+    V  D  TGRSRGF F+ FK P+ +++VM+ 
Sbjct: 164 KMFIGGLNWETTDDSLRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEVMSK 223

Query: 190 GEHTINNKKVDPKKAKAR 243
            EH ++ K +DPK+A  R
Sbjct: 224 -EHHLDGKIIDPKRAIPR 240



 Score = 82.2 bits (194), Expect = 9e-15
 Identities = 37/87 (42%), Positives = 56/87 (64%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P+E    T + FVGG+  + +++E RNFF++FG +L+  +  DK   + +GF F+T+E+E
Sbjct: 239 PREEQEKTAKMFVGGVPGDCTEEEFRNFFNQFGRVLDATLMMDKDTGRPRGFGFVTYENE 298

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPK 482
             V   +  P  TI GK V+VKRATPK
Sbjct: 299 SAVEATMSQPYITIHGKPVEVKRATPK 325



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 28/78 (35%), Positives = 53/78 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E +DD +R++F +FG +L+  +  D T  + +GF F+TF++ + VN+++ + +
Sbjct: 166 FIGGLNWETTDDSLRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEVM-SKE 224

Query: 435 RTIGGKEVDVKRATPKPD 488
             + GK +D KRA P+ +
Sbjct: 225 HHLDGKIIDPKRAIPREE 242



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 25/75 (33%), Positives = 45/75 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+  + T++E R+ F  +G +    +  D +TGR RGF F+ ++   +++  M+ 
Sbjct: 248 KMFVGGVPGDCTEEEFRNFFNQFGRVLDATLMMDKDTGRPRGFGFVTYENESAVEATMSQ 307

Query: 190 GEHTINNKKVDPKKA 234
              TI+ K V+ K+A
Sbjct: 308 PYITIHGKPVEVKRA 322


>UniRef50_Q6BL35 Cluster: Debaryomyces hansenii chromosome F of
           strain CBS767 of Debaryomyces hansenii; n=4;
           Saccharomycetales|Rep: Debaryomyces hansenii chromosome
           F of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 495

 Score = 89.0 bits (211), Expect = 8e-17
 Identities = 37/80 (46%), Positives = 58/80 (72%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H K+F+GGL+W+TT++ L ++F  YGE+    +  D NTG+SRGF F+ FK P+S+D+V+
Sbjct: 169 HGKMFIGGLNWDTTEQGLVEYFTKYGEVIDHTIMRDNNTGKSRGFGFLTFKDPKSVDEVI 228

Query: 184 AAGEHTINNKKVDPKKAKAR 243
              +H ++ K +DPK+A AR
Sbjct: 229 KT-DHILDGKLIDPKRAIAR 247



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 27/76 (35%), Positives = 49/76 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+   +++ +  +FFS+FG+I++ ++  DK   + +GF FIT++S   V+ +     
Sbjct: 257 FVGGIDPMVNEKDFNDFFSQFGSIIDAQLMIDKDTGRSRGFGFITYDSPDAVDRVTVNKY 316

Query: 435 RTIGGKEVDVKRATPK 482
            T+ GK ++VKRA P+
Sbjct: 317 LTLKGKSMEVKRAEPR 332



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/78 (35%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+     +K+  D F  +G I    +  D +TGRSRGF FI + +P+++D+V   
Sbjct: 255 KIFVGGIDPMVNEKDFNDFFSQFGSIIDAQLMIDKDTGRSRGFGFITYDSPDAVDRVTVN 314

Query: 190 GEHTINNKKVDPKKAKAR 243
              T+  K ++ K+A+ R
Sbjct: 315 KYLTLKGKSMEVKRAEPR 332



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 21/78 (26%), Positives = 48/78 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + ++  +  +F+++G +++  +  D    + +GF F+TF+  + V++++KT  
Sbjct: 173 FIGGLNWDTTEQGLVEYFTKYGEVIDHTIMRDNNTGKSRGFGFLTFKDPKSVDEVIKT-D 231

Query: 435 RTIGGKEVDVKRATPKPD 488
             + GK +D KRA  + +
Sbjct: 232 HILDGKLIDPKRAIAREE 249


>UniRef50_O43347 Cluster: RNA-binding protein Musashi homolog 1;
           n=65; Euteleostomi|Rep: RNA-binding protein Musashi
           homolog 1 - Homo sapiens (Human)
          Length = 362

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 37/81 (45%), Positives = 54/81 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+TT + LR++FG +GE++   V  DP T RSRGF F+ F     +DKV+A 
Sbjct: 21  KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQ 80

Query: 190 GEHTINNKKVDPKKAKARHGK 252
             H +++K +DPK A  R  +
Sbjct: 81  SRHELDSKTIDPKVAFPRRAQ 101



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 31/81 (38%), Positives = 52/81 (64%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++ +F  +G+++   +  D  T R RGF F+ F++ + ++KV
Sbjct: 107 RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 166

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 167 CEIHFHEINNKMVECKKAQPK 187



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS   + ++++ +F +FG + +  + FDKT N+ +GF F+TFESE +V  + +   
Sbjct: 112 FVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHF 171

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 172 HEINNKMVECKKAQPK 187



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/80 (30%), Positives = 43/80 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + + + +R +F +FG + E  +  D    + +GF F+TF  +  V+ +L   +
Sbjct: 23  FIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSR 82

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             +  K +D K A P+   P
Sbjct: 83  HELDSKTIDPKVAFPRRAQP 102


>UniRef50_Q9HEH4 Cluster: Related to heterogeneous nuclear
           ribonucleoprotein; n=13; Fungi/Metazoa group|Rep:
           Related to heterogeneous nuclear ribonucleoprotein -
           Neurospora crassa
          Length = 503

 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 38/77 (49%), Positives = 54/77 (70%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+GGL+WETTD+ LRD+F  +GE+    V  D  TGRSRGF F+ FK P++++ VM   
Sbjct: 1   MFIGGLNWETTDQSLRDYFSQFGEVVECTVMRDGATGRSRGFGFLTFKDPKTVNIVMVK- 59

Query: 193 EHTINNKKVDPKKAKAR 243
           EH ++ K +DPK+A  R
Sbjct: 60  EHYLDGKIIDPKRAIPR 76



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 33/87 (37%), Positives = 53/87 (60%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P++    T + FVGG+S E +D E R +F++FG +++  +  DK   + +GF F+TFESE
Sbjct: 75  PRDEQEKTSKIFVGGVSQETTDHEFREYFAQFGRVVDATLMMDKDTGRPRGFGFVTFESE 134

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPK 482
             V   L +    I GK ++VK+A P+
Sbjct: 135 AGVEACL-SANLEIHGKPIEVKKAQPR 160



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/78 (38%), Positives = 49/78 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+S ETTD E R++F  +G +    +  D +TGR RGF F+ F++   ++  ++A
Sbjct: 84  KIFVGGVSQETTDHEFREYFAQFGRVVDATLMMDKDTGRPRGFGFVTFESEAGVEACLSA 143

Query: 190 GEHTINNKKVDPKKAKAR 243
               I+ K ++ KKA+ R
Sbjct: 144 NLE-IHGKPIEVKKAQPR 160



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 27/78 (34%), Positives = 49/78 (62%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E +D  +R++FS+FG ++E  +  D    + +GF F+TF+  + VN ++   +
Sbjct: 2   FIGGLNWETTDQSLRDYFSQFGEVVECTVMRDGATGRSRGFGFLTFKDPKTVN-IVMVKE 60

Query: 435 RTIGGKEVDVKRATPKPD 488
             + GK +D KRA P+ +
Sbjct: 61  HYLDGKIIDPKRAIPRDE 78


>UniRef50_Q8MS04 Cluster: RH49436p; n=9; Endopterygota|Rep: RH49436p
           - Drosophila melanogaster (Fruit fly)
          Length = 634

 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSW+T+  +L+++F  +G +  + +  DP T RSRGF FI F+ P +++KV+  
Sbjct: 204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKV 263

Query: 190 GEHTINNKKVDPKKAKARH 246
             HT++ KK+DPK A  ++
Sbjct: 264 PIHTLDGKKIDPKHATPKN 282



 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 35/94 (37%), Positives = 60/94 (63%)
 Frame = +3

Query: 201 HQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFC 380
           H   ++RP++  + T + FVGG+S + S +E++ +FS+FG + E  M  D+   + +GF 
Sbjct: 277 HATPKNRPRQA-NKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFG 335

Query: 381 FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           F+TFE+E VV+ + +    TI  K+V+ K+A PK
Sbjct: 336 FVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK 369



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 33/76 (43%), Positives = 49/76 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS + S D+++ +F+ FGT+ +V +  D    + +GF FITF+    V  +LK P 
Sbjct: 206 FVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPI 265

Query: 435 RTIGGKEVDVKRATPK 482
            T+ GK++D K ATPK
Sbjct: 266 HTLDGKKIDPKHATPK 281



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 31/79 (39%), Positives = 51/79 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+S +T+ +E++ +F  +G +E   +  D  T R RGF F+ F+  + +D+V  
Sbjct: 291 KKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCE 350

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTI NKKV+ KKA+ +
Sbjct: 351 IHFHTIKNKKVECKKAQPK 369


>UniRef50_Q5K6W6 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 480

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 37/78 (47%), Positives = 57/78 (73%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL+WETT+  L ++ G +GEI++  +  DP +GRSRGFAF+ ++ P S+ KVMA 
Sbjct: 113 KMFIGGLNWETTEAGLSEYMGQFGEIDACTIMRDP-SGRSRGFAFLTYRDPASVTKVMAQ 171

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ K++DPK+A  R
Sbjct: 172 THH-LDGKQIDPKRAIPR 188



 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 27/93 (29%), Positives = 53/93 (56%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P+     T + FVGGL+  ++ + +++F  +FG +++  + FDK   + KGF F TF+ E
Sbjct: 187 PRAEHERTAKVFVGGLAPSVTGESLKSFLCQFGQVMDATVMFDKETGRSKGFAFATFQDE 246

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGA 500
           + V   +      + GK++++K+A P+    G+
Sbjct: 247 ESVGRAMAASGVELEGKQIEIKKAQPRGTAQGS 279



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 31/81 (38%), Positives = 47/81 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVGGL+   T + L+     +G++    V  D  TGRS+GFAF  F+  ES+ + 
Sbjct: 193 RTAKVFVGGLAPSVTGESLKSFLCQFGQVMDATVMFDKETGRSKGFAFATFQDEESVGRA 252

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
           MAA    +  K+++ KKA+ R
Sbjct: 253 MAASGVELEGKQIEIKKAQPR 273



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 22/78 (28%), Positives = 40/78 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E ++  +  +  +FG I    +  D +   R GF F+T+     V  ++    
Sbjct: 115 FIGGLNWETTEAGLSEYMGQFGEIDACTIMRDPSGRSR-GFAFLTYRDPASVTKVM-AQT 172

Query: 435 RTIGGKEVDVKRATPKPD 488
             + GK++D KRA P+ +
Sbjct: 173 HHLDGKQIDPKRAIPRAE 190


>UniRef50_A3LZT4 Cluster: Predicted protein; n=1; Pichia
           stipitis|Rep: Predicted protein - Pichia stipitis
           (Yeast)
          Length = 481

 Score = 85.0 bits (201), Expect = 1e-15
 Identities = 34/78 (43%), Positives = 56/78 (71%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL+W+TT++ L  +F  +GE+    +  D NTG+SRGF F+ F+ P+S+D+V+  
Sbjct: 161 KMFIGGLNWDTTEEGLVSYFSKFGEVVDYTIMKDNNTGKSRGFGFLTFRDPKSVDEVIKT 220

Query: 190 GEHTINNKKVDPKKAKAR 243
            +H ++ K +DPK+A AR
Sbjct: 221 -DHILDGKLIDPKRAIAR 237



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 29/76 (38%), Positives = 49/76 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+   +++ E  +FFS+FG+I++ ++  DK   + +GF FITF+S   V+ +     
Sbjct: 247 FVGGIDPMVNEKEFHDFFSQFGSIIDAQLMIDKDSGRSRGFGFITFDSPDAVDRVTVNKF 306

Query: 435 RTIGGKEVDVKRATPK 482
            T+ GK ++VKRA P+
Sbjct: 307 LTLKGKAMEVKRAEPR 322



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 29/78 (37%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+     +KE  D F  +G I    +  D ++GRSRGF FI F +P+++D+V   
Sbjct: 245 KIFVGGIDPMVNEKEFHDFFSQFGSIIDAQLMIDKDSGRSRGFGFITFDSPDAVDRVTVN 304

Query: 190 GEHTINNKKVDPKKAKAR 243
              T+  K ++ K+A+ R
Sbjct: 305 KFLTLKGKAMEVKRAEPR 322



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 24/82 (29%), Positives = 51/82 (62%)
 Frame = +3

Query: 243 TWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
           T + F+GGL+ + +++ + ++FS+FG +++  +  D    + +GF F+TF   + V++++
Sbjct: 159 TGKMFIGGLNWDTTEEGLVSYFSKFGEVVDYTIMKDNNTGKSRGFGFLTFRDPKSVDEVI 218

Query: 423 KTPKRTIGGKEVDVKRATPKPD 488
           KT    + GK +D KRA  + +
Sbjct: 219 KT-DHILDGKLIDPKRAIAREE 239


>UniRef50_UPI00015560CE Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A1; n=4; Mammalia|Rep:
           PREDICTED: similar to heterogeneous nuclear
           ribonucleoprotein A1 - Ornithorhynchus anatinus
          Length = 280

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100



 Score = 35.9 bits (79), Expect = 0.82
 Identities = 14/28 (50%), Positives = 21/28 (75%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIE 90
           +K+FVGG+  +T +  LRD+F  YG+IE
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIE 132


>UniRef50_Q8W034 Cluster: Ribonucleoprotein 1; n=5; core
           eudicotyledons|Rep: Ribonucleoprotein 1 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 411

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 38/84 (45%), Positives = 57/84 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGG+SWET + +LR+HF  YGE+    V  D  TGR RGF F++F  P  +D+V+  
Sbjct: 7   KLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE 66

Query: 190 GEHTINNKKVDPKKAKARHGKILS 261
            +H+I+ ++VD K+A +R  + +S
Sbjct: 67  -KHSIDTREVDVKRAMSREEQQVS 89



 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 32/81 (39%), Positives = 52/81 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   ++D+E R +F  +G + +V + +D+  N+ +GF F++F+SE  V+ +L    
Sbjct: 113 FVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTF 172

Query: 435 RTIGGKEVDVKRATPKPDGPG 497
             + GK+V+VKRA PK   PG
Sbjct: 173 HDLSGKQVEVKRALPKDANPG 193



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/76 (36%), Positives = 46/76 (60%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL    TD+E R +F  YG +  + +  D  T R RGF F+ F + +++D V+ 
Sbjct: 110 KKIFVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLH 169

Query: 187 AGEHTINNKKVDPKKA 234
              H ++ K+V+ K+A
Sbjct: 170 KTFHDLSGKQVEVKRA 185



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+S E  +D++R  F+ +G + +  +  DK   + +GF F+ F    V++ +L+  K
Sbjct: 9   FVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQ-EK 67

Query: 435 RTIGGKEVDVKRATPKPD 488
            +I  +EVDVKRA  + +
Sbjct: 68  HSIDTREVDVKRAMSREE 85


>UniRef50_P09651 Cluster: Heterogeneous nuclear ribonucleoprotein
           A1; n=390; Euteleostomi|Rep: Heterogeneous nuclear
           ribonucleoprotein A1 - Homo sapiens (Human)
          Length = 372

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+ +   E +D  M A
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA 74

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + V+PK+A +R
Sbjct: 75  RPHKVDGRVVEPKRAVSR 92



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 105 KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N    + +KA ++
Sbjct: 165 QKYHTVNGHNCEVRKALSK 183



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY 167

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V++A  K +
Sbjct: 168 HTVNGHNCEVRKALSKQE 185



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T+ + + V+  +    
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP 76

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 77  HKVDGRVVEPKRAVSREDSQRPGA 100


>UniRef50_P51991 Cluster: Heterogeneous nuclear ribonucleoprotein
           A3; n=98; Coelomata|Rep: Heterogeneous nuclear
           ribonucleoprotein A3 - Homo sapiens (Human)
          Length = 378

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 36/82 (43%), Positives = 51/82 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS+ETTD  LR+HF  +G +    V  DP T RSRGF F+ +   E +D  M A
Sbjct: 36  KLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCA 95

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
             H ++ + V+PK+A +R   +
Sbjct: 96  RPHKVDGRVVEPKRAVSREDSV 117



 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 33/79 (41%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LRD+F  YG+IE+I V  D  +G+ RGFAF+ F   +++DK++ 
Sbjct: 126 KKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV 185

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTIN    + KKA ++
Sbjct: 186 QKYHTINGHNCEVKKALSK 204



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 23/78 (29%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++    
Sbjct: 129 FVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKY 188

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G   +VK+A  K +
Sbjct: 189 HTINGHNCEVKKALSKQE 206



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E +DD +R  F ++GT+ +  +  D    + +GF F+T+   + V+  +    
Sbjct: 38  FIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARP 97

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G+ V+ KRA  + D   PGA
Sbjct: 98  HKVDGRVVEPKRAVSREDSVKPGA 121


>UniRef50_Q6PNM9 Cluster: AUF1 similar protein; n=3; Paracentrotus
           lividus|Rep: AUF1 similar protein - Paracentrotus
           lividus (Common sea urchin)
          Length = 361

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 34/76 (44%), Positives = 53/76 (69%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL+W TT + L+ +F AYG ++   +K D  T + RGF FI+F++ +S+ KV+ 
Sbjct: 50  KKLFVGGLAWNTTPETLQQYFSAYGTVQDCEIKKDQVTKKPRGFGFILFESADSVTKVLD 109

Query: 187 AGEHTINNKKVDPKKA 234
             EH +++K +DPK A
Sbjct: 110 VPEHKVDDKTIDPKPA 125



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GG+ S++ DD+I+++FS+FGT++E E P DKT  +R GF F+ +E+         +  
Sbjct: 138 FIGGIGSDLKDDDIKSYFSQFGTVVETEFPEDKTTGRRLGFAFVKYETSDEAQKAQNSRF 197

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI  K+V+V  A  + +
Sbjct: 198 HTISNKKVEVSEAVSREE 215



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 25/81 (30%), Positives = 46/81 (56%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           + +K+F+GG+  +  D +++ +F  +G +       D  TGR  GFAF+ ++  +   K 
Sbjct: 133 KKKKIFIGGIGSDLKDDDIKSYFSQFGTVVETEFPEDKTTGRRLGFAFVKYETSDEAQKA 192

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
             +  HTI+NKKV+  +A +R
Sbjct: 193 QNSRFHTISNKKVEVSEAVSR 213



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 2/80 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+   + + ++ +FS +GT+ + E+  D+   + +GF FI FES   V  +L  P+
Sbjct: 53  FVGGLAWNTTPETLQQYFSAYGTVQDCEIKKDQVTKKPRGFGFILFESADSVTKVLDVPE 112

Query: 435 RTIGGKEVDVKRATP--KPD 488
             +  K +D K A P  KP+
Sbjct: 113 HKVDDKTIDPKPANPLKKPE 132


>UniRef50_UPI000023D975 Cluster: hypothetical protein FG10273.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG10273.1 - Gibberella zeae PH-1
          Length = 552

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 38/83 (45%), Positives = 56/83 (67%), Gaps = 5/83 (6%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL+WETTD+ LRD+F  +GE+    V  D +TGRSRGF F+ FK  ++++ VM  
Sbjct: 122 KMFIGGLNWETTDQSLRDYFAQFGEVVECTVMRDSSTGRSRGFGFLTFKDAKTVNIVMVK 181

Query: 190 GEHTINNK-----KVDPKKAKAR 243
            EH ++ K     ++DPK+A  R
Sbjct: 182 -EHFLDGKILILLQIDPKRAIPR 203



 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 31/87 (35%), Positives = 54/87 (62%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P++    T + FVGG+S E +D E + +F++FG +++  +  DK   + +GF F+TFE+E
Sbjct: 202 PRDEQEKTSKIFVGGVSQETTDQEFKEYFAQFGRVVDATLMMDKDTGRPRGFGFVTFENE 261

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPK 482
             V+  +  P   I GK ++VK+A P+
Sbjct: 262 AGVDACINVPLE-IHGKPIEVKKAQPR 287



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 33/102 (32%), Positives = 56/102 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+S ETTD+E +++F  +G +    +  D +TGR RGF F+ F+    +D  +  
Sbjct: 211 KIFVGGVSQETTDQEFKEYFAQFGRVVDATLMMDKDTGRPRGFGFVTFENEAGVDACINV 270

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVN 315
               I+ K ++ KKA+ R G +  E+ A +    + +    N
Sbjct: 271 -PLEIHGKPIEVKKAQPR-GNLREEEEASRRGKFRKDGDQSN 310



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 26/83 (31%), Positives = 51/83 (61%), Gaps = 5/83 (6%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E +D  +R++F++FG ++E  +  D +  + +GF F+TF+  + VN ++   +
Sbjct: 124 FIGGLNWETTDQSLRDYFAQFGEVVECTVMRDSSTGRSRGFGFLTFKDAKTVN-IVMVKE 182

Query: 435 RTIGGK-----EVDVKRATPKPD 488
             + GK     ++D KRA P+ +
Sbjct: 183 HFLDGKILILLQIDPKRAIPRDE 205


>UniRef50_Q96EP5 Cluster: DAZ-associated protein 1; n=39;
           Euteleostomi|Rep: DAZ-associated protein 1 - Homo
           sapiens (Human)
          Length = 407

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 34/78 (43%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL W TT + LR +F  YGE+    +  D  T +SRGF F+ FK P  +  V+A+
Sbjct: 11  KLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLAS 70

Query: 190 GEHTINNKKVDPKKAKAR 243
             HT++ + +DPK    R
Sbjct: 71  RPHTLDGRNIDPKPCTPR 88



 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 8/101 (7%)
 Frame = +3

Query: 204 QQQESRPKEG*--------STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK 359
           Q + +RPKEG         S + + FVGG+     + E+R +F +FG + EV M +D  K
Sbjct: 91  QPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEK 150

Query: 360 NQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
            + +GF FITFE EQ V+  +      I GK+V+VKRA P+
Sbjct: 151 QRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 191



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 26/76 (34%), Positives = 46/76 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    + + +R++FS++G +++  +  DKT NQ +GF F+ F+    V  +L +  
Sbjct: 13  FVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRP 72

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K  TP+
Sbjct: 73  HTLDGRNIDPKPCTPR 88



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 29/84 (34%), Positives = 47/84 (55%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +  K+FVGG+     + ELR++F  +G +  + +  D    R RGF FI F+  +S+D+ 
Sbjct: 111 KSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 170

Query: 181 MAAGEHTINNKKVDPKKAKARHGK 252
           +    H I  KKV+ K+A+ R  K
Sbjct: 171 VNMHFHDIMGKKVEVKRAEPRDSK 194


>UniRef50_Q9D3U4 Cluster: Adult male testis cDNA, RIKEN full-length
           enriched library, clone:4933434H11 product:similar to
           telomeric and tetraplex DNA binding protein qTBP42 V;
           n=2; Murinae|Rep: Adult male testis cDNA, RIKEN
           full-length enriched library, clone:4933434H11
           product:similar to telomeric and tetraplex DNA binding
           protein qTBP42 V - Mus musculus (Mouse)
          Length = 565

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 34/77 (44%), Positives = 54/77 (70%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLS E + + L ++   +GEI    +KTDPNTG SRGF F++FK   +++KV+  
Sbjct: 34  KMFIGGLSQEMSKQVLLEYLSKFGEIIDFIIKTDPNTGLSRGFGFVLFKDSATVEKVLQV 93

Query: 190 GEHTINNKKVDPKKAKA 240
            +H ++ KK++ K+AKA
Sbjct: 94  KDHKVDGKKIEFKRAKA 110



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 34/114 (29%), Positives = 61/114 (53%), Gaps = 2/114 (1%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++K+FVGGL+   +++++R +FG +G+IE+I +    +T   R F FI +    S+ KV+
Sbjct: 117 NKKIFVGGLNPRLSEEKIRAYFGTFGQIEAIELPLCSDTRERRAFGFIKYMDENSVRKVL 176

Query: 184 AAGEHTINNKKVDPKKA--KARHGKILSEDSAVKSQMMKSETSSVNLELS*KWR 339
               H I + + + K A  K    + LS+  A+     +    +V LE +  WR
Sbjct: 177 ENRYHFIGSSRCEVKMAYPKENPARQLSKRKAIAKDRTRKSVPAVELENN--WR 228



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/76 (36%), Positives = 42/76 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+  +S+++IR +F  FG I  +E+P      +R+ F FI +  E  V  +L+   
Sbjct: 121 FVGGLNPRLSEEKIRAYFGTFGQIEAIELPLCSDTRERRAFGFIKYMDENSVRKVLENRY 180

Query: 435 RTIGGKEVDVKRATPK 482
             IG    +VK A PK
Sbjct: 181 HFIGSSRCEVKMAYPK 196



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS E+S   +  + S+FG I++  +  D      +GF F+ F+    V  +L+   
Sbjct: 36  FIGGLSQEMSKQVLLEYLSKFGEIIDFIIKTDPNTGLSRGFGFVLFKDSATVEKVLQVKD 95

Query: 435 RTIGGKEVDVKRA 473
             + GK+++ KRA
Sbjct: 96  HKVDGKKIEFKRA 108


>UniRef50_Q22037 Cluster: Heterogeneous nuclear ribonucleoprotein
           A1; n=5; Caenorhabditis|Rep: Heterogeneous nuclear
           ribonucleoprotein A1 - Caenorhabditis elegans
          Length = 346

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 40/96 (41%), Positives = 53/96 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+  TTD  +R+ +  +GEI  I V  DP T RSRGF F+ F     +D  M  
Sbjct: 24  KIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQ 83

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
             H I+ K VDPK+A  R  K  SE +    ++  S
Sbjct: 84  RPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVS 119



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 33/78 (42%), Positives = 48/78 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+S  +DD +R F+S+FG I ++ +  D T  + +GF F+TF  +  V+  +K   
Sbjct: 26  FVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRP 85

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK VD KRA P+ D
Sbjct: 86  HIIDGKTVDPKRAVPRDD 103



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 27/94 (28%), Positives = 48/94 (51%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++L+V G+  + T+  L ++F  YG +    +  D  T + RGF F+ F   +S+D+ + 
Sbjct: 114 KRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVL 173

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQM 288
              H +N  + D +K        LS+D   K+QM
Sbjct: 174 QKSHMVNGHRCDVRKG-------LSKDEMSKAQM 200



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 19/78 (24%), Positives = 42/78 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V G+  + ++D +  +F+++GT+ + E+  DK   + +GF F+TF+    V+  +    
Sbjct: 117 YVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKS 176

Query: 435 RTIGGKEVDVKRATPKPD 488
             + G   DV++   K +
Sbjct: 177 HMVNGHRCDVRKGLSKDE 194


>UniRef50_Q6CC04 Cluster: Yarrowia lipolytica chromosome C of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome C of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 367

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 33/93 (35%), Positives = 60/93 (64%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P+E    T + FVGG+ S++++++ + FF ++GT+++ ++  DK   + +GF F+TF+SE
Sbjct: 75  PREEQDKTSKIFVGGVGSDVTEEDYKQFFEQYGTVIDAQLMIDKDSGRPRGFGFVTFDSE 134

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGA 500
           Q +N +L  P   +  K ++VKRA  +  G GA
Sbjct: 135 QAMNTILAQPLLILKDKPIEVKRAENRSKGAGA 167



 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 34/77 (44%), Positives = 53/77 (68%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+GGL+WETTD+ L ++F  +GE+    V  D  +G+SRGF F+ F+ P+ ++ VMA  
Sbjct: 1   MFIGGLNWETTDESLTNYFAQFGEVLECTVMRDHFSGKSRGFGFLTFRDPKCVNAVMAK- 59

Query: 193 EHTINNKKVDPKKAKAR 243
           EH ++ K +DPK+A  R
Sbjct: 60  EHYLDGKIIDPKRAIPR 76



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 27/78 (34%), Positives = 48/78 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E +D+ + N+F++FG +LE  +  D    + +GF F+TF   + VN ++   +
Sbjct: 2   FIGGLNWETTDESLTNYFAQFGEVLECTVMRDHFSGKSRGFGFLTFRDPKCVNAVM-AKE 60

Query: 435 RTIGGKEVDVKRATPKPD 488
             + GK +D KRA P+ +
Sbjct: 61  HYLDGKIIDPKRAIPREE 78



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 22/78 (28%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+  + T+++ +  F  YG +    +  D ++GR RGF F+ F + ++++ ++A 
Sbjct: 84  KIFVGGVGSDVTEEDYKQFFEQYGTVIDAQLMIDKDSGRPRGFGFVTFDSEQAMNTILAQ 143

Query: 190 GEHTINNKKVDPKKAKAR 243
               + +K ++ K+A+ R
Sbjct: 144 PLLILKDKPIEVKRAENR 161


>UniRef50_Q4PBU3 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 588

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 35/78 (44%), Positives = 54/78 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL+W+TT+  LR +F  +GE+ +  +  D  TGRSRGFAF+ F  P++++ VM  
Sbjct: 170 KMFIGGLNWDTTEDSLRRYFSQFGEVGNCAIMRDNMTGRSRGFAFLNFVDPKAVNTVMVR 229

Query: 190 GEHTINNKKVDPKKAKAR 243
            EH ++ K +DPK+A  R
Sbjct: 230 -EHYLDGKVIDPKRAIPR 246



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 30/78 (38%), Positives = 43/78 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   ++    R FF +FGT+ +     D+   + +GF F+T+  +  +N +L T  
Sbjct: 281 FVGGLPPSVTPATFRTFFEQFGTLSDCTCMMDRETGKPRGFGFLTYADDSSLNHVLNTRP 340

Query: 435 RTIGGKEVDVKRATPKPD 488
               GKEVDVKRA  K D
Sbjct: 341 IVFDGKEVDVKRAQSKND 358



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 25/77 (32%), Positives = 45/77 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + ++D +R +FS+FG +    +  D    + +GF F+ F   + VN ++   +
Sbjct: 172 FIGGLNWDTTEDSLRRYFSQFGEVGNCAIMRDNMTGRSRGFAFLNFVDPKAVNTVM-VRE 230

Query: 435 RTIGGKEVDVKRATPKP 485
             + GK +D KRA P+P
Sbjct: 231 HYLDGKVIDPKRAIPRP 247



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL    T    R  F  +G +       D  TG+ RGF F+ +    S++ V+ 
Sbjct: 278 QKLFVGGLPPSVTPATFRTFFEQFGTLSDCTCMMDRETGKPRGFGFLTYADDSSLNHVLN 337

Query: 187 AGEHTINNKKVDPKKAKARH 246
                 + K+VD K+A++++
Sbjct: 338 TRPIVFDGKEVDVKRAQSKN 357


>UniRef50_Q5CS11 Cluster: Musashi. RRM domain containing protein,
           splicing related; n=2; Cryptosporidium|Rep: Musashi. RRM
           domain containing protein, splicing related -
           Cryptosporidium parvum Iowa II
          Length = 507

 Score = 79.8 bits (188), Expect = 5e-14
 Identities = 36/79 (45%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA- 186
           K+FVGGL    TD++LR+HFG YG I++++V  D +T R RGF F+ +++P+++++VM  
Sbjct: 167 KIFVGGLPQSCTDEKLREHFGKYGTIKNLSVMVDRDTNRHRGFGFVEYESPDAVEEVMRH 226

Query: 187 AGEHTINNKKVDPKKAKAR 243
             +H I+NK V+ KKA  R
Sbjct: 227 YYDHQIDNKWVECKKALPR 245



 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 37/78 (47%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F GGLS  TT+  LR HF  YGEI    V T+  TGRSRGF FI F + ES+D V+++
Sbjct: 24  KIFCGGLSDVTTNASLRTHFSPYGEIVDSVVLTEKTTGRSRGFGFITFASEESVDAVLSS 83

Query: 190 GEHTINNKKVDPKKAKAR 243
            +  ++ K++D K+A  R
Sbjct: 84  PQ-IVDGKEIDCKRAVPR 100



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 34/92 (36%), Positives = 54/92 (58%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           Q E     G +   + F GGLS   ++  +R  FS +G I++  +  +KT  + +GF FI
Sbjct: 10  QTEGGSSGGPTVPAKIFCGGLSDVTTNASLRTHFSPYGEIVDSVVLTEKTTGRSRGFGFI 69

Query: 387 TFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           TF SE+ V+ +L +P + + GKE+D KRA P+
Sbjct: 70  TFASEESVDAVLSSP-QIVDGKEIDCKRAVPR 100



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TP 431
           FVGGL    +D+++R  F ++GTI  + +  D+  N+ +GF F+ +ES   V ++++   
Sbjct: 169 FVGGLPQSCTDEKLREHFGKYGTIKNLSVMVDRDTNRHRGFGFVEYESPDAVEEVMRHYY 228

Query: 432 KRTIGGKEVDVKRATPK 482
              I  K V+ K+A P+
Sbjct: 229 DHQIDNKWVECKKALPR 245


>UniRef50_Q4W5P0 Cluster: Homologous to drosophila sqd (Squid)
           protein protein 1, isoform b; n=3; Caenorhabditis|Rep:
           Homologous to drosophila sqd (Squid) protein protein 1,
           isoform b - Caenorhabditis elegans
          Length = 308

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 38/82 (46%), Positives = 49/82 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+S E  +++L  HF  YGE+    VK D   GRSRGFAF+ F   E     +A
Sbjct: 29  KKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALA 88

Query: 187 AGEHTINNKKVDPKKAKARHGK 252
           A E TI  K V+ K AK+R  K
Sbjct: 89  AREQTIKGKSVEVKPAKSRENK 110



 Score = 75.8 bits (178), Expect = 8e-13
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL S+ S+ ++R+ F +FG + ++E PFDK    R+ F FI FE E+  +      K
Sbjct: 113 FVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTK 172

Query: 435 RTIGGKEVDVKRATPKPDG-PGA 500
           +T G +E DVK+A P+    PGA
Sbjct: 173 QTFGTRECDVKKAVPQGKRFPGA 195



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/77 (38%), Positives = 47/77 (61%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++K+FVGGL  + ++++LR HF  +G+++ I    D  T   R FAFIVF+  ES DK  
Sbjct: 109 NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKAS 168

Query: 184 AAGEHTINNKKVDPKKA 234
           +  + T   ++ D KKA
Sbjct: 169 SQTKQTFGTRECDVKKA 185



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 23/73 (31%), Positives = 48/73 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+S E++++++ + F+++G + + ++ +D+T  + +GF F+ F + +     L   +
Sbjct: 32  FVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAARE 91

Query: 435 RTIGGKEVDVKRA 473
           +TI GK V+VK A
Sbjct: 92  QTIKGKSVEVKPA 104


>UniRef50_Q4S8N9 Cluster: Chromosome 7 SCAF14703, whole genome
           shotgun sequence; n=4; Clupeocephala|Rep: Chromosome 7
           SCAF14703, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 157

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 33/68 (48%), Positives = 45/68 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLSW+T+   LRD+F  +GEI    V  DP T RSRGF F+ F    S+DKV+A 
Sbjct: 22  KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQ 81

Query: 190 GEHTINNK 213
             H +++K
Sbjct: 82  QHHELDSK 89



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 24/66 (36%), Positives = 37/66 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + S D +R++FS+FG I E  +  D T  + +GF F+TF     V+ +L    
Sbjct: 24  FIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQH 83

Query: 435 RTIGGK 452
             +  K
Sbjct: 84  HELDSK 89


>UniRef50_A7SCX6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 305

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 35/76 (46%), Positives = 50/76 (65%), Gaps = 1/76 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-A 186
           KLFVGGLS+ETT + L+++F  YGE+  +++K D  TGR RGFAF+ FK     D V+  
Sbjct: 30  KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQ 89

Query: 187 AGEHTINNKKVDPKKA 234
              H ++ + +DPK A
Sbjct: 90  VDPHVLDGRTIDPKPA 105



 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 33/77 (42%), Positives = 52/77 (67%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSE-FGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTP 431
           FVGGL  E SD++IR +F + +  + E+E   + + N+R+GFCF++F+SE  V+ + +T 
Sbjct: 120 FVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQ 179

Query: 432 KRTIGGKEVDVKRATPK 482
              I G +V+VKRA PK
Sbjct: 180 FHNIEGNKVEVKRALPK 196



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 31/79 (39%), Positives = 52/79 (65%), Gaps = 1/79 (1%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFG-AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           R +K+FVGGL  ET+D+++R++FG AY  ++ I   T+ ++ R RGF F+ F + +++DK
Sbjct: 115 RVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDK 174

Query: 178 VMAAGEHTINNKKVDPKKA 234
           +     H I   KV+ K+A
Sbjct: 175 ICETQFHNIEGNKVEVKRA 193



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 22/76 (28%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           FVGGLS E + + ++ +FS++G ++ V++  D    + +GF F+ F+ +   + +L +  
Sbjct: 32  FVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVD 91

Query: 432 KRTIGGKEVDVKRATP 479
              + G+ +D K A P
Sbjct: 92  PHVLDGRTIDPKPAAP 107


>UniRef50_P48809 Cluster: Heterogeneous nuclear ribonucleoprotein
           27C; n=11; Endopterygota|Rep: Heterogeneous nuclear
           ribonucleoprotein 27C - Drosophila melanogaster (Fruit
           fly)
          Length = 421

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 34/78 (43%), Positives = 49/78 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSWETT + L  +F  +G+I    V  +  +GRSRGF F+ F  P +++ V+  
Sbjct: 8   KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN 67

Query: 190 GEHTINNKKVDPKKAKAR 243
           G HT++ + +DPK    R
Sbjct: 68  GPHTLDGRTIDPKPCNPR 85



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 32/93 (34%), Positives = 59/93 (63%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +PK+G    ++ F+GGL S +++ ++R FF+ +G + EV + +D+ K + +GF F++FE 
Sbjct: 89  KPKKGGG--YKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEE 146

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           E  V  +       + GK+V++K+A P+ DG G
Sbjct: 147 ESSVEHVTNERYINLNGKQVEIKKAEPR-DGSG 178



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 28/80 (35%), Positives = 45/80 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL    T+ +LR  F  YG++  + +  D    +SRGF F+ F+   S++ V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 190 GEHTINNKKVDPKKAKARHG 249
               +N K+V+ KKA+ R G
Sbjct: 157 RYINLNGKQVEIKKAEPRDG 176



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E + + +  +F  FG I++  +  +    + +GF F+TF     VN +L+   
Sbjct: 10  FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGP 69

Query: 435 RTIGGKEVDVKRATPK 482
            T+ G+ +D K   P+
Sbjct: 70  HTLDGRTIDPKPCNPR 85


>UniRef50_Q1ENZ5 Cluster: RNA-binding protein, putative; n=2;
           Magnoliophyta|Rep: RNA-binding protein, putative - Musa
           acuminata (Banana)
          Length = 465

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 35/81 (43%), Positives = 52/81 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLSS I++ + + +F +FGTI +V + +D    + +GF FIT++SE  V+ +L    
Sbjct: 110 FVGGLSSTITEGDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLNAF 169

Query: 435 RTIGGKEVDVKRATPKPDGPG 497
             + GK V+VKRA PK   PG
Sbjct: 170 HELNGKMVEVKRAVPKEPSPG 190



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 34/78 (43%), Positives = 51/78 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GG+SW+T +  LR +F A+GE+    +  D  TGR+RGF F+VF  P   ++V+  
Sbjct: 7   KLFIGGISWDTNEDSLRKYFSAFGEVVEAVIMKDRTTGRARGFGFVVFADPAVTERVVTE 66

Query: 190 GEHTINNKKVDPKKAKAR 243
            +HTI+ + V+ KKA  R
Sbjct: 67  -KHTIDGRMVEAKKAVPR 83



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS   T+ + + +F  +G I  + V  D NT R RGF FI + + +++DKV+ 
Sbjct: 107 KKIFVGGLSSTITEGDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLL 166

Query: 187 AGEHTINNKKVDPKKA 234
              H +N K V+ K+A
Sbjct: 167 NAFHELNGKMVEVKRA 182



 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 28/78 (35%), Positives = 50/78 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GG+S + ++D +R +FS FG ++E  +  D+T  + +GF F+ F ++  V + + T K
Sbjct: 9   FIGGISWDTNEDSLRKYFSAFGEVVEAVIMKDRTTGRARGFGFVVF-ADPAVTERVVTEK 67

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G+ V+ K+A P+ D
Sbjct: 68  HTIDGRMVEAKKAVPRDD 85


>UniRef50_Q66IT0 Cluster: MGC84815 protein; n=1; Xenopus laevis|Rep:
           MGC84815 protein - Xenopus laevis (African clawed frog)
          Length = 291

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 37/91 (40%), Positives = 53/91 (58%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL+ +T +  LR ++  +GEI  + V  DP + +SRGF F+ FK   S+DK  A
Sbjct: 13  KKLFVGGLNPKTNEDSLRAYYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEASSVDKAQA 72

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVK 279
              H ++ K VD K+A  R        +AVK
Sbjct: 73  DRPHKVDGKDVDSKRAMPREETSPEVHAAVK 103



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 31/79 (39%), Positives = 50/79 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL  + T+++L ++FG +G +   ++    +T  SRGFAF+ F   +S+DKV+ 
Sbjct: 103 KKIFVGGLKKDVTNEDLAEYFGKFGNVTDASIVVAKDTNTSRGFAFVTFDDTDSVDKVIL 162

Query: 187 AGEHTINNKKVDPKKAKAR 243
           A  H I   K D +KA +R
Sbjct: 163 ARPHMIGGHKADVRKALSR 181



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ + ++D +R ++S++G I +V +  D   N+ +GF F+TF+    V+       
Sbjct: 16  FVGGLNPKTNEDSLRAYYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEASSVDKAQADRP 75

Query: 435 RTIGGKEVDVKRATPKPD 488
             + GK+VD KRA P+ +
Sbjct: 76  HKVDGKDVDSKRAMPREE 93



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 22/78 (28%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  +++++++  +F +FG + +  +   K  N  +GF F+TF+    V+ ++    
Sbjct: 106 FVGGLKKDVTNEDLAEYFGKFGNVTDASIVVAKDTNTSRGFAFVTFDDTDSVDKVILARP 165

Query: 435 RTIGGKEVDVKRATPKPD 488
             IGG + DV++A  + +
Sbjct: 166 HMIGGHKADVRKALSREE 183


>UniRef50_UPI0000F1F0C3 Cluster: PREDICTED: similar to LOC561459
           protein; n=1; Danio rerio|Rep: PREDICTED: similar to
           LOC561459 protein - Danio rerio
          Length = 329

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 32/78 (41%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL W TT + LR++F  YGE+    +  D +T +SRGF F+ FK P  +  V+  
Sbjct: 24  KLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKSTNQSRGFGFVKFKDPNCVRTVLDT 83

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + +DPK    R
Sbjct: 84  KPHNLDGRNIDPKPCTPR 101



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 26/76 (34%), Positives = 45/76 (59%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    + + +RN+FS++G +++  +  DK+ NQ +GF F+ F+    V  +L T  
Sbjct: 26  FVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKSTNQSRGFGFVKFKDPNCVRTVLDTKP 85

Query: 435 RTIGGKEVDVKRATPK 482
             + G+ +D K  TP+
Sbjct: 86  HNLDGRNIDPKPCTPR 101


>UniRef50_Q4SEZ3 Cluster: Chromosome 1 SCAF14609, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 1
           SCAF14609, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 476

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 32/78 (41%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL W TT + LR++F  YGE+    +  D  T +SRGF F+ FK P  +  V+  
Sbjct: 1   KLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVRTVLET 60

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ + +DPK    R
Sbjct: 61  KPHNLDGRNIDPKPCTPR 78



 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 27/76 (35%), Positives = 46/76 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    + + +RN+FS++G +++  +  DKT NQ +GF F+ F+    V  +L+T  
Sbjct: 3   FVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVRTVLETKP 62

Query: 435 RTIGGKEVDVKRATPK 482
             + G+ +D K  TP+
Sbjct: 63  HNLDGRNIDPKPCTPR 78



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 7/91 (7%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWED-------FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKN 362
           Q ++SR KEG   +  D       FVGG+     + E+R++F+ FG + EV M +D  K 
Sbjct: 81  QPEKSRTKEGWKGSKADSNKSKKIFVGGIPHNCGEPELRDYFNRFGVVTEVVMIYDAEKQ 140

Query: 363 QRKGFCFITFESEQVVNDLLKTPKRTIGGKE 455
           + +GF FITFE+EQ V+  +      I GK+
Sbjct: 141 RPRGFGFITFEAEQSVDQAVNMHFHDIMGKK 171



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/72 (36%), Positives = 41/72 (56%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           + +K+FVGG+     + ELRD+F  +G +  + +  D    R RGF FI F+A +S+D+ 
Sbjct: 100 KSKKIFVGGIPHNCGEPELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQA 159

Query: 181 MAAGEHTINNKK 216
           +    H I  KK
Sbjct: 160 VNMHFHDIMGKK 171


>UniRef50_UPI0001560FCC Cluster: PREDICTED: hypothetical protein;
           n=1; Equus caballus|Rep: PREDICTED: hypothetical protein
           - Equus caballus
          Length = 501

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 32/76 (42%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+  +S+++IR +F  FG I ++++P +   N+R+ FCFIT+  E+ V  LL+T  
Sbjct: 184 FVGGLNPRLSEEKIRQYFGTFGVIQDIKLPVNSKTNERRAFCFITYADEKAVRKLLETRY 243

Query: 435 RTIGGKEVDVKRATPK 482
             IG +  +VK A PK
Sbjct: 244 HRIGSRRCEVKIAFPK 259



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 29/77 (37%), Positives = 48/77 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLS   + + L D+   +GE+    +K  P TG SRGF F++FK   +++KV+  
Sbjct: 97  KMFIGGLSGNVSKQGLLDYLSQFGEVVDFIIKIHPGTGLSRGFGFVLFKDSATVEKVLQV 156

Query: 190 GEHTINNKKVDPKKAKA 240
            EH ++ K +  ++AKA
Sbjct: 157 KEHKLDGKTIQLRRAKA 173



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 24/86 (27%), Positives = 49/86 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL+   +++++R +FG +G I+ I +  +  T   R F FI +   +++ K++ 
Sbjct: 181 KKVFVGGLNPRLSEEKIRQYFGTFGVIQDIKLPVNSKTNERRAFCFITYADEKAVRKLLE 240

Query: 187 AGEHTINNKKVDPKKAKARHGKILSE 264
              H I +++ + K A  +  K L +
Sbjct: 241 TRYHRIGSRRCEVKIAFPKEYKRLRQ 266



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 19/73 (26%), Positives = 39/73 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS  +S   + ++ S+FG +++  +         +GF F+ F+    V  +L+  +
Sbjct: 99  FIGGLSGNVSKQGLLDYLSQFGEVVDFIIKIHPGTGLSRGFGFVLFKDSATVEKVLQVKE 158

Query: 435 RTIGGKEVDVKRA 473
             + GK + ++RA
Sbjct: 159 HKLDGKTIQLRRA 171


>UniRef50_Q9SU99 Cluster: HnRNP-like protein; n=10; core
           eudicotyledons|Rep: HnRNP-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 524

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 37/84 (44%), Positives = 55/84 (65%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G + T + FVGGL S I++ E +N+F +FGTI +V + +D    + +GF FITF+SE+ V
Sbjct: 110 GGARTKKIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESV 169

Query: 411 NDLLKTPKRTIGGKEVDVKRATPK 482
           + +L      + GK V+VKRA PK
Sbjct: 170 DMVLHKTFHELNGKMVEVKRAVPK 193



 Score = 75.8 bits (178), Expect = 8e-13
 Identities = 33/78 (42%), Positives = 52/78 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GG+SW+T ++ L+++FG YG++    +  D  TGR+RGF FIVF  P   ++V+  
Sbjct: 9   KLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-M 67

Query: 190 GEHTINNKKVDPKKAKAR 243
            +H I+ + V+ KKA  R
Sbjct: 68  DKHIIDGRTVEAKKAVPR 85



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 33/78 (42%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGL    T+ E +++F  +G I  + V  D NT R RGF FI F + ES+D V
Sbjct: 113 RTKKIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMV 172

Query: 181 MAAGEHTINNKKVDPKKA 234
           +    H +N K V+ K+A
Sbjct: 173 LHKTFHELNGKMVEVKRA 190



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/78 (29%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GG+S +  ++ ++ +F ++G ++E  +  D+T  + +GF FI F    V   ++   K
Sbjct: 11  FIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-MDK 69

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ K+A P+ D
Sbjct: 70  HIIDGRTVEAKKAVPRDD 87


>UniRef50_P48810 Cluster: Heterogeneous nuclear ribonucleoprotein
           87F; n=16; Coelomata|Rep: Heterogeneous nuclear
           ribonucleoprotein 87F - Drosophila melanogaster (Fruit
           fly)
          Length = 385

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 35/79 (44%), Positives = 55/79 (69%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  ++ LR++F  +G+I S+N+ +D +TG+ RGFAFI F   + +DK++ 
Sbjct: 115 KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIIL 174

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H+I NK +D KKA A+
Sbjct: 175 QKTHSIKNKTLDVKKAIAK 193



 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 35/78 (44%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD  L+ HF  +G I  + V  DP T RSRGF FI +     ID    A
Sbjct: 25  KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNA 84

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 85  RPHKIDGRTVEPKRAVPR 102



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 31/95 (32%), Positives = 53/95 (55%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q+   P  G +T  + FVGGL  +  ++ +R +F +FG I+ V +  DK   +++GF F
Sbjct: 102 RQEIDSPNAG-ATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAF 160

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           I F+    V+ ++     +I  K +DVK+A  K D
Sbjct: 161 IEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +DD ++  F ++G I++V +  D    + +GF FIT+    ++++      
Sbjct: 27  FIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARP 86

Query: 435 RTIGGKEVDVKRATPKP--DGPGA 500
             I G+ V+ KRA P+   D P A
Sbjct: 87  HKIDGRTVEPKRAVPRQEIDSPNA 110


>UniRef50_Q4SQV2 Cluster: Chromosome 1 SCAF14529, whole genome
           shotgun sequence; n=10; Euteleostomi|Rep: Chromosome 1
           SCAF14529, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 487

 Score = 75.8 bits (178), Expect = 8e-13
 Identities = 35/76 (46%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL  +T +  L +HF  +GEIE   V +D  TG+ RGF F+ F   +S DK + 
Sbjct: 96  KKIFVGGLKDDTEENHLTEHFSQFGEIEKAEVISDKETGKKRGFGFVYFVDQDSADKSVV 155

Query: 187 AGEHTINNKKVDPKKA 234
              HTIN  KV+ KKA
Sbjct: 156 IKFHTINGHKVEVKKA 171



 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 33/78 (42%), Positives = 44/78 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL+ +T D  LR HF  +G +    V  +    RSR F F+ +  PE  D  MAA
Sbjct: 6   KLFVGGLNVDTDDDGLRKHFEQFGTLTDCVVVVNKQVQRSRCFGFVTYSTPEEADSAMAA 65

Query: 190 GEHTINNKKVDPKKAKAR 243
             HT++   V+ K+A AR
Sbjct: 66  RPHTVDGNPVEVKRAVAR 83



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 28/79 (35%), Positives = 44/79 (55%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+      + L D+F  +G +E   + +D  TG+ RGF F+ F   +S  K + 
Sbjct: 349 KKIFVGGVQDHVEAEHLTDYFSQFGAVEKAEIISDKLTGKKRGFGFVFFVDTDSATKAVL 408

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HTI+  KV+ KKA  +
Sbjct: 409 TRYHTISGNKVEAKKAMTK 427



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 24/78 (30%), Positives = 43/78 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ +  DD +R  F +FGT+ +  +  +K   + + F F+T+ + +  +  +    
Sbjct: 8   FVGGLNVDTDDDGLRKHFEQFGTLTDCVVVVNKQVQRSRCFGFVTYSTPEEADSAMAARP 67

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G  V+VKRA  + D
Sbjct: 68  HTVDGNPVEVKRAVARED 85



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 23/78 (29%), Positives = 42/78 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+   +  + + ++FS+FG + + E+  DK   +++GF F+ F         + T  
Sbjct: 352 FVGGVQDHVEAEHLTDYFSQFGAVEKAEIISDKLTGKKRGFGFVFFVDTDSATKAVLTRY 411

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G +V+ K+A  K +
Sbjct: 412 HTISGNKVEAKKAMTKQE 429



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 25/78 (32%), Positives = 43/78 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  +  ++ +   FS+FG I + E+  DK   +++GF F+ F  +   +  +    
Sbjct: 99  FVGGLKDDTEENHLTEHFSQFGEIEKAEVISDKETGKKRGFGFVYFVDQDSADKSVVIKF 158

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI G +V+VK+A  K +
Sbjct: 159 HTINGHKVEVKKALTKQE 176



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 22/56 (39%), Positives = 30/56 (53%)
 Frame = +1

Query: 76  YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 243
           YG++    V  +   GRSR F FI +  PE  D  MAA  H ++   V+ K+A AR
Sbjct: 281 YGQLSDCVVVKNKELGRSRCFGFITYSTPEEADSAMAASPHVVDGHNVELKRAVAR 336


>UniRef50_A7NUC5 Cluster: Chromosome chr18 scaffold_1, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr18 scaffold_1, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 494

 Score = 75.8 bits (178), Expect = 8e-13
 Identities = 35/81 (43%), Positives = 53/81 (65%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDL 419
           T+ + FVGGLSS ++++E +N+F  FG I +V +  D    + +GF FITFESE+ V  +
Sbjct: 121 TSKKIFVGGLSSNLTEEEFKNYFERFGRITDVVVMHDSATRRPRGFGFITFESEESVEHV 180

Query: 420 LKTPKRTIGGKEVDVKRATPK 482
           ++     + GK V+VKRA PK
Sbjct: 181 MQNNFYELNGKRVEVKRAVPK 201



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 31/76 (40%), Positives = 49/76 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS   T++E +++F  +G I  + V  D  T R RGF FI F++ ES++ VM 
Sbjct: 123 KKIFVGGLSSNLTEEEFKNYFERFGRITDVVVMHDSATRRPRGFGFITFESEESVEHVMQ 182

Query: 187 AGEHTINNKKVDPKKA 234
              + +N K+V+ K+A
Sbjct: 183 NNFYELNGKRVEVKRA 198



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 19/46 (41%), Positives = 32/46 (69%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVGG+S  I++  +R++FS++GT++E  +  D  +  R GF F+TF
Sbjct: 8   FVGGVSGAITEGLLRDYFSKYGTVVETYIRRDSGRTPRGGFGFVTF 53



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA- 186
           KLFVGG+S   T+  LRD+F  YG +    ++ D       GF F+ F    S+ + +  
Sbjct: 6   KLFVGGVSGAITEGLLRDYFSKYGTVVETYIRRDSGRTPRGGFGFVTFADAASLSRALQD 65

Query: 187 AGEHTINNKKV 219
             +H I  ++V
Sbjct: 66  QQQHFIQGQRV 76


>UniRef50_Q9UAF2 Cluster: Musashi; n=1; Halocynthia roretzi|Rep:
           Musashi - Halocynthia roretzi (Sea squirt)
          Length = 335

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 33/73 (45%), Positives = 49/73 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL+ +T D  LR +F ++GE+    V  D  TG SRGF F+ F   +S+ KV+  
Sbjct: 10  KIFIGGLARQTEDDGLRAYFESFGEVVESIVMKDKVTGFSRGFGFVKFSDQQSVSKVLKN 69

Query: 190 GEHTINNKKVDPK 228
           G H+++NKK+DPK
Sbjct: 70  GPHSLDNKKIDPK 82



 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSE-FGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTP 431
           F+GG++   + ++++ +F E FGT+ EV    +K  N+ KGF F+TF +EQ VN  +   
Sbjct: 107 FIGGIAQSSTTEDVKKYFEEGFGTVNEVVFVINKEDNRHKGFGFVTFANEQAVNKAVDMH 166

Query: 432 KRTIGGKEVDVKRATPKPDGP 494
              IG K+++ KRATP+   P
Sbjct: 167 FHEIGDKQIEAKRATPREKMP 187



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 27/76 (35%), Positives = 44/76 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ +  DD +R +F  FG ++E  +  DK     +GF F+ F  +Q V+ +LK   
Sbjct: 12  FIGGLARQTEDDGLRAYFESFGEVVESIVMKDKVTGFSRGFGFVKFSDQQSVSKVLKNGP 71

Query: 435 RTIGGKEVDVKRATPK 482
            ++  K++D K  TPK
Sbjct: 72  HSLDNKKIDPKPCTPK 87



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 19/79 (24%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFG-AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K+F+GG++  +T ++++ +F   +G +  +    +    R +GF F+ F   ++++K + 
Sbjct: 105 KIFIGGIAQSSTTEDVKKYFEEGFGTVNEVVFVINKEDNRHKGFGFVTFANEQAVNKAVD 164

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H I +K+++ K+A  R
Sbjct: 165 MHFHEIGDKQIEAKRATPR 183


>UniRef50_UPI00005A10B6 Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP-1) (Topoisomerase-inhibitor
           suppressed); n=4; Eutheria|Rep: PREDICTED: similar to
           Heterogeneous nuclear ribonucleoprotein A1
           (Helix-destabilizing protein) (Single-strand binding
           protein) (hnRNP core protein A1) (HDP-1)
           (Topoisomerase-inhibitor suppressed) - Canis familiaris
          Length = 407

 Score = 54.4 bits (125), Expect(2) = 2e-12
 Identities = 22/60 (36%), Positives = 37/60 (61%)
 Frame = +1

Query: 64  HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 243
           +F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++    H +N    + +KA ++
Sbjct: 211 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKSHPVNGHNWEVRKALSK 270



 Score = 40.3 bits (90), Expect(2) = 2e-12
 Identities = 16/26 (61%), Positives = 21/26 (80%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI 87
           KLF+GGLS+ETTD+ LR HF  +G +
Sbjct: 154 KLFIGGLSFETTDESLRSHFEQWGTL 179



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 15/62 (24%), Positives = 34/62 (54%)
 Frame = +3

Query: 303 FFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           +F ++G I  +E+  D+   +++GF F+TF+    V+ ++      + G   +V++A  K
Sbjct: 211 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKSHPVNGHNWEVRKALSK 270

Query: 483 PD 488
            +
Sbjct: 271 QE 272



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           F+GGLS E +D+ +R+ F ++GT+ +   P ++
Sbjct: 156 FIGGLSFETTDESLRSHFEQWGTLTDCVAPVEE 188


>UniRef50_Q86ER1 Cluster: Clone ZZD1516 mRNA sequence; n=2;
           Schistosoma japonicum|Rep: Clone ZZD1516 mRNA sequence -
           Schistosoma japonicum (Blood fluke)
          Length = 313

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 35/78 (44%), Positives = 48/78 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT+ +L+D +  +GEI  + V  D  T RSRGF FI +K PE +D   A 
Sbjct: 18  KLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQAN 77

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 78  RPHEIDGKTVEAKRAMPR 95



 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 31/78 (39%), Positives = 44/78 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL  + T +ELR++F  YG I    V     +G SRGF F+ F   + +DK +  
Sbjct: 109 KLFVGGLKKDVTHEELREYFSKYGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILY 168

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I + + D KKA ++
Sbjct: 169 KPHHIGSSRADVKKALSK 186



 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 30/92 (32%), Positives = 50/92 (54%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           +++S   E   T  + FVGGL  +++ +E+R +FS++G I E E+   K   + +GF F+
Sbjct: 95  REDSNSPESHMTVTKLFVGGLKKDVTHEELREYFSKYGNITECEVVAWKESGESRGFGFV 154

Query: 387 TFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           TF+    V+  +      IG    DVK+A  K
Sbjct: 155 TFDDYDPVDKAILYKPHHIGSSRADVKKALSK 186



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 26/78 (33%), Positives = 49/78 (62%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   ++ ++++F+S++G I++V +  D   N+ +GF FIT++  ++V+       
Sbjct: 20  FIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKEPEMVDAAQANRP 79

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+ D
Sbjct: 80  HEIDGKTVEAKRAMPRED 97


>UniRef50_UPI00005A4DCF Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP-1) (Topoisomerase-inhibitor
           suppressed); n=2; Canis lupus familiaris|Rep: PREDICTED:
           similar to Heterogeneous nuclear ribonucleoprotein A1
           (Helix-destabilizing protein) (Single-strand binding
           protein) (hnRNP core protein A1) (HDP-1)
           (Topoisomerase-inhibitor suppressed) - Canis familiaris
          Length = 433

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 31/79 (39%), Positives = 52/79 (65%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LR +F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++ 
Sbjct: 146 KKIFVGGIKEDTEEHHLRYYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI 205

Query: 187 AGEHTINNKKVDPKKAKAR 243
              HT+N+   + +KA ++
Sbjct: 206 QKYHTVNDHNCEVRKALSK 224



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 28/73 (38%), Positives = 43/73 (58%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE 195
           F+ GLS++TT + LR HF  +G +       DPNT  SRGF F+++   E +D  M A  
Sbjct: 58  FISGLSFKTTYETLRSHFEQWGMLIDCVAMRDPNTKLSRGFGFVMYATMEEVDAAMKARP 117

Query: 196 HTINNKKVDPKKA 234
           H ++ + V+ K+A
Sbjct: 118 HKVDGRVVERKRA 130



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 23/94 (24%), Positives = 50/94 (53%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           Q++S+      T  + FVGG+  +  +  +R +F ++G I  +E+  D+   +++GF F+
Sbjct: 133 QEDSQRPGAHLTVKKIFVGGIKEDTEEHHLRYYFEQYGKIEVIEIMTDRGSGKKRGFAFV 192

Query: 387 TFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           TF+    V+ ++     T+     +V++A  K +
Sbjct: 193 TFDDHDSVDKIVIQKYHTVNDHNCEVRKALSKQE 226



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 2/87 (2%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           W  F+ GLS + + + +R+ F ++G +++     D      +GF F+ + + + V+  +K
Sbjct: 55  WNFFISGLSFKTTYETLRSHFEQWGMLIDCVAMRDPNTKLSRGFGFVMYATMEEVDAAMK 114

Query: 426 TPKRTIGGKEVDVKRATPKPDG--PGA 500
                + G+ V+ KRA  + D   PGA
Sbjct: 115 ARPHKVDGRVVERKRAVSQEDSQRPGA 141


>UniRef50_Q8W555 Cluster: AT3g07810/F17A17_15; n=11;
           Magnoliophyta|Rep: AT3g07810/F17A17_15 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 494

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 30/78 (38%), Positives = 53/78 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GG+SW+T ++ L+++F ++GE+    +  D  TGR+RGF F+VF  P ++ +++  
Sbjct: 7   KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVIT 65

Query: 190 GEHTINNKKVDPKKAKAR 243
            +H I+ + V+ KKA  R
Sbjct: 66  EKHNIDGRLVEAKKAVPR 83



 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 34/89 (38%), Positives = 53/89 (59%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G   T + FVGGL S +++ + + +F +FGT  +V + +D    + +GF FIT++SE+ V
Sbjct: 103 GPGRTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAV 162

Query: 411 NDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
             +L      + GK V+VKRA PK   PG
Sbjct: 163 EKVLLKTFHELNGKMVEVKRAVPKELSPG 191



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVGGL    T+ + + +F  +G    + V  D NT R RGF FI + + E+++KV
Sbjct: 106 RTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKV 165

Query: 181 MAAGEHTINNKKVDPKKA 234
           +    H +N K V+ K+A
Sbjct: 166 LLKTFHELNGKMVEVKRA 183



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 25/78 (32%), Positives = 50/78 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GG+S + +++ ++ +FS FG ++E  +  D+T  + +GF F+ F ++  V +++ T K
Sbjct: 9   FIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVF-ADPAVAEIVITEK 67

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ K+A P+ D
Sbjct: 68  HNIDGRLVEAKKAVPRDD 85


>UniRef50_Q9U5E3 Cluster: CiMsi; n=1; Ciona intestinalis|Rep: CiMsi
           - Ciona intestinalis (Transparent sea squirt)
          Length = 393

 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 38/107 (35%), Positives = 59/107 (55%), Gaps = 1/107 (0%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+ +TT + LR +F  YGE+    +  D  TG SRGF F+ F  P S+  V+ A
Sbjct: 11  KIFVGGLARQTTLEGLRSYFENYGEVSDCVLMKDKETGFSRGFGFVTFTNPSSVAAVVKA 70

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVK-SQMMKSETSSVNLELS 327
             H ++NK +DPK    +  +   + S+   S+  K     +++E S
Sbjct: 71  RPHNLDNKMIDPKPCTTKAAQQQKKVSSTNYSKAHKIFIGGISMEAS 117



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 31/92 (33%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK--TKNQRKGF 377
           QQQ+       S   + F+GG+S E S+ +++++F  +GT++EV    +K  T    KGF
Sbjct: 91  QQQKKVSSTNYSKAHKIFIGGISMEASEADVQSYFERYGTVVEVVFVVNKEDTSKPHKGF 150

Query: 378 CFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
            F+TFE E  V+  +      I  K V+ K+A
Sbjct: 151 GFVTFEDESSVDQAIAKHYHIIKDKRVEAKKA 182



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 27/80 (33%), Positives = 51/80 (63%), Gaps = 2/80 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRS-RGFAFIVFKAPESIDKVM 183
           K+F+GG+S E ++ +++ +F  YG + E + V    +T +  +GF F+ F+   S+D+ +
Sbjct: 106 KIFIGGISMEASEADVQSYFERYGTVVEVVFVVNKEDTSKPHKGFGFVTFEDESSVDQAI 165

Query: 184 AAGEHTINNKKVDPKKAKAR 243
           A   H I +K+V+ KKA++R
Sbjct: 166 AKHYHIIKDKRVEAKKAESR 185



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 22/76 (28%), Positives = 40/76 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ + + + +R++F  +G + +  +  DK     +GF F+TF +   V  ++K   
Sbjct: 13  FVGGLARQTTLEGLRSYFENYGEVSDCVLMKDKETGFSRGFGFVTFTNPSSVAAVVKARP 72

Query: 435 RTIGGKEVDVKRATPK 482
             +  K +D K  T K
Sbjct: 73  HNLDNKMIDPKPCTTK 88


>UniRef50_UPI0000DB6D53 Cluster: PREDICTED: similar to CG32169-PA
           isoform 2; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG32169-PA isoform 2 - Apis mellifera
          Length = 426

 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 34/81 (41%), Positives = 52/81 (64%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT ++++++F  +G IE   +  D  T R RGF F+ F++ + +DKV
Sbjct: 185 RTKKIFVGGLSAPTTLEDVKNYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKV 244

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
                H INNK V+ KKA+ +
Sbjct: 245 CEIHFHEINNKMVECKKAQPK 265



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 31/76 (40%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS+  + ++++N+F +FG I +  + FDK  N+ +GF F+TF+SE VV+ + +   
Sbjct: 190 FVGGLSAPTTLEDVKNYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHF 249

Query: 435 RTIGGKEVDVKRATPK 482
             I  K V+ K+A PK
Sbjct: 250 HEINNKMVECKKAQPK 265



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
 Frame = +1

Query: 130 RGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR--HGKILSEDSAV 276
           +GF FI F  P S+DKV+A G H ++ KK+DPK A  R  H K+++    +
Sbjct: 139 KGFGFITFADPASVDKVLAQGNHELDGKKIDPKVAFPRRTHPKMVTRTKKI 189


>UniRef50_Q5TTQ2 Cluster: ENSANGP00000026814; n=3;
           Endopterygota|Rep: ENSANGP00000026814 - Anopheles
           gambiae str. PEST
          Length = 358

 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 33/78 (42%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL + TTD  L+ +F  +G++  + V  DP T RSRGF FI +     ID   A+
Sbjct: 28  KLFIGGLDYRTTDDTLKAYFEKWGKVVDVVVMKDPKTKRSRGFGFITYSKSYMIDDAQAS 87

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ + V+PK+A  R
Sbjct: 88  RPHKIDGRVVEPKRAVPR 105



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 32/76 (42%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  ++ LR++F  YG + S  + TD + G+ RGF F+ F   + +DK++ 
Sbjct: 118 KKLFVGGLRDDFDEEHLREYFSKYGNVISACIVTDKDNGKKRGFGFVEFDDYDPVDKIIL 177

Query: 187 AGEHTINNKKVDPKKA 234
              HTI NK +D KKA
Sbjct: 178 QKSHTIQNKLLDVKKA 193



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 31/95 (32%), Positives = 56/95 (58%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +Q  +RP+ G S+  + FVGGL  +  ++ +R +FS++G ++   +  DK   +++GF F
Sbjct: 105 RQDINRPEAG-SSVKKLFVGGLRDDFDEEHLREYFSKYGNVISACIVTDKDNGKKRGFGF 163

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           + F+    V+ ++     TI  K +DVK+A PK D
Sbjct: 164 VEFDDYDPVDKIILQKSHTIQNKLLDVKKALPKQD 198



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 24/78 (30%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL    +DD ++ +F ++G +++V +  D    + +GF FIT+    +++D   +  
Sbjct: 30  FIGGLDYRTTDDTLKAYFEKWGKVVDVVVMKDPKTKRSRGFGFITYSKSYMIDDAQASRP 89

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ KRA P+ D
Sbjct: 90  HKIDGRVVEPKRAVPRQD 107


>UniRef50_UPI0000E4626F Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A2/B1 isoform 1; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           heterogeneous nuclear ribonucleoprotein A2/B1 isoform 1
           - Strongylocentrotus purpuratus
          Length = 360

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 33/87 (37%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +  KLF+GGLS+ T +  ++++FG +GEI    V  DP + +S+GF F+ F + + ++KV
Sbjct: 11  QERKLFLGGLSYNTKEDNIKEYFGQFGEIVDCCVIKDPTSLKSKGFGFVTFASRKEVNKV 70

Query: 181 MAA---GEHTINNKKVDPKKAKARHGK 252
           M A     H ++N+ VD ++A AR  K
Sbjct: 71  MGARKENPHRLDNRAVDVRRAMARDEK 97



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 29/78 (37%), Positives = 48/78 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K FVGG+  ETT++ELR +F  +G+I  + +        S+GF+FI +   + +D+++  
Sbjct: 105 KCFVGGIPKETTEEELRAYFSQFGQIVELALHL------SKGFSFITYDDTDCVDQIVMK 158

Query: 190 GEHTINNKKVDPKKAKAR 243
             H IN KKV+ KKA ++
Sbjct: 159 KFHHINGKKVEGKKAYSK 176



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 4/84 (4%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS    +D I+ +F +FG I++  +  D T  + KGF F+TF S + VN ++   K
Sbjct: 16  FLGGLSYNTKEDNIKEYFGQFGEIVDCCVIKDPTSLKSKGFGFVTFASRKEVNKVMGARK 75

Query: 435 RT---IGGKEVDVKRATPKPD-GP 494
                +  + VDV+RA  + + GP
Sbjct: 76  ENPHRLDNRAVDVRRAMARDEKGP 99



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 30/94 (31%), Positives = 55/94 (58%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           + E  PK   + +++ FVGG+  E +++E+R +FS+FG I+E+ +      +  KGF FI
Sbjct: 94  RDEKGPK---NPSFKCFVGGIPKETTEEELRAYFSQFGQIVELAL------HLSKGFSFI 144

Query: 387 TFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           T++    V+ ++      I GK+V+ K+A  K +
Sbjct: 145 TYDDTDCVDQIVMKKFHHINGKKVEGKKAYSKEE 178


>UniRef50_A7SSE1 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 164

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 30/70 (42%), Positives = 46/70 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+  T+ ++L D+F AYG++ S+N+  DP T + RGF F+ F++ +S+ K    
Sbjct: 95  KIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADE 154

Query: 190 GEHTINNKKV 219
             H IN K V
Sbjct: 155 HYHQINGKTV 164



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 33/78 (42%), Positives = 44/78 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+  T    L+ +F  YGE+    + TDP T RSR F FI F+ P  +  VM  
Sbjct: 2   KIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDD 61

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++ K +DPK A  R
Sbjct: 62  KPHQLDGKMIDPKPAVPR 79



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 23/79 (29%), Positives = 41/79 (51%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P+   +  ++ FVGGL+   S  ++ ++F+ +G ++ V +  D    + +GF F+TFES+
Sbjct: 86  PQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESK 145

Query: 402 QVVNDLLKTPKRTIGGKEV 458
             V          I GK V
Sbjct: 146 DSVTKAADEHYHQINGKTV 164


>UniRef50_A7RG33 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 177

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 28/79 (35%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K+F+GGL+W TT++ L+D+F  +G I + + +K D   GRSRGF F+ +++ +S+++V+ 
Sbjct: 1   KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRD---GRSRGFGFVTYESSDSVNEVLK 57

Query: 187 AGEHTINNKKVDPKKAKAR 243
             +H +++++++PK++  R
Sbjct: 58  KKDHVLDDREIEPKRSVPR 76



 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 28/82 (34%), Positives = 52/82 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++++FS++GTI  V+    K   + +GF F+T+ES   VN++LK   
Sbjct: 3   FIGGLNWNTTEEGLKDYFSQWGTI--VDCVIMKRDGRSRGFGFVTYESSDSVNEVLKKKD 60

Query: 435 RTIGGKEVDVKRATPKPDGPGA 500
             +  +E++ KR+ P+ D  GA
Sbjct: 61  HVLDDREIEPKRSVPR-DESGA 81



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 7/83 (8%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAY------GEIESINVKTD-PNTGRSRGFAFIVFKAPES 168
           K+FVGGL+  T +++++++F +       GE+  +++K D  N  R RGFAF+ F   E 
Sbjct: 90  KIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEI 149

Query: 169 IDKVMAAGEHTINNKKVDPKKAK 237
           ++KV A   H I  K+ + KKA+
Sbjct: 150 VEKVCAMKYHEIRMKQCEVKKAE 172



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 29/99 (29%), Positives = 57/99 (57%), Gaps = 7/99 (7%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEF------GTILEVEMPFDKTKNQR 368
           + ES   E  S T + FVGGL+S   +++I+ +F+        G +++V++  D+   +R
Sbjct: 76  RDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKR 135

Query: 369 -KGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
            +GF F+TF+++++V  +       I  K+ +VK+A P+
Sbjct: 136 IRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 174


>UniRef50_UPI00005A196B Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP); n=1; Canis lupus familiaris|Rep:
           PREDICTED: similar to Heterogeneous nuclear
           ribonucleoprotein A1 (Helix-destabilizing protein)
           (Single-strand binding protein) (hnRNP core protein A1)
           (HDP) - Canis familiaris
          Length = 286

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 31/76 (40%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+  +T +  LR +F  YG+IE I + TD  +G+ RGFAF+ F   +S DK++ 
Sbjct: 59  KKIFVGGIEEDTEEHHLRGYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFNDHDSADKIVI 118

Query: 187 AGEHTINNKKVDPKKA 234
              HT+N    +  KA
Sbjct: 119 QKYHTVNGHNCEVGKA 134



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 20/78 (25%), Positives = 41/78 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  +  +  +R +F ++G I  +E+  D+   +++GF F+TF      + ++    
Sbjct: 62  FVGGIEEDTEEHHLRGYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFNDHDSADKIVIQKY 121

Query: 435 RTIGGKEVDVKRATPKPD 488
            T+ G   +V +A  K +
Sbjct: 122 HTVNGHNCEVGKALLKQE 139


>UniRef50_A7PIB0 Cluster: Chromosome chr13 scaffold_17, whole genome
           shotgun sequence; n=2; core eudicotyledons|Rep:
           Chromosome chr13 scaffold_17, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 287

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 31/71 (43%), Positives = 44/71 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+WET  + +RDHF  YGEI    + +D  TGRS+G+ F+ FK PE+  K    
Sbjct: 17  KVFVGGLAWETPKEAMRDHFEKYGEILEAVIISDKLTGRSKGYGFVTFKEPEAAKKACED 76

Query: 190 GEHTINNKKVD 222
               IN ++ +
Sbjct: 77  ATPMINGRRAN 87



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G +T  + FVGGL+ E   + +R+ F ++G ILE  +  DK   + KG+ F+TF+  +  
Sbjct: 11  GDTTLTKVFVGGLAWETPKEAMRDHFEKYGEILEAVIISDKLTGRSKGYGFVTFKEPEAA 70

Query: 411 NDLLKTPKRTIGGKEVDVKRAT 476
               +     I G+  +   A+
Sbjct: 71  KKACEDATPMINGRRANCNLAS 92


>UniRef50_A4V6N1 Cluster: HnRNP A2/B1 protein; n=1; Dugesia
           japonica|Rep: HnRNP A2/B1 protein - Dugesia japonica
           (Planarian)
          Length = 386

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 31/78 (39%), Positives = 48/78 (61%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           + +K+FVGGL  +TT+ ++R +F  YG++  +    D    +SRGF F+VFK  ES+D+ 
Sbjct: 16  KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEAESVDRC 75

Query: 181 MAAGEHTINNKKVDPKKA 234
            A   H +  K VD K+A
Sbjct: 76  QAERPHQLLGKIVDTKRA 93



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 31/76 (40%), Positives = 48/76 (63%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +++F+GG+    T+ +L+D+F  +GEI    +K D  +G SRGFAFI F   + +DKV+ 
Sbjct: 109 KRIFIGGIRRFFTEDDLKDYFSTFGEIVDCTIKRDNVSGLSRGFAFITFTDRDIVDKVIL 168

Query: 187 AGEHTINNKKVDPKKA 234
           +  H I +  VD KKA
Sbjct: 169 SKPHAIRHCIVDVKKA 184



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 28/78 (35%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  + ++ ++R +FS++G + +V    DKT N+ +GF F+ F+  + V+       
Sbjct: 21  FVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEAESVDRCQAERP 80

Query: 435 RTIGGKEVDVKRATPKPD 488
             + GK VD KRA PK +
Sbjct: 81  HQLLGKIVDTKRAMPKEE 98



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 23/73 (31%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GG+    ++D+++++FS FG I++  +  D      +GF FITF    +V+ ++ +  
Sbjct: 112 FIGGIRRFFTEDDLKDYFSTFGEIVDCTIKRDNVSGLSRGFAFITFTDRDIVDKVILSKP 171

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK+A
Sbjct: 172 HAIRHCIVDVKKA 184


>UniRef50_Q9LNP1 Cluster: F1L3.34; n=2; Arabidopsis thaliana|Rep:
           F1L3.34 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 392

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 34/81 (41%), Positives = 49/81 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGG+SWETT +   ++FG +GE+    + TD  TG  RGF F+ F      +KV+  
Sbjct: 90  KLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE 149

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            +H I+++KVD K+   R  K
Sbjct: 150 -DHVIDDRKVDLKRTLPRGDK 169



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 33/86 (38%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query: 237 STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND 416
           S T + FVGGL   + +DE++N+F  +G I+E ++ +D    + +GF F+TF++E  V+ 
Sbjct: 177 SKTRKIFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDR 236

Query: 417 LLKTPK-RTIGGKEVDVKRATPKPDG 491
           L    K   +G K+V++KRA PK  G
Sbjct: 237 LFSDGKVHELGDKQVEIKRAEPKRTG 262



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 30/79 (37%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL     + EL+++F  YG+I    +  D +TGRSRGF F+ F+  +S+D++ + 
Sbjct: 181 KIFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSD 240

Query: 190 GE-HTINNKKVDPKKAKAR 243
           G+ H + +K+V+ K+A+ +
Sbjct: 241 GKVHELGDKQVEIKRAEPK 259



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 25/78 (32%), Positives = 43/78 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+S E + +   N+F +FG +++  +  D+     +GF F+TF    V   +L+   
Sbjct: 92  FVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLE-ED 150

Query: 435 RTIGGKEVDVKRATPKPD 488
             I  ++VD+KR  P+ D
Sbjct: 151 HVIDDRKVDLKRTLPRGD 168


>UniRef50_Q0DXG2 Cluster: Os02g0755400 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os02g0755400 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 176

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 32/71 (45%), Positives = 44/71 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+WET  K L+DHF  YGEI    V TD  T RS+G+ F+ F+ PES  + +  
Sbjct: 47  KVFVGGLAWETPSKGLQDHFQQYGEILEAVVITDRETSRSKGYGFVTFREPESAREAVRN 106

Query: 190 GEHTINNKKVD 222
              TI  ++ +
Sbjct: 107 PNPTIGGRRAN 117



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 28/92 (30%), Positives = 50/92 (54%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           R + G +T  + FVGGL+ E     +++ F ++G ILE  +  D+  ++ KG+ F+TF  
Sbjct: 37  RTRFGDTTLTKVFVGGLAWETPSKGLQDHFQQYGEILEAVVITDRETSRSKGYGFVTFRE 96

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
            +   + ++ P  TIGG+  +   A+  P  P
Sbjct: 97  PESAREAVRNPNPTIGGRRANCNIASMGPPRP 128


>UniRef50_A2YHR7 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 377

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 35/81 (43%), Positives = 46/81 (56%), Gaps = 3/81 (3%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGG+     + ELR HFG YG + S+ V  D  TG  RGF F+ F+  E   + +  
Sbjct: 21  KLFVGGIPTSAQEAELRGHFGQYGAVRSVIVMRDKETGHGRGFGFVEFEEEEDAARALGD 80

Query: 190 GE---HTINNKKVDPKKAKAR 243
           GE   H I  + VD K+A+AR
Sbjct: 81  GEHPRHLICGRVVDVKRARAR 101



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 27/76 (35%), Positives = 47/76 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL   I+++E + +F  FGT+ +V + +D   N+ +GF F+TF+SE+ V  +++   
Sbjct: 147 FIGGLRDNITEEEFKTYFESFGTVTDVVVIYDSMTNRSRGFGFVTFDSEEAVRKVIEHSF 206

Query: 435 RTIGGKEVDVKRATPK 482
             + G  V+ K A PK
Sbjct: 207 HDLKGTRVEAKIAIPK 222



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 26/76 (34%), Positives = 45/76 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+F+GGL    T++E + +F ++G +  + V  D  T RSRGF F+ F + E++ KV+ 
Sbjct: 144 KKVFIGGLRDNITEEEFKTYFESFGTVTDVVVIYDSMTNRSRGFGFVTFDSEEAVRKVIE 203

Query: 187 AGEHTINNKKVDPKKA 234
              H +   +V+ K A
Sbjct: 204 HSFHDLKGTRVEAKIA 219



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 3/80 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL---K 425
           FVGG+ +   + E+R  F ++G +  V +  DK     +GF F+ FE E+     L   +
Sbjct: 23  FVGGIPTSAQEAELRGHFGQYGAVRSVIVMRDKETGHGRGFGFVEFEEEEDAARALGDGE 82

Query: 426 TPKRTIGGKEVDVKRATPKP 485
            P+  I G+ VDVKRA  +P
Sbjct: 83  HPRHLICGRVVDVKRARARP 102


>UniRef50_A2X9R7 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 355

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 32/71 (45%), Positives = 44/71 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+WET  K L+DHF  YGEI    V TD  T RS+G+ F+ F+ PES  + +  
Sbjct: 47  KVFVGGLAWETPSKGLQDHFQQYGEILEAVVITDRETSRSKGYGFVTFREPESAREAVRN 106

Query: 190 GEHTINNKKVD 222
              TI  ++ +
Sbjct: 107 PNPTIGGRRAN 117



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 28/92 (30%), Positives = 50/92 (54%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           R + G +T  + FVGGL+ E     +++ F ++G ILE  +  D+  ++ KG+ F+TF  
Sbjct: 37  RTRFGDTTLTKVFVGGLAWETPSKGLQDHFQQYGEILEAVVITDRETSRSKGYGFVTFRE 96

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
            +   + ++ P  TIGG+  +   A+  P  P
Sbjct: 97  PESAREAVRNPNPTIGGRRANCNIASMGPPRP 128


>UniRef50_UPI0000D5737C Cluster: PREDICTED: similar to RNA binding
           motif protein 24; n=3; Endopterygota|Rep: PREDICTED:
           similar to RNA binding motif protein 24 - Tribolium
           castaneum
          Length = 318

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL + TTD+ LR+HF  YGEIE   V TD  TG+SRG+ F++     S D+    
Sbjct: 90  KLFVGGLPYHTTDQSLREHFSVYGEIEEAVVITDRQTGKSRGYGFVIMGDKSSSDRACKD 149

Query: 190 GEHTINNKKVD 222
               I+ +K +
Sbjct: 150 ANPIIDGRKAN 160


>UniRef50_UPI0000E4934F Cluster: PREDICTED: similar to musashi
           nrp-1; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to musashi nrp-1 - Strongylocentrotus
           purpuratus
          Length = 229

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 32/91 (35%), Positives = 58/91 (63%)
 Frame = +3

Query: 210 QESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           + S PK   S T + FVGG+++  ++  ++ FF ++G + EV + FD+T N+ +GF F+ 
Sbjct: 105 KRSHPKPV-SKTKKIFVGGIAASTTEPHLKKFFEKYGKVEEVTLMFDRTTNRHRGFGFVI 163

Query: 390 FESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           F++E+ V+ + +     + GK V+VK+A PK
Sbjct: 164 FDNEKTVDSVCEEHFHELDGKLVEVKKAQPK 194



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/97 (30%), Positives = 56/97 (57%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG++  TT+  L+  F  YG++E + +  D  T R RGF F++F   +++D V  
Sbjct: 116 KKIFVGGIAASTTEPHLKKFFEKYGKVEEVTLMFDRTTNRHRGFGFVIFDNEKTVDSVCE 175

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKS 297
              H ++ K V+ KKA+ +   +    +  ++ MM++
Sbjct: 176 EHFHELDGKLVEVKKAQPKEVMMPQNAAKNRAAMMRN 212



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 31/91 (34%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +1

Query: 55  LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 234
           LR +F  +GE++   +  D  T RSRGF F+ F  P  ++ V+  G H ++ KKVDPK A
Sbjct: 43  LRKYFCQFGEVKECVIMRDTTTRRSRGFGFVTFSDPAHVETVIQRGTHEVDKKKVDPKVA 102

Query: 235 --KARHGKILSEDSAVKSQMMKSETSSVNLE 321
             K  H K +S+   +    + + T+  +L+
Sbjct: 103 FPKRSHPKPVSKTKKIFVGGIAASTTEPHLK 133



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 21/67 (31%), Positives = 34/67 (50%)
 Frame = +3

Query: 294 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 473
           +R +F +FG + E  +  D T  + +GF F+TF     V  +++     +  K+VD K A
Sbjct: 43  LRKYFCQFGEVKECVIMRDTTTRRSRGFGFVTFSDPAHVETVIQRGTHEVDKKKVDPKVA 102

Query: 474 TPKPDGP 494
            PK   P
Sbjct: 103 FPKRSHP 109


>UniRef50_Q9LHL2 Cluster: Similarity to RNA binding protein; n=13;
           Magnoliophyta|Rep: Similarity to RNA binding protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 358

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 33/74 (44%), Positives = 45/74 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL  +TT+     HFG YGEI    +  D +TG+ RGF FI F  P  +DKV+  
Sbjct: 20  KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-E 78

Query: 190 GEHTINNKKVDPKK 231
             H IN K+V+ K+
Sbjct: 79  DTHVINGKQVEIKR 92



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 29/77 (37%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           FVGG+ S +++DE+++FF+++G ++E ++  D   N+ +GF F+ F+SE+VV++LL K  
Sbjct: 112 FVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGN 171

Query: 432 KRTIGGKEVDVKRATPK 482
              +   +V++K+A PK
Sbjct: 172 MIDMADTQVEIKKAEPK 188



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 31/85 (36%), Positives = 49/85 (57%), Gaps = 6/85 (7%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+    T+ EL+D F  YG +    V  D  T RSRGF F++F + E +D++++
Sbjct: 109 KKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLS 168

Query: 187 AG------EHTINNKKVDPKKAKAR 243
            G      +  +  KK +PKK+  R
Sbjct: 169 KGNMIDMADTQVEIKKAEPKKSLNR 193



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 26/79 (32%), Positives = 43/79 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL  + ++      F ++G I +  +  D+   Q +GF FITF    VV+ +++   
Sbjct: 22  FIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIE-DT 80

Query: 435 RTIGGKEVDVKRATPKPDG 491
             I GK+V++KR  PK  G
Sbjct: 81  HVINGKQVEIKRTIPKGAG 99


>UniRef50_Q9FM47 Cluster: Similarity to RNA binding protein; n=5;
           Magnoliophyta|Rep: Similarity to RNA binding protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 423

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 40/102 (39%), Positives = 54/102 (52%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+ ETT  E   HFG YGEI    +  D  TG+ RGF F+ +     +DKV+  
Sbjct: 43  KIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVI-Q 101

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVN 315
             H I  K+V+ K+   R G + S D   K   +    SSV+
Sbjct: 102 DNHIIIGKQVEIKRTIPR-GSMSSNDFKTKKIFVGGIPSSVD 142



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 31/77 (40%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+ S + DDE + FF +FG + E ++  D +  + +GF F+T+ESE +V+ LL    
Sbjct: 133 FVGGIPSSVDDDEFKEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGN 192

Query: 435 R-TIGGKEVDVKRATPK 482
           R  + G +V++K+A PK
Sbjct: 193 RIELSGTQVEIKKAEPK 209



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 26/80 (32%), Positives = 50/80 (62%), Gaps = 1/80 (1%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+     D E ++ F  +GE++   +  D +TGRSRGF F+ +++ + +D ++A
Sbjct: 130 KKIFVGGIPSSVDDDEFKEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLA 189

Query: 187 AGEH-TINNKKVDPKKAKAR 243
            G    ++  +V+ KKA+ +
Sbjct: 190 KGNRIELSGTQVEIKKAEPK 209



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/76 (32%), Positives = 43/76 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E +  E    F ++G I +  +  D+   Q +GF F+T+    VV+ +++   
Sbjct: 45  FVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQ-DN 103

Query: 435 RTIGGKEVDVKRATPK 482
             I GK+V++KR  P+
Sbjct: 104 HIIIGKQVEIKRTIPR 119


>UniRef50_Q8W4A6 Cluster: Putative uncharacterized protein MJH23.3;
           n=2; Arabidopsis thaliana|Rep: Putative uncharacterized
           protein MJH23.3 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 231

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 33/74 (44%), Positives = 45/74 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL  +TT+     HFG YGEI    +  D +TG+ RGF FI F  P  +DKV+  
Sbjct: 20  KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-E 78

Query: 190 GEHTINNKKVDPKK 231
             H IN K+V+ K+
Sbjct: 79  DTHVINGKQVEIKR 92



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 23/56 (41%), Positives = 44/56 (78%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
           FVGG+ S +++DE+++FF+++G ++E ++  D   N+ +GF F+ F+SE+VV++LL
Sbjct: 112 FVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 25/62 (40%), Positives = 39/62 (62%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGG+    T+ EL+D F  YG +    V  D  T RSRGF F++F + E +D++++
Sbjct: 109 KKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLS 168

Query: 187 AG 192
            G
Sbjct: 169 KG 170



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 26/79 (32%), Positives = 43/79 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL  + ++      F ++G I +  +  D+   Q +GF FITF    VV+ +++   
Sbjct: 22  FIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIE-DT 80

Query: 435 RTIGGKEVDVKRATPKPDG 491
             I GK+V++KR  PK  G
Sbjct: 81  HVINGKQVEIKRTIPKGAG 99


>UniRef50_A4V6K1 Cluster: DAZ-associated protein; n=2;
           Platyhelminthes|Rep: DAZ-associated protein - Dugesia
           japonica (Planarian)
          Length = 296

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 30/73 (41%), Positives = 48/73 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL   TT++ L+ +F  +G++   +V  D  TGRSRGF ++ +   E++ KVM+ 
Sbjct: 16  KLFVGGLHQSTTNESLKSYFSKFGDVVEASVMMDHRTGRSRGFGYVRYSDNEAVQKVMST 75

Query: 190 GEHTINNKKVDPK 228
            +H +  K++DPK
Sbjct: 76  -KHHLEGKEIDPK 87



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 28/76 (36%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG++ E +++ +R+FF +FG I E+ +  D++ ++ +GF F+ F+ E VV  L+    
Sbjct: 104 FVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHI 163

Query: 435 RTIGGKEVDVKRATPK 482
            TIG K+V++K   P+
Sbjct: 164 LTIGNKQVEIKPMEPQ 179



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVGG++ E  ++ LRD F  +G I  + +  D +  R RGFAF+ F     + ++
Sbjct: 99  RQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQL 158

Query: 181 MAAGEHTINNKKVDPK 228
           +     TI NK+V+ K
Sbjct: 159 INDHILTIGNKQVEIK 174



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 21/71 (29%), Positives = 42/71 (59%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    +++ ++++FS+FG ++E  +  D    + +GF ++ +   + V  ++ T K
Sbjct: 18  FVGGLHQSTTNESLKSYFSKFGDVVEASVMMDHRTGRSRGFGYVRYSDNEAVQKVMST-K 76

Query: 435 RTIGGKEVDVK 467
             + GKE+D K
Sbjct: 77  HHLEGKEIDPK 87


>UniRef50_A4R1M8 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 530

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 33/88 (37%), Positives = 54/88 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+S ETTD+E +D F  +G +    +  D +TGR RGF F+ F++   ++  +A 
Sbjct: 166 KIFVGGVSQETTDQEFKDFFAQFGRVVDATLMMDKDTGRPRGFGFVTFESEAGVEACLAR 225

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSA 273
            +  I+ K ++ KKA+ R G +  E+ A
Sbjct: 226 -DLEIHGKLIEVKKAQPR-GNLREEEEA 251



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 33/87 (37%), Positives = 53/87 (60%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P++    T + FVGG+S E +D E ++FF++FG +++  +  DK   + +GF F+TFESE
Sbjct: 157 PRDEQEKTSKIFVGGVSQETTDQEFKDFFAQFGRVVDATLMMDKDTGRPRGFGFVTFESE 216

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPK 482
             V   L      I GK ++VK+A P+
Sbjct: 217 AGVEACLARDLE-IHGKLIEVKKAQPR 242



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 30/69 (43%), Positives = 44/69 (63%)
 Frame = +1

Query: 37  ETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 216
           +  D+ LRD+F  +GE+    V  D  TGRSRGF F+ FK P++++ VM   EH ++ K 
Sbjct: 91  QADDESLRDYFSQFGEVIECTVMRDGTTGRSRGFGFLTFKDPKTVNIVMVK-EHYLDGKI 149

Query: 217 VDPKKAKAR 243
           +DPK+A  R
Sbjct: 150 IDPKRAIPR 158



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 23/72 (31%), Positives = 45/72 (62%)
 Frame = +3

Query: 273 SEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGK 452
           ++  D+ +R++FS+FG ++E  +  D T  + +GF F+TF+  + VN ++   +  + GK
Sbjct: 90  NQADDESLRDYFSQFGEVIECTVMRDGTTGRSRGFGFLTFKDPKTVN-IVMVKEHYLDGK 148

Query: 453 EVDVKRATPKPD 488
            +D KRA P+ +
Sbjct: 149 IIDPKRAIPRDE 160


>UniRef50_Q9SM01 Cluster: RNA binding protein; n=2; Arabidopsis
           thaliana|Rep: RNA binding protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 381

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 32/92 (34%), Positives = 56/92 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGLS  TT++E + +F  +G    + V  D  T R RGF F+ + + +S++ V
Sbjct: 118 RTKKIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVV 177

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAV 276
           M +  H +++K+V+ K+A  + G   +  +AV
Sbjct: 178 MQSNFHELSDKRVEVKRAIPKEGIQSNNGNAV 209



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 31/82 (37%), Positives = 51/82 (62%)
 Frame = +3

Query: 237 STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND 416
           S T + FVGGLSS  +++E +++F  FG   +V +  D   N+ +GF F+T++SE  V  
Sbjct: 117 SRTKKIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEV 176

Query: 417 LLKTPKRTIGGKEVDVKRATPK 482
           ++++    +  K V+VKRA PK
Sbjct: 177 VMQSNFHELSDKRVEVKRAIPK 198



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 29/79 (36%), Positives = 44/79 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGG++ ET+++ L+ +F  YG +    V  +  TG+ RGF F+ F     + K +  
Sbjct: 7   KLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKAL-R 65

Query: 190 GEHTINNKKVDPKKAKARH 246
             H I  K VD +KA  +H
Sbjct: 66  DTHFILGKPVDVRKAIRKH 84



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 28/77 (36%), Positives = 46/77 (59%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE-QVVNDLLKTP 431
           FVGG++ E S++ ++ +FS +G +LE  +  +K   + +GF F+ F ++  VV  L  T 
Sbjct: 9   FVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKALRDT- 67

Query: 432 KRTIGGKEVDVKRATPK 482
              I GK VDV++A  K
Sbjct: 68  -HFILGKPVDVRKAIRK 83


>UniRef50_UPI000156016B Cluster: PREDICTED: hypothetical protein;
           n=1; Equus caballus|Rep: PREDICTED: hypothetical protein
           - Equus caballus
          Length = 223

 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 31/75 (41%), Positives = 46/75 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K FVG LSW+ + K+ +D+F    E+    +K DPN GRSRG  FI+FK   S++KV+  
Sbjct: 60  KWFVGSLSWDISKKDPKDYFTKLREVVDRTIKMDPNIGRSRGLGFILFKDVASVEKVLDQ 119

Query: 190 GEHTINNKKVDPKKA 234
            E  +   +++ KKA
Sbjct: 120 KERKVGGHRMNHKKA 134



 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 30/80 (37%), Positives = 49/80 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL+ E T++++R++FG +GEIE+I    DP + + +G  FI FK  E +  ++ 
Sbjct: 143 KKIFVGGLNPEATEEKIREYFGKFGEIEAIEFSLDPESNKRQGSVFIAFKEEEPVRSILE 202

Query: 187 AGEHTINNKKVDPKKAKARH 246
              HTI+  K     A+  H
Sbjct: 203 K-FHTISGSKCQMDMAEIIH 221



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 27/73 (36%), Positives = 43/73 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E ++++IR +F +FG I  +E   D   N+R+G  FI F+ E+ V  +L+   
Sbjct: 146 FVGGLNPEATEEKIREYFGKFGEIEAIEFSLDPESNKRQGSVFIAFKEEEPVRSILE-KF 204

Query: 435 RTIGGKEVDVKRA 473
            TI G +  +  A
Sbjct: 205 HTISGSKCQMDMA 217


>UniRef50_A7PL41 Cluster: Chromosome chr7 scaffold_20, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr7 scaffold_20, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 458

 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 31/77 (40%), Positives = 45/77 (58%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H K+FV GL W+TT + L   F  YG+IE  NV TD NTG+++G+ F++FK  +   K +
Sbjct: 91  HRKIFVHGLGWDTTRETLLAAFEPYGQIEDCNVVTDRNTGKAKGYGFVLFKTRQGAVKAL 150

Query: 184 AAGEHTINNKKVDPKKA 234
                 INN+    + A
Sbjct: 151 KQPGKKINNRMTQSQLA 167



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 25/82 (30%), Positives = 40/82 (48%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K++V  +  +   + LR  F  +GEIE+  +  D  TG+SRGFA  V+K  ES  K +  
Sbjct: 184 KIYVSNVQADVDPERLRSFFAKFGEIETGPIGFDTQTGKSRGFALFVYKNQESARKALED 243

Query: 190 GEHTINNKKVDPKKAKARHGKI 255
                   ++  +KA     K+
Sbjct: 244 PYRIFEGHQLHCQKATEGKNKV 265



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 17/74 (22%), Positives = 40/74 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  + +++  + +R+FF++FG I    + FD    + +GF    +++++     L+ P 
Sbjct: 186 YVSNVQADVDPERLRSFFAKFGEIETGPIGFDTQTGKSRGFALFVYKNQESARKALEDPY 245

Query: 435 RTIGGKEVDVKRAT 476
           R   G ++  ++AT
Sbjct: 246 RIFEGHQLHCQKAT 259


>UniRef50_A5BLC5 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 443

 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 31/77 (40%), Positives = 45/77 (58%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H K+FV GL W+TT + L   F  YG+IE  NV TD NTG+++G+ F++FK  +   K +
Sbjct: 91  HRKIFVHGLGWDTTRETLLAAFEPYGQIEDCNVVTDRNTGKAKGYGFVLFKTRQGAVKAL 150

Query: 184 AAGEHTINNKKVDPKKA 234
                 INN+    + A
Sbjct: 151 KQPGKKINNRMTQSQLA 167



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRG 135
           K++V  +  +   + LR  F  +GEIE+  +  D  TG+SRG
Sbjct: 184 KIYVSNVQADVDPERLRSFFAKFGEIETGPIGFDTQTGKSRG 225


>UniRef50_Q9SYP9 Cluster: F9H16.14 protein; n=6; core
           eudicotyledons|Rep: F9H16.14 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 288

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 29/53 (54%), Positives = 38/53 (71%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           K+FVGGL+WET  + LR HF  YG+I    V TD NTGRS+G+ F+ F+ PE+
Sbjct: 25  KVFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEA 77



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 25/82 (30%), Positives = 40/82 (48%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G +T  + FVGGL+ E   + +R  F ++G ILE  +  DK   + KG+ F+TF   +  
Sbjct: 19  GDTTFTKVFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAA 78

Query: 411 NDLLKTPKRTIGGKEVDVKRAT 476
                 P   I G+  +   A+
Sbjct: 79  RRACVDPTPIIDGRRANCNLAS 100


>UniRef50_Q8WSM6 Cluster: Putative uncharacterized protein; n=4;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 336

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 33/78 (42%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS +TTD++L ++F  +G +    V  DPNT  SRGF F+ F +  S +  M  
Sbjct: 71  KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMND 130

Query: 190 GEHTINNKKVDPKKAKAR 243
             H +  K VD K+A  R
Sbjct: 131 RPHKLGGKTVDSKRAIPR 148



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 26/76 (34%), Positives = 44/76 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + +D+++ N+FS++G +++  +  D      +GF F+TF S       +    
Sbjct: 73  FIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRP 132

Query: 435 RTIGGKEVDVKRATPK 482
             +GGK VD KRA P+
Sbjct: 133 HKLGGKTVDSKRAIPR 148


>UniRef50_Q1LVU9 Cluster: Cold inducible RNA binding protein; n=8;
           Clupeocephala|Rep: Cold inducible RNA binding protein -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 223

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 33/71 (46%), Positives = 45/71 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGLS++TT++ L + F  YG I  ++V  D  T RSRGF F+ F+ PE     MAA
Sbjct: 23  KLFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAA 82

Query: 190 GEHTINNKKVD 222
               +N K+VD
Sbjct: 83  ----MNGKQVD 89



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 23/69 (33%), Positives = 43/69 (62%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS + ++  +   FS++GTI +V++  D+  ++ +GF F+TFE+ +   D +    
Sbjct: 25  FIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAM---- 80

Query: 435 RTIGGKEVD 461
             + GK+VD
Sbjct: 81  AAMNGKQVD 89


>UniRef50_Q9VFT3 Cluster: CG9654-PA; n=4; Drosophila
           melanogaster|Rep: CG9654-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 428

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 33/78 (42%), Positives = 47/78 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGLS +TT + LR  F  +G +    V  DP +  SRGF F+ +  P+S++ V  A
Sbjct: 33  KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRA 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             HTI+NK V+ K A  R
Sbjct: 93  RPHTIDNKIVETKHALPR 110



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/78 (33%), Positives = 44/78 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGLS++ + + +R FFS+FG + +  +  D   N  +GF F+T+   + V  + +   
Sbjct: 35  FIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
            TI  K V+ K A P+ D
Sbjct: 95  HTIDNKIVETKHALPRQD 112



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 24/76 (31%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +++F+GGL     +  +R++F  +G + S+ +  D  TGR R F F+ F  P S +K +A
Sbjct: 136 KRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    V+ K++
Sbjct: 196 PRKHWILQTLVEVKRS 211



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/78 (30%), Positives = 40/78 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL     ++ +R +FS+FG +  V++  D+   +++ F F+ F         L   K
Sbjct: 139 FLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRK 198

Query: 435 RTIGGKEVDVKRATPKPD 488
             I    V+VKR+T K D
Sbjct: 199 HWILQTLVEVKRSTQKAD 216


>UniRef50_A4RXB1 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 218

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 31/80 (38%), Positives = 47/80 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   + +  +RNFFS+FG ++EV +  D   +Q +GF FITF+ +     +L+   
Sbjct: 16  FVGGLDRTVDEGVVRNFFSQFGPVMEVLVMRDPHNHQSRGFGFITFQRDDSAKQVLQNRY 75

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             + GK V+VK A P+   P
Sbjct: 76  HDMLGKRVEVKSAVPRGQAP 95



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 27/78 (34%), Positives = 43/78 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL     +  +R+ F  +G +  + V  DP+  +SRGF FI F+  +S  +V+  
Sbjct: 14  KIFVGGLDRTVDEGVVRNFFSQFGPVMEVLVMRDPHNHQSRGFGFITFQRDDSAKQVLQN 73

Query: 190 GEHTINNKKVDPKKAKAR 243
             H +  K+V+ K A  R
Sbjct: 74  RYHDMLGKRVEVKSAVPR 91


>UniRef50_A3BDN9 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 285

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 30/55 (54%), Positives = 39/55 (70%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           + K+FVGGL+WET  + LR HF AYGEI    V TD  TGRS+G+ F+ F+ P+S
Sbjct: 32  YTKVFVGGLAWETRSEGLRAHFEAYGEILEAVVITDRATGRSKGYGFVTFRDPDS 86



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 3/93 (3%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G +T  + FVGGL+ E   + +R  F  +G ILE  +  D+   + KG+ F+TF      
Sbjct: 28  GDTTYTKVFVGGLAWETRSEGLRAHFEAYGEILEAVVITDRATGRSKGYGFVTFRDPDSA 87

Query: 411 NDLLKTPKRTIGGKEVDVKRA---TPKPDGPGA 500
                 P   I G+  +   A    P PD P A
Sbjct: 88  RMACMDPYPVIDGRRANCNLAILGRPGPDIPFA 120


>UniRef50_Q2UQ21 Cluster: Predicted protein; n=3;
           Pezizomycotina|Rep: Predicted protein - Aspergillus
           oryzae
          Length = 127

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+W TTD+ LR  F  YG +E   V  D +TGRSRGF F+ F +    +    A
Sbjct: 3   KLFIGGLAWHTTDESLRSGFEKYGAVEEAIVVKDRDTGRSRGFGFVRFSSEADAE----A 58

Query: 190 GEHTINNKKVD 222
             H +NN++ D
Sbjct: 59  AAHEMNNQEFD 69



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 16/49 (32%), Positives = 30/49 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           F+GGL+   +D+ +R+ F ++G + E  +  D+   + +GF F+ F SE
Sbjct: 5   FIGGLAWHTTDESLRSGFEKYGAVEEAIVVKDRDTGRSRGFGFVRFSSE 53


>UniRef50_Q13151 Cluster: Heterogeneous nuclear ribonucleoprotein
           A0; n=22; Mammalia|Rep: Heterogeneous nuclear
           ribonucleoprotein A0 - Homo sapiens (Human)
          Length = 305

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ +T++  LR HF A+G +    V  +P T RSR F F+ +   E  D  MAA
Sbjct: 8   KLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAA 67

Query: 190 GEHTINNKKVDPKKAKAR 243
             H ++   V+ K+A +R
Sbjct: 68  SPHAVDGNTVELKRAVSR 85



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL  +  + +L +HF  +G +E   +  D  +G+ RGF F+ F+  ++ DK   
Sbjct: 98  KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAV 157

Query: 187 AGEHTINNKKVDPKKA 234
              H I   +V+ KKA
Sbjct: 158 VKFHPIQGHRVEVKKA 173



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL  ++++ ++   FS+FGT+ + E+  DK   +++GF F+ F++    +       
Sbjct: 101 FVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKF 160

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G  V+VK+A PK D
Sbjct: 161 HPIQGHRVEVKKAVPKED 178



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ + S+  +R  F  FGT+ +  +  +    + + F F+T+ + +  +  +    
Sbjct: 10  FIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASP 69

Query: 435 RTIGGKEVDVKRATPKPDG--PGA 500
             + G  V++KRA  + D   PGA
Sbjct: 70  HAVDGNTVELKRAVSREDSARPGA 93


>UniRef50_A7PG81 Cluster: Chromosome chr6 scaffold_15, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_15, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 410

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 29/70 (41%), Positives = 41/70 (58%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H K+FV GL W+ T++ L   F  YG+IE  NV TD  TGRS+G+ F++FK      K +
Sbjct: 78  HRKIFVHGLGWDATNETLTSAFKQYGQIEECNVVTDKITGRSKGYGFVLFKTRSGARKAL 137

Query: 184 AAGEHTINNK 213
              +  I N+
Sbjct: 138 KQPQKKIGNR 147



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 22/76 (28%), Positives = 42/76 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +  +IS +++R FF++FG I +  + FDK   + +GF  I F++ + +   L+ P 
Sbjct: 175 YVGNVGPQISAEKLRTFFAKFGEIEDGPLGFDKATGKFRGFAIIVFKTAEGMKRALEEPI 234

Query: 435 RTIGGKEVDVKRATPK 482
           +T    ++   R   K
Sbjct: 235 KTFESCKLQCSRKVAK 250



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/78 (32%), Positives = 42/78 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L+VG +  + + ++LR  F  +GEIE   +  D  TG+ RGFA IVFK  E + + +  
Sbjct: 173 RLYVGNVGPQISAEKLRTFFAKFGEIEDGPLGFDKATGKFRGFAIIVFKTAEGMKRALEE 232

Query: 190 GEHTINNKKVDPKKAKAR 243
              T  + K+   +  A+
Sbjct: 233 PIKTFESCKLQCSRKVAK 250



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/79 (27%), Positives = 39/79 (49%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV GL  + +++ + + F ++G I E  +  DK   + KG+ F+ F++       LK P+
Sbjct: 82  FVHGLGWDATNETLTSAFKQYGQIEECNVVTDKITGRSKGYGFVLFKTRSGARKALKQPQ 141

Query: 435 RTIGGKEVDVKRATPKPDG 491
           + IG +      A   P G
Sbjct: 142 KKIGNRMAACHLAAAGPSG 160


>UniRef50_Q9M9E6 Cluster: F3F9.20; n=8; Arabidopsis thaliana|Rep:
           F3F9.20 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 302

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 28/73 (38%), Positives = 46/73 (63%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + K+FVGGL+WET   E+R +F  +GEI    + TD NTG+S+G+ F+ F+  +S  + +
Sbjct: 16  YTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAV 75

Query: 184 AAGEHTINNKKVD 222
           A     I+ +K +
Sbjct: 76  ADPNPVIDGRKAN 88



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/91 (34%), Positives = 47/91 (51%), Gaps = 3/91 (3%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G +T  + FVGGL+ E   DE+R +F +FG ILE  +  DK   + KG+ F+TF      
Sbjct: 12  GDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSA 71

Query: 411 NDLLKTPKRTIGGKEVDVKRAT---PKPDGP 494
              +  P   I G++ +   A+   P+P  P
Sbjct: 72  TRAVADPNPVIDGRKANCNIASFGRPRPSPP 102


>UniRef50_Q4UI71 Cluster: RNA-binding (SR) protein, putative; n=2;
           Theileria|Rep: RNA-binding (SR) protein, putative -
           Theileria annulata
          Length = 303

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F GGL+  TT ++L+++F  YGE+    +  D NTGRSRGF F+ F   +S++ V+  
Sbjct: 29  KIFAGGLTRSTTPEDLKEYFSKYGEVTHTEIVRDKNTGRSRGFGFVTFADRDSVNTVLRK 88

Query: 190 GEHTINNKKVDPKKA-KARHGKILS 261
             H I+  + D K A +    KIL+
Sbjct: 89  -VHKIDGVEADVKLAVRKEKSKILA 112



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 26/76 (34%), Positives = 43/76 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F GGL+   + ++++ +FS++G +   E+  DK   + +GF F+TF     VN +L+   
Sbjct: 31  FAGGLTRSTTPEDLKEYFSKYGEVTHTEIVRDKNTGRSRGFGFVTFADRDSVNTVLRKVH 90

Query: 435 RTIGGKEVDVKRATPK 482
           + I G E DVK A  K
Sbjct: 91  K-IDGVEADVKLAVRK 105



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/80 (32%), Positives = 45/80 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +++FVGG+S + T+   RD+F  YG I S N   D  T R RG+ F++++  E  +K  +
Sbjct: 119 KRIFVGGVSEKITESYFRDYFARYGPITSYNYLVDRATNRPRGYGFVIYENMEDAEK--S 176

Query: 187 AGEHTINNKKVDPKKAKARH 246
            G H    +  + K A+ ++
Sbjct: 177 IGMHLSLGRNCEAKFAEPKY 196


>UniRef50_Q8LPB0 Cluster: Glycine-rich RNA-binding protein; n=1;
           Physcomitrella patens|Rep: Glycine-rich RNA-binding
           protein - Physcomitrella patens (Moss)
          Length = 155

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 26/60 (43%), Positives = 39/60 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL+W TTD  +++ F A+GE+  + +  D +TGRSRGF F+ F   +  +  + A
Sbjct: 43  KLFVGGLAWGTTDDNIKEAFSAFGEVTEVKIICDRDTGRSRGFGFVTFATDQDAEAALQA 102



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-P 431
           FVGGL+   +DD I+  FS FG + EV++  D+   + +GF F+TF ++Q     L+   
Sbjct: 45  FVGGLAWGTTDDNIKEAFSAFGEVTEVKIICDRDTGRSRGFGFVTFATDQDAEAALQALD 104

Query: 432 KRTIGGKEVDVKRAT 476
            R + G+ + V  AT
Sbjct: 105 GRDLAGRTIRVNYAT 119


>UniRef50_Q7XI13 Cluster: Glycine-rich RNA-binding protein-like;
           n=9; Magnoliophyta|Rep: Glycine-rich RNA-binding
           protein-like - Oryza sativa subsp. japonica (Rice)
          Length = 308

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 30/80 (37%), Positives = 48/80 (60%), Gaps = 2/80 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGGLSW+TT++ L   F  YG++    V  + +TGRSRGF F+ F  P ++D  +  
Sbjct: 8   RIFVGGLSWDTTERTLERAFSEYGKVIETQVVLERDTGRSRGFGFVTFSEPRAVDAAI-R 66

Query: 190 GEHT--INNKKVDPKKAKAR 243
           G H   ++ + +   KA+ R
Sbjct: 67  GMHNGELDGRTISVNKAQPR 86



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 21/77 (27%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TP 431
           FVGGLS + ++  +   FSE+G ++E ++  ++   + +GF F+TF   + V+  ++   
Sbjct: 10  FVGGLSWDTTERTLERAFSEYGKVIETQVVLERDTGRSRGFGFVTFSEPRAVDAAIRGMH 69

Query: 432 KRTIGGKEVDVKRATPK 482
              + G+ + V +A P+
Sbjct: 70  NGELDGRTISVNKAQPR 86


>UniRef50_A1CJX8 Cluster: Glycine-rich RNA-binding protein,
           putative; n=2; Aspergillus|Rep: Glycine-rich RNA-binding
           protein, putative - Aspergillus clavatus
          Length = 133

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+W TTD  LR  F  +G++E   V  D +T RSRGF F+ F +    DK M A
Sbjct: 3   KLFIGGLAWHTTDDALRQGFEQFGQVEEAIVVKDRDTNRSRGFGFVRFSSDSDADKAMDA 62

Query: 190 GEHTINNKKVD 222
               +NN++ D
Sbjct: 63  ----MNNQEFD 69



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-P 431
           F+GGL+   +DD +R  F +FG + E  +  D+  N+ +GF F+ F S+   +  +    
Sbjct: 5   FIGGLAWHTTDDALRQGFEQFGQVEEAIVVKDRDTNRSRGFGFVRFSSDSDADKAMDAMN 64

Query: 432 KRTIGGKEVDVKRATPK 482
            +   G+ + V +A+ +
Sbjct: 65  NQEFDGRTIRVDKASER 81


>UniRef50_A7PG82 Cluster: Chromosome chr6 scaffold_15, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_15, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 516

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 31/79 (39%), Positives = 44/79 (55%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H K+FV GL W+TT + L   FG YGEIE     +D  +G+S+G+AFI+FK      K +
Sbjct: 194 HRKIFVHGLGWDTTAETLTSVFGKYGEIEDCKAVSDKISGKSKGYAFILFKHRSGARKAL 253

Query: 184 AAGEHTINNKKVDPKKAKA 240
              +  I N+    + A A
Sbjct: 254 KQPQKKIGNRMTSCQLASA 272



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  +SSEI   ++  FF++FG I E  +  DK+  + KGF    ++S +     L+ P 
Sbjct: 294 FVSNVSSEIDPQKLLEFFAKFGEIEEGPLGLDKSTGKPKGFALFVYKSIESSRRALEEPH 353

Query: 435 RTIGGKEVDVKRAT--PKPDGP 494
           +   G  +  ++A   PKP+ P
Sbjct: 354 KIFEGHTLHCQKAIDGPKPNKP 375



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 7/86 (8%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FV  +S E   ++L + F  +GEIE   +  D +TG+ +GFA  V+K+ ES  + +  
Sbjct: 292 KIFVSNVSSEIDPQKLLEFFAKFGEIEEGPLGLDKSTGKPKGFALFVYKSIESSRRALEE 351

Query: 190 GE-----HTIN-NKKVD-PKKAKARH 246
                  HT++  K +D PK  K  H
Sbjct: 352 PHKIFEGHTLHCQKAIDGPKPNKPFH 377


>UniRef50_A5BSV4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 195

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 28/71 (39%), Positives = 43/71 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+WET    +R HF  +GEI    + TD NTG+S+G+ F+ F+ PES  +    
Sbjct: 17  KVFVGGLAWETPTDVMRRHFEQFGEILEAVIITDKNTGKSKGYGFVTFRDPESARRACVD 76

Query: 190 GEHTINNKKVD 222
               I+ ++ +
Sbjct: 77  PNPVIDGRRAN 87



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/98 (32%), Positives = 46/98 (46%), Gaps = 3/98 (3%)
 Frame = +3

Query: 210 QESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           Q  R   G +T  + FVGGL+ E   D +R  F +FG ILE  +  DK   + KG+ F+T
Sbjct: 4   QHYRSPFGDTTFTKVFVGGLAWETPTDVMRRHFEQFGEILEAVIITDKNTGKSKGYGFVT 63

Query: 390 FESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGP 494
           F   +        P   I G+  +   A+   P+P  P
Sbjct: 64  FRDPESARRACVDPNPVIDGRRANCNIASLGRPRPSPP 101


>UniRef50_A7ART3 Cluster: Ribonucleoprotein, putative; n=1; Babesia
           bovis|Rep: Ribonucleoprotein, putative - Babesia bovis
          Length = 306

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/78 (35%), Positives = 48/78 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG++   ++ E +D+FG YG + + N   D +T + RGF F+V++ P  +DK  A 
Sbjct: 124 RIFVGGIADNISEDEFKDYFGKYGSVLNYNFIVDKSTNKPRGFGFVVYEDPADVDK--AI 181

Query: 190 GEHTINNKKVDPKKAKAR 243
           G HT   +  + K+A+ R
Sbjct: 182 GHHTKLGRNCEAKRAQPR 199



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 30/75 (40%), Positives = 43/75 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F GGL+  TT + LR++F  YG +    +  D  TGRSRGF F+ F    ++  V+A 
Sbjct: 33  KIFAGGLNRSTTAETLRNYFSKYGTVVHSEIVADKTTGRSRGFGFVTFSNDAALKAVLAV 92

Query: 190 GEHTINNKKVDPKKA 234
             H I+N   D K+A
Sbjct: 93  -SHKIDNVLADVKQA 106



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 26/77 (33%), Positives = 46/77 (59%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG++  IS+DE +++F ++G++L      DK+ N+ +GF F+ +E    V+  +    
Sbjct: 126 FVGGIADNISEDEFKDYFGKYGSVLNYNFIVDKSTNKPRGFGFVVYEDPADVDKAI--GH 183

Query: 435 RTIGGKEVDVKRATPKP 485
            T  G+  + KRA P+P
Sbjct: 184 HTKLGRNCEAKRAQPRP 200



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 29/96 (30%), Positives = 50/96 (52%)
 Frame = +3

Query: 195 THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKG 374
           TH         E     ++ F GGL+   + + +RN+FS++GT++  E+  DKT  + +G
Sbjct: 15  THGDDPSKLFNESDYEAYKIFAGGLNRSTTAETLRNYFSKYGTVVHSEIVADKTTGRSRG 74

Query: 375 FCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           F F+TF ++  +  +L    + I     DVK+A  K
Sbjct: 75  FGFVTFSNDAALKAVLAVSHK-IDNVLADVKQAIKK 109


>UniRef50_UPI0000F2CBBE Cluster: PREDICTED: similar to musashi
           homolog 1 (Drosophila),; n=1; Monodelphis domestica|Rep:
           PREDICTED: similar to musashi homolog 1 (Drosophila), -
           Monodelphis domestica
          Length = 432

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 28/66 (42%), Positives = 41/66 (62%)
 Frame = +1

Query: 55  LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 234
           LR++FG +GE++   V  DP T RSRGF F+ F     +DKV+A   H +++K +DPK A
Sbjct: 121 LREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFVDQAGVDKVLAQSRHELDSKTIDPKVA 180

Query: 235 KARHGK 252
             R  +
Sbjct: 181 FPRRAQ 186



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 20/74 (27%), Positives = 38/74 (51%)
 Frame = +3

Query: 273 SEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGK 452
           S ++ + +R +F +FG + E  +  D    + +GF F+TF  +  V+ +L   +  +  K
Sbjct: 114 SPVAHEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFVDQAGVDKVLAQSRHELDSK 173

Query: 453 EVDVKRATPKPDGP 494
            +D K A P+   P
Sbjct: 174 TIDPKVAFPRRAQP 187


>UniRef50_UPI0000E4615D Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A3, partial; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           heterogeneous nuclear ribonucleoprotein A3, partial -
           Strongylocentrotus purpuratus
          Length = 697

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 27/75 (36%), Positives = 45/75 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGG+   TT+  + D FG +GE+  + +  +   G+ RGFAF+ F   E + +V+A 
Sbjct: 117 RIFVGGIPENTTEAAMIDAFGKFGEVVEVEIPPNEKNGKPRGFAFVTFATKEIVGEVVAT 176

Query: 190 GEHTINNKKVDPKKA 234
             HT   +KV+ K+A
Sbjct: 177 KYHTFLGRKVEVKRA 191



 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 26/76 (34%), Positives = 50/76 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+    ++  + + F +FG ++EVE+P ++   + +GF F+TF ++++V +++ T  
Sbjct: 119 FVGGIPENTTEAAMIDAFGKFGEVVEVEIPPNEKNGKPRGFAFVTFATKEIVGEVVATKY 178

Query: 435 RTIGGKEVDVKRATPK 482
            T  G++V+VKRA  K
Sbjct: 179 HTFLGRKVEVKRAIEK 194



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 27/102 (26%), Positives = 50/102 (49%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL  +++++ L + F  +G I  + +   PN  + +GF F+ F     ++ V+ A
Sbjct: 17  KLFLGGLRSQSSERHLYEAFLPFGHIVDVLMVRGPN-HKPKGFGFVTFSKAYMMEAVITA 75

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVN 315
             H      VD K  + +      E S  K+ ++K+   + N
Sbjct: 76  --HPDMRVIVDGKSVEIKRIS-EGEPSRSKAALLKAAIPNEN 114


>UniRef50_A3FQK0 Cluster: RNA recognition motif (RRM)-containing
           protein; n=2; Cryptosporidium|Rep: RNA recognition motif
           (RRM)-containing protein - Cryptosporidium parvum Iowa
           II
          Length = 202

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 33/86 (38%), Positives = 50/86 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLS + T   L ++F  +G I    V  D  +GRSRGF F+ FK P++++ V   
Sbjct: 9   KIFVGGLSQQVTSSILMEYFLQFGVILDAVVMYDNVSGRSRGFGFVTFKDPKTVEIVQNI 68

Query: 190 GEHTINNKKVDPKKAKARHGKILSED 267
             H I  K VD K+A  R+  ++ ++
Sbjct: 69  TPHIIMGKVVDCKRASPRNTNLMIKE 94



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/76 (35%), Positives = 44/76 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +++   +  +F +FG IL+  + +D    + +GF F+TF+  + V  +     
Sbjct: 11  FVGGLSQQVTSSILMEYFLQFGVILDAVVMYDNVSGRSRGFGFVTFKDPKTVEIVQNITP 70

Query: 435 RTIGGKEVDVKRATPK 482
             I GK VD KRA+P+
Sbjct: 71  HIIMGKVVDCKRASPR 86



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA- 186
           K+FVGGL  + T +E + +F  +G I+   + TD N GR RGF F+ F++ ++++ V   
Sbjct: 122 KIFVGGLP-DLTLEEFKIYFQRFGNIKDAVLITDKNNGRPRGFGFVTFESVDAVNNVTKF 180

Query: 187 AGEHTINNKKVDPKKAKARHG 249
              H +  K V+ K+A  R G
Sbjct: 181 YSNHYLKGKWVECKRALPRDG 201



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TP 431
           FVGGL  +++ +E + +F  FG I +  +  DK   + +GF F+TFES   VN++ K   
Sbjct: 124 FVGGLP-DLTLEEFKIYFQRFGNIKDAVLITDKNNGRPRGFGFVTFESVDAVNNVTKFYS 182

Query: 432 KRTIGGKEVDVKRATPKPDG 491
              + GK V+ KRA P+ DG
Sbjct: 183 NHYLKGKWVECKRALPR-DG 201


>UniRef50_UPI00005A129E Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP); n=1; Canis lupus familiaris|Rep:
           PREDICTED: similar to Heterogeneous nuclear
           ribonucleoprotein A1 (Helix-destabilizing protein)
           (Single-strand binding protein) (hnRNP core protein A1)
           (HDP) - Canis familiaris
          Length = 200

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 26/57 (45%), Positives = 40/57 (70%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +FVGG+  +T +  LRD+F  YG+IE I + TD  +G+ RGFAF+ F   +S+DK++
Sbjct: 99  IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIV 155



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/55 (50%), Positives = 35/55 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           KLF+GGLS+ETTD+ LR HF  +G +       DPNT RSRGF F+     E +D
Sbjct: 40  KLFMGGLSFETTDESLRSHFEQWGTLTDCVEMRDPNTKRSRGFGFVTNATVEEVD 94



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 16/56 (28%), Positives = 35/56 (62%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
           FVGG+  +  +  +R++F ++G I  +E+  D+   +++GF F+TF+    V+ ++
Sbjct: 100 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIV 155



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILE-VEMPFDKTKNQRKGFCFIT 389
           F+GGLS E +D+ +R+ F ++GT+ + VEM    TK  R GF F+T
Sbjct: 42  FMGGLSFETTDESLRSHFEQWGTLTDCVEMRDPNTKRSR-GFGFVT 86


>UniRef50_A7SIF0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 190

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 5/83 (6%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF---KAPESI--D 174
           KLFVGGL+ ETT++ LR++F AYGE+  + V  D  T +SRGF ++ F   K   ++  D
Sbjct: 15  KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKD 74

Query: 175 KVMAAGEHTINNKKVDPKKAKAR 243
           KV   G H I+ K+V+ K+A  R
Sbjct: 75  KV-ENGAHRIDGKEVEVKRAIPR 96



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 29/82 (35%), Positives = 48/82 (58%), Gaps = 4/82 (4%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK--- 425
           FVGGL+ E +++ +R +F  +G + +V +  D    + +GF ++TF   +V  ++LK   
Sbjct: 17  FVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKV 76

Query: 426 -TPKRTIGGKEVDVKRATPKPD 488
                 I GKEV+VKRA P+ D
Sbjct: 77  ENGAHRIDGKEVEVKRAIPRDD 98



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEF--GTILEVEMPFDKT-KNQRKGFCFITFESEQVVNDLLK 425
           FVGGL  + + ++I+          + +V++   K  + + +GF F+   +E   ++L  
Sbjct: 111 FVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKHRGFAFVELNNEDQADELCC 170

Query: 426 TPKRTIGGKEVDVKRATPK 482
             K  + GK V+ K+ATP+
Sbjct: 171 VKKIHVKGKMVEAKKATPR 189



 Score = 36.7 bits (81), Expect = 0.47
 Identities = 22/83 (26%), Positives = 45/83 (54%), Gaps = 4/83 (4%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGE--IESINV--KTDPNTGRSRGFAFIVFKAPESID 174
           +K+FVGGL  + T +++++   +  E  ++ +++  K +  T + RGFAF+     +  D
Sbjct: 108 KKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDET-KHRGFAFVELNNEDQAD 166

Query: 175 KVMAAGEHTINNKKVDPKKAKAR 243
           ++    +  +  K V+ KKA  R
Sbjct: 167 ELCCVKKIHVKGKMVEAKKATPR 189


>UniRef50_Q02926 Cluster: Ribonucleoprotein RB97D; n=7;
           Sophophora|Rep: Ribonucleoprotein RB97D - Drosophila
           melanogaster (Fruit fly)
          Length = 471

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVGGL     ++ LR++F  +G + S+ + TD  TG+ RGFAF+ F   +++DK + 
Sbjct: 123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAIL 182

Query: 187 AGEHTINNKKVDPKKA 234
             +H I    VD KK+
Sbjct: 183 KKQHAIKYVHVDVKKS 198



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 29/78 (37%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+  TT++ L+  +G +G++  + V  D  T RSRGF FI +     +D+    
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 190 GEHTINNKKVDPKKAKAR 243
             H I+ K V+ K+A  R
Sbjct: 93  RPHIIDGKTVEAKRALPR 110



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 23/78 (29%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++ F+ ++G +++V +  D    + +GF FIT+    +V+   +   
Sbjct: 35  FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GK V+ KRA P+P+
Sbjct: 95  HIIDGKTVEAKRALPRPE 112



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL     ++ +R +F +FG ++ V++  DKT  +R+GF F+ F+    V+  +   +
Sbjct: 126 FVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQ 185

Query: 435 RTIGGKEVDVKRA 473
             I    VDVK++
Sbjct: 186 HAIKYVHVDVKKS 198


>UniRef50_Q6ZZX5 Cluster: Heterogeneous nuclear ribonucleoprotein;
           n=2; Euteleostomi|Rep: Heterogeneous nuclear
           ribonucleoprotein - Salmo salar (Atlantic salmon)
          Length = 120

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 28/67 (41%), Positives = 40/67 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+F+GGL  +  D+ L D+F  +GEIE   V  +  TG+ RGF F+ F   +S DK + 
Sbjct: 35  KKIFIGGLKDDIEDEHLNDYFSQFGEIEKAEVIAEKETGKKRGFGFVHFTDNDSADKAVV 94

Query: 187 AGEHTIN 207
              HTIN
Sbjct: 95  VKFHTIN 101



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 20/65 (30%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL  +I D+ + ++FS+FG I + E+  +K   +++GF F+ F      +  +    
Sbjct: 38  FIGGLKDDIEDEHLNDYFSQFGEIEKAEVIAEKETGKKRGFGFVHFTDNDSADKAVVVKF 97

Query: 435 RTIGG 449
            TI G
Sbjct: 98  HTING 102


>UniRef50_Q75KB4 Cluster: Putative RNA binding protein; n=4; Oryza
           sativa|Rep: Putative RNA binding protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 291

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 33/82 (40%), Positives = 45/82 (54%), Gaps = 3/82 (3%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFV GL  +T + +LR HF  YGE+    V  D  +G SRGF F+ F    +  + +A 
Sbjct: 6   KLFVAGLPQQTREGDLRGHFARYGEVVHTRVVLDMASGNSRGFGFVEFADEAATLRALAD 65

Query: 190 GE---HTINNKKVDPKKAKARH 246
            E   H    +KVD K+A+ RH
Sbjct: 66  DEMPNHVFRGRKVDVKRAERRH 87



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 27/76 (35%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   ++  ++ ++F +FGTI +  +  ++T N+ +GF FI+F+S + V  +L    
Sbjct: 115 FVGGLHETVTVKDLISYFEKFGTITDAVVMRNRTTNRARGFGFISFDSHEAVCKILLNRF 174

Query: 435 RTIGGKEVDVKRATPK 482
             + G++V+VK A PK
Sbjct: 175 HNLNGRDVEVKIAVPK 190



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/76 (36%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL    T K+L  +F  +G I    V  +  T R+RGF FI F + E++ K++ 
Sbjct: 112 KKVFVGGLHETVTVKDLISYFEKFGTITDAVVMRNRTTNRARGFGFISFDSHEAVCKILL 171

Query: 187 AGEHTINNKKVDPKKA 234
              H +N + V+ K A
Sbjct: 172 NRFHNLNGRDVEVKIA 187



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL---K 425
           FV GL  +  + ++R  F+ +G ++   +  D      +GF F+ F  E      L   +
Sbjct: 8   FVAGLPQQTREGDLRGHFARYGEVVHTRVVLDMASGNSRGFGFVEFADEAATLRALADDE 67

Query: 426 TPKRTIGGKEVDVKRATPKPD 488
            P     G++VDVKRA  + D
Sbjct: 68  MPNHVFRGRKVDVKRAERRHD 88


>UniRef50_A2YWJ2 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 424

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 28/77 (36%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   +++D+ ++FF ++G +++ ++  D    + +GF FI F S+QVV+DLL    
Sbjct: 176 FVGGLPQALTEDDFKHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVDDLLANGN 235

Query: 435 R-TIGGKEVDVKRATPK 482
              + G +V++K+A PK
Sbjct: 236 MIDLAGAKVEIKKAEPK 252



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL    T+ + +  F  YG +    +  D  T RSRGF FIVF + + +D ++A
Sbjct: 173 KKIFVGGLPQALTEDDFKHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVDDLLA 232

Query: 187 AGEH-TINNKKVDPKKAKAR 243
            G    +   KV+ KKA+ +
Sbjct: 233 NGNMIDLAGAKVEIKKAEPK 252



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 24/65 (36%), Positives = 35/65 (53%)
 Frame = +1

Query: 37  ETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 216
           E  + +   HFG YGEI    +  D +T + RGF FI +  P  +D+VM    H  N K+
Sbjct: 95  EPDEADFVKHFGQYGEIVDSVIMRDKHTSQPRGFGFITYSNPAVVDRVM-DDIHEFNGKQ 153

Query: 217 VDPKK 231
           V+ K+
Sbjct: 154 VEIKR 158



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 21/59 (35%), Positives = 34/59 (57%)
 Frame = +3

Query: 306 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           F ++G I++  +  DK  +Q +GF FIT+ +  VV D +        GK+V++KR  PK
Sbjct: 105 FGQYGEIVDSVIMRDKHTSQPRGFGFITYSNPAVV-DRVMDDIHEFNGKQVEIKRTIPK 162


>UniRef50_Q26658 Cluster: Stage specific activator protein; n=3;
           Strongylocentrotus purpuratus|Rep: Stage specific
           activator protein - Strongylocentrotus purpuratus
           (Purple sea urchin)
          Length = 382

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 25/81 (30%), Positives = 52/81 (64%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGG+S + T ++L + F ++G +E +++  D +TG+ RGF F+   + E+++K+
Sbjct: 97  RTKKVFVGGISQQATKEDLYELFRSHGNVEDVHIMNDTDTGKHRGFGFVTLDSEEAVEKL 156

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
           +      +  K ++ KKA+ +
Sbjct: 157 VRMHHLELKGKSMEIKKAQPK 177



 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 6/116 (5%)
 Frame = +3

Query: 168 NRQGHG--CW*THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           N +G G  C     +  E R   G   T + FVGG+S + + +++   F   G + +V +
Sbjct: 71  NLEGKGLDCKRCKARGSEKRMGPGDQRTKKVFVGGISQQATKEDLYELFRSHGNVEDVHI 130

Query: 342 PFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD----GPG 497
             D    + +GF F+T +SE+ V  L++     + GK +++K+A PK +    GPG
Sbjct: 131 MNDTDTGKHRGFGFVTLDSEEAVEKLVRMHHLELKGKSMEIKKAQPKMNRGFGGPG 186



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 5/86 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK-NQRKGFCFITFESEQVVNDLLKTP 431
           FVGG+      D  R +F +FG + ++ +  DK K  Q KGF F+TF     V+D+    
Sbjct: 9   FVGGVDRNTHADTFRAYFEKFGKLSDIILMMDKDKPGQNKGFGFVTFADPACVDDVTNEK 68

Query: 432 KRTIGGKEVDVK----RATPKPDGPG 497
              + GK +D K    R + K  GPG
Sbjct: 69  NHNLEGKGLDCKRCKARGSEKRMGPG 94



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNT-GRSRGFAFIVFKAPESIDKVMA 186
           K+FVGG+   T     R +F  +G++  I +  D +  G+++GF F+ F  P  +D V  
Sbjct: 7   KIFVGGVDRNTHADTFRAYFEKFGKLSDIILMMDKDKPGQNKGFGFVTFADPACVDDVTN 66

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +  K +D K+ KAR
Sbjct: 67  EKNHNLEGKGLDCKRCKAR 85


>UniRef50_Q5JK61 Cluster: RNA recognition motif (RRM)-containing
           protein-like; n=7; Oryza sativa|Rep: RNA recognition
           motif (RRM)-containing protein-like - Oryza sativa
           subsp. japonica (Rice)
          Length = 310

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           K+FVGGL+WET  + +R +F  +G+I    V TD NTGRS+G+ F+ F+ PE+  K
Sbjct: 22  KVFVGGLAWETQKEGMRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPEAAMK 77



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 26/81 (32%), Positives = 40/81 (49%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G +T  + FVGGL+ E   + +R +F +FG ILE  +  DK   + KG+ F+TF   +  
Sbjct: 16  GDTTLTKVFVGGLAWETQKEGMRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPEAA 75

Query: 411 NDLLKTPKRTIGGKEVDVKRA 473
                 P   I G+  +   A
Sbjct: 76  MKACFDPYPVIDGRRANCNLA 96


>UniRef50_Q4PBV1 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 192

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K++VG LSW TTD  L   F  YG++    V  D  TGRSRGF F+ F      D  +AA
Sbjct: 4   KVYVGNLSWNTTDDSLAHAFSTYGQLTDYIVMKDRETGRSRGFGFVTFATQAEADAAIAA 63

Query: 190 -GEHTINNKKVDPKKAKAR 243
             E  ++ +++    A +R
Sbjct: 64  LNEQELDGRRIRVNMANSR 82



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-P 431
           +VG LS   +DD + + FS +G + +  +  D+   + +GF F+TF ++   +  +    
Sbjct: 6   YVGNLSWNTTDDSLAHAFSTYGQLTDYIVMKDRETGRSRGFGFVTFATQAEADAAIAALN 65

Query: 432 KRTIGGKEVDVKRATPKPDG 491
           ++ + G+ + V  A  +P G
Sbjct: 66  EQELDGRRIRVNMANSRPAG 85


>UniRef50_Q40437 Cluster: RGP-3; n=2; Nicotiana|Rep: RGP-3 -
           Nicotiana sylvestris (Wood tobacco)
          Length = 144

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 28/60 (46%), Positives = 38/60 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSW T D+ LRD F  +G++    V  D ++GRSRGF F+ F   E  ++ + A
Sbjct: 39  KLFVGGLSWGTDDQSLRDAFATFGDVVDARVIVDRDSGRSRGFGFVNFSDDECANEAIKA 98



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-P 431
           FVGGLS    D  +R+ F+ FG +++  +  D+   + +GF F+ F  ++  N+ +K   
Sbjct: 41  FVGGLSWGTDDQSLRDAFATFGDVVDARVIVDRDSGRSRGFGFVNFSDDECANEAIKAMD 100

Query: 432 KRTIGGKEVDVKRATPKPDGPG 497
            + + G+ + V+ A  +    G
Sbjct: 101 GQELQGRNIRVRIAQERAPRSG 122


>UniRef50_UPI0000E4A54D Cluster: PREDICTED: hypothetical protein;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 244

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 28/71 (39%), Positives = 39/71 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL + TTDK LRDHF  YG IE   V TD  +G+S+G+ F+        +     
Sbjct: 11  KIFVGGLPYHTTDKSLRDHFEIYGTIEEAVVITDRTSGKSKGYGFVTMSDQREAETATKE 70

Query: 190 GEHTINNKKVD 222
               I+ +K +
Sbjct: 71  ANPIIDGRKAN 81



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 37/73 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    +D  +R+ F  +GTI E  +  D+T  + KG+ F+T   ++      K   
Sbjct: 13  FVGGLPYHTTDKSLRDHFEIYGTIEEAVVITDRTSGKSKGYGFVTMSDQREAETATKEAN 72

Query: 435 RTIGGKEVDVKRA 473
             I G++ +V  A
Sbjct: 73  PIIDGRKANVNLA 85


>UniRef50_Q10N14 Cluster: RNA recognition motif family protein,
           expressed; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: RNA recognition motif family
           protein, expressed - Oryza sativa subsp. japonica (Rice)
          Length = 310

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 27/71 (38%), Positives = 42/71 (59%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+WET    LR+HF  +G+I    + +D  TGRS+G+ F+ FK  ++  K    
Sbjct: 34  KVFVGGLAWETHKDTLREHFERFGDILEAVIISDKLTGRSKGYGFVTFKEADAAKKACED 93

Query: 190 GEHTINNKKVD 222
               IN ++ +
Sbjct: 94  ATPVINGRRAN 104



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 28/91 (30%), Positives = 42/91 (46%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           Q Q+     G +T  + FVGGL+ E   D +R  F  FG ILE  +  DK   + KG+ F
Sbjct: 19  QVQQPAAAFGDTTLTKVFVGGLAWETHKDTLREHFERFGDILEAVIISDKLTGRSKGYGF 78

Query: 384 ITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 476
           +TF+         +     I G+  +   A+
Sbjct: 79  VTFKEADAAKKACEDATPVINGRRANCNLAS 109


>UniRef50_Q6VYI5 Cluster: TARDBP S8; n=8; Coelomata|Rep: TARDBP S8 -
           Mus musculus (Mouse)
          Length = 302

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+D+F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPK 228
            H I+ +  D K
Sbjct: 165 RHMIDGRWCDCK 176



 Score = 39.1 bits (87), Expect = 0.088
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 2/79 (2%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++++FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK--PDGP 494
            G+  D K    K  PD P
Sbjct: 169 DGRWCDCKLPNSKQSPDEP 187



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 21/76 (27%), Positives = 39/76 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + +++ +E++ FF ++G +++V +P        + F F+TF  ++V   L     
Sbjct: 194 FVGRCTEDMTAEELQQFFCQYGEVVDVFIP-----KPFRAFAFVTFADDKVAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 33.1 bits (72), Expect = 5.8
 Identities = 22/82 (26%), Positives = 38/82 (46%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T +EL+  F  YGE+  + +         R FAF+ F A + + + 
Sbjct: 189 RSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKP-----FRAFAFVTF-ADDKVAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264


>UniRef50_Q5PPI5 Cluster: Putative uncharacterized protein; n=1;
           Rattus norvegicus|Rep: Putative uncharacterized protein
           - Rattus norvegicus (Rat)
          Length = 148

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/60 (48%), Positives = 36/60 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL++ T ++ L DHF ++G I  + V  D  T RSRGF FI F  PE     M A
Sbjct: 7   KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRA 66



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           FVGGL+    +  + + FS FG I EV +  D+   + +GF FITF + +  +D ++
Sbjct: 9   FVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMR 65


>UniRef50_Q05C33 Cluster: Tardbp protein; n=14; Coelomata|Rep:
           Tardbp protein - Mus musculus (Mouse)
          Length = 288

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+D+F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPK 228
            H I+ +  D K
Sbjct: 165 RHMIDGRWCDCK 176



 Score = 39.1 bits (87), Expect = 0.088
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 2/79 (2%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++++FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK--PDGP 494
            G+  D K    K  PD P
Sbjct: 169 DGRWCDCKLPNSKQSPDEP 187



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 15/55 (27%), Positives = 32/55 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDL 419
           FVG  + +++ +E++ FF ++G +++V +P        + F F+TF  ++V   L
Sbjct: 194 FVGRCTEDMTAEELQQFFCQYGEVVDVFIP-----KPFRAFAFVTFADDKVAQSL 243


>UniRef50_A5KRV2 Cluster: RNP-1 like RNA-binding protein; n=1;
           candidate division TM7 genomosp. GTL1|Rep: RNP-1 like
           RNA-binding protein - candidate division TM7 genomosp.
           GTL1
          Length = 108

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/80 (35%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLF+G L++ TTD  LR HF   GE+E   V TD ++GRS+GF F+ +   E  D  + 
Sbjct: 3   KKLFIGSLAYATTDDSLRAHFAEKGEVEEAKVVTDRDSGRSKGFGFVTYVNDEDADTAIK 62

Query: 187 AGEHT-INNKKVDPKKAKAR 243
             +++ ++ + +   +A+ R
Sbjct: 63  ELDNSELDGRNIHVNEARPR 82



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TP 431
           F+G L+   +DD +R  F+E G + E ++  D+   + KGF F+T+ +++  +  +K   
Sbjct: 6   FIGSLAYATTDDSLRAHFAEKGEVEEAKVVTDRDSGRSKGFGFVTYVNDEDADTAIKELD 65

Query: 432 KRTIGGKEVDVKRATPKPDGP 494
              + G+ + V  A P+ + P
Sbjct: 66  NSELDGRNIHVNEARPREERP 86


>UniRef50_Q501B0 Cluster: At2g46780; n=3; core eudicotyledons|Rep:
           At2g46780 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 336

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/53 (50%), Positives = 36/53 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           K+FVGGL+WET    +R +F  +GEI    V TD NTGRS+G+ F+ FK  E+
Sbjct: 23  KIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEA 75



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 23/73 (31%), Positives = 37/73 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E   D +R +F +FG I+E  +  DK   + KG+ F+TF+  +      +   
Sbjct: 25  FVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQNMN 84

Query: 435 RTIGGKEVDVKRA 473
             I G+  +   A
Sbjct: 85  PVIDGRRANCNLA 97


>UniRef50_Q6X9Z2 Cluster: HnRNP core protein A1; n=2;
           Laurasiatheria|Rep: HnRNP core protein A1 - Equus
           caballus (Horse)
          Length = 61

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/46 (58%), Positives = 33/46 (71%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           KLF+GGLS+ETTD+ LR HF  +G +    V  DPNT RSRGF F+
Sbjct: 15  KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV 60



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           F+GGLS E +D+ +R+ F ++GT+ +  +  D    + +GF F+T
Sbjct: 17  FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVT 61


>UniRef50_O75526 Cluster: RNA-binding motif protein,
           X-linked-like-2; n=77; Euteleostomi|Rep: RNA-binding
           motif protein, X-linked-like-2 - Homo sapiens (Human)
          Length = 392

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 34/79 (43%), Positives = 46/79 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   FG YG I  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  AAARD--MNGKSLDGKAIK 80



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E  +  +   F ++G I+EV +  D+  N+ +GF F+TFES        +   
Sbjct: 11  FIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            +++ GK + V +AT KP
Sbjct: 71  GKSLDGKAIKVAQAT-KP 87


>UniRef50_UPI0000211FC5 Cluster: PREDICTED: RNA binding motif
           protein 3; n=2; Eutheria|Rep: PREDICTED: RNA binding
           motif protein 3 - Pan troglodytes
          Length = 211

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 29/60 (48%), Positives = 36/60 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL++ T ++ L DHF ++G I  + V  D  T RSRGF FI F  PE     M A
Sbjct: 7   KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRA 66



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           FVGGL+    +  + + FS FG I EV +  D+   + +GF FITF + +
Sbjct: 9   FVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPE 58


>UniRef50_UPI0000EB42F3 Cluster: UPI0000EB42F3 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB42F3 UniRef100
           entry - Canis familiaris
          Length = 133

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 32/79 (40%), Positives = 44/79 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL++ T ++ L DHF ++G I  + V  D  T RSRGF FI F  PE     M A
Sbjct: 7   KLFVGGLNFITNEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFSNPEYASDTMRA 66

Query: 190 GEHTINNKKVDPKKAKARH 246
               +N + +D ++    H
Sbjct: 67  ----MNGESLDGRQICVDH 81



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+   ++  + + FS FG I EV +  D+   + +GF FITF + +  +D ++   
Sbjct: 9   FVGGLNFITNEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFSNPEYASDTMRAMN 68

Query: 435 -RTIGGKEVDV 464
             ++ G+++ V
Sbjct: 69  GESLDGRQICV 79


>UniRef50_Q94AC3 Cluster: AT4g36960/C7A10_400; n=11;
           Magnoliophyta|Rep: AT4g36960/C7A10_400 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 379

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 31/78 (39%), Positives = 43/78 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  + S +S+ + R+ F  +G I ++ MP D    Q +G  FITF S   V DL++   
Sbjct: 94  FVARIPSSVSESDFRSHFERYGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLME-DT 152

Query: 435 RTIGGKEVDVKRATPKPD 488
             +GG  V V RATPK D
Sbjct: 153 HDLGGTTVAVDRATPKED 170



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 32/83 (38%), Positives = 47/83 (56%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L  E S D++R++F  FG I +  +P D  ++  +GF F+TF +E  V D +    
Sbjct: 243 FVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTF-AENGVADRVARRS 301

Query: 435 RTIGGKEVDVKRATPKPD-GPGA 500
             I G+EV +  ATP  + GP A
Sbjct: 302 HEICGQEVAIDSATPLDEAGPSA 324



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 26/75 (34%), Positives = 42/75 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KL V G+ W+     L+D+   +G++E   V  D +TGRSRGF ++ F + E     +  
Sbjct: 4   KLVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL-K 62

Query: 190 GEHTINNKKVDPKKA 234
           GEH + N+ ++ K A
Sbjct: 63  GEHFLGNRILEVKVA 77



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 26/70 (37%), Positives = 37/70 (52%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG L  E +  +LRD+FG +G I+   +  DP     RGF F+ F      D+V A 
Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRV-AR 299

Query: 190 GEHTINNKKV 219
             H I  ++V
Sbjct: 300 RSHEICGQEV 309



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 18/58 (31%), Positives = 33/58 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++FV  +    ++ + R HF  YGEI  + +  D N+ + RG  FI F + +S++ +M
Sbjct: 92  RIFVARIPSSVSESDFRSHFERYGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLM 149



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/75 (28%), Positives = 45/75 (60%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           G+  +I  D ++++ S+FG + +  +  D++  + +GF ++TF S +   + LK  +  +
Sbjct: 9   GIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNALK-GEHFL 67

Query: 444 GGKEVDVKRATPKPD 488
           G + ++VK ATPK +
Sbjct: 68  GNRILEVKVATPKEE 82


>UniRef50_Q2V9B8 Cluster: RNA-binding protein AKIP1-like; n=1;
           Solanum tuberosum|Rep: RNA-binding protein AKIP1-like -
           Solanum tuberosum (Potato)
          Length = 498

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 29/79 (36%), Positives = 41/79 (51%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H K+FV GL W+TT + L   F  YGEIE     TD  +G+S+G+ FI+FK      K +
Sbjct: 158 HRKIFVHGLGWDTTAETLTSVFATYGEIEDCKAVTDKVSGKSKGYGFILFKHRSGARKAL 217

Query: 184 AAGEHTINNKKVDPKKAKA 240
              +  I  +    + A A
Sbjct: 218 KEPQKKIGTRMTSCQLASA 236



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 19/77 (24%), Positives = 40/77 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  +++++   ++  +FS+FG + E  +  DK   + KGFC   +++ +     L+ P 
Sbjct: 260 FVSNVAADLEPQKLLEYFSKFGEVEEGPLGLDKQSGKPKGFCLFVYKTVEGARKALEEPH 319

Query: 435 RTIGGKEVDVKRATPKP 485
           +T  G  +  ++A   P
Sbjct: 320 KTFEGHTLHCQKAIDGP 336



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 23/94 (24%), Positives = 44/94 (46%), Gaps = 2/94 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FV  ++ +   ++L ++F  +GE+E   +  D  +G+ +GF   V+K  E   K +  
Sbjct: 258 KIFVSNVAADLEPQKLLEYFSKFGEVEEGPLGLDKQSGKPKGFCLFVYKTVEGARKALEE 317

Query: 190 GEHTINNKKVDPKKA--KARHGKILSEDSAVKSQ 285
              T     +  +KA    +H K   +    +SQ
Sbjct: 318 PHKTFEGHTLHCQKAIDGPKHSKNFHQQQQPQSQ 351


>UniRef50_O64571 Cluster: Putative RNA-binding protein; n=3;
           Arabidopsis thaliana|Rep: Putative RNA-binding protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 613

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/80 (35%), Positives = 45/80 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +FV G  W+TT + L+  F +YGEIE  +V  D +TGR +G+ F++FK  +   + +   
Sbjct: 410 IFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRP 469

Query: 193 EHTINNKKVDPKKAKARHGK 252
           E  + N+ V    A  + GK
Sbjct: 470 EKRMYNRIVVCNLASEKPGK 489


>UniRef50_A7RU25 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 291

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 29/67 (43%), Positives = 41/67 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL + TT+ E++++F  +GEI+   VK DPNT RSRGF F+ FK  E    V++  
Sbjct: 117 LIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLST- 175

Query: 193 EHTINNK 213
            H I  +
Sbjct: 176 SHRIQGR 182



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 21/75 (28%), Positives = 40/75 (53%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL    ++ E++ +F+ FG I   E+  D    + +GF F+ F+ ++   ++L T  R I
Sbjct: 121 GLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLSTSHR-I 179

Query: 444 GGKEVDVKRATPKPD 488
            G+  +V+   PK +
Sbjct: 180 QGRLCEVRLPRPKEE 194



 Score = 39.9 bits (89), Expect = 0.050
 Identities = 26/93 (27%), Positives = 45/93 (48%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           RPKE  +   + FVG L    ++  +  +F++FG + +V +P        + F F+TF S
Sbjct: 190 RPKEELNVPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIP-----KPFRHFGFVTFAS 244

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
            ++   +L    R I G  +++  A PK    G
Sbjct: 245 GELAKKVLSQNHR-ISGSLLNITFAEPKSTAKG 276



 Score = 37.5 bits (83), Expect = 0.27
 Identities = 20/60 (33%), Positives = 32/60 (53%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLFVG L   TT+K L ++F  +GE+  + +         R F F+ F + E   KV++
Sbjct: 199 KKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPKP-----FRHFGFVTFASGELAKKVLS 253


>UniRef50_Q1DPW0 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 147

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 30/71 (42%), Positives = 42/71 (59%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+W TTD+ LR  F  +G IE   V  D +T RSRGF F+ F +    +  M  
Sbjct: 3   KLFIGGLAWHTTDETLRQGFSKFGSIEEAIVVKDRDTNRSRGFGFVRFASEGEAEAAM-- 60

Query: 190 GEHTINNKKVD 222
             + +NN++ D
Sbjct: 61  --NEMNNQEFD 69



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE-QVVNDLLKTP 431
           F+GGL+   +D+ +R  FS+FG+I E  +  D+  N+ +GF F+ F SE +    + +  
Sbjct: 5   FIGGLAWHTTDETLRQGFSKFGSIEEAIVVKDRDTNRSRGFGFVRFASEGEAEAAMNEMN 64

Query: 432 KRTIGGKEVDVKRATPKPDGP 494
            +   G+ + V +A  +P GP
Sbjct: 65  NQEFDGRTIRVDKAADRPSGP 85


>UniRef50_Q13148 Cluster: TAR DNA-binding protein 43; n=36;
           Coelomata|Rep: TAR DNA-binding protein 43 - Homo sapiens
           (Human)
          Length = 414

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 32/91 (35%), Positives = 54/91 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+TT+++L+++F  +GE+  + VK D  TG S+GF F+ F   E+  KVM+  
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ- 164

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            H I+ +  D K   ++     S+D  ++S+
Sbjct: 165 RHMIDGRWCDCKLPNSKQ----SQDEPLRSR 191



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG  + ++++DE+R FFS++G +++V +P        + F F+TF  +Q+   L     
Sbjct: 194 FVGRCTEDMTEDELREFFSQYGDVMDVFIP-----KPFRAFAFVTFADDQIAQSLC-GED 247

Query: 435 RTIGGKEVDVKRATPK 482
             I G  V +  A PK
Sbjct: 248 LIIKGISVHISNAEPK 263



 Score = 36.7 bits (81), Expect = 0.47
 Identities = 20/73 (27%), Positives = 36/73 (49%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL  + ++ +++ +FS FG +L V++  D      KGF F+ F +E      + + +  I
Sbjct: 110 GLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF-TEYETQVKVMSQRHMI 168

Query: 444 GGKEVDVKRATPK 482
            G+  D K    K
Sbjct: 169 DGRWCDCKLPNSK 181



 Score = 36.7 bits (81), Expect = 0.47
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG  + + T+ ELR+ F  YG++  + +         R FAF+ F A + I + 
Sbjct: 189 RSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP-----FRAFAFVTF-ADDQIAQS 242

Query: 181 MAAGEHTINNKKVDPKKAKARH 246
           +   +  I    V    A+ +H
Sbjct: 243 LCGEDLIIKGISVHISNAEPKH 264


>UniRef50_Q4SJ02 Cluster: Chromosome 21 SCAF14577, whole genome
           shotgun sequence; n=2; Tetraodon nigroviridis|Rep:
           Chromosome 21 SCAF14577, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 278

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 28/73 (38%), Positives = 41/73 (56%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + K+FVGGL + TTD  LR +F  +GEIE   V TD  TG+SRG+ F+      + D+  
Sbjct: 10  YTKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRAC 69

Query: 184 AAGEHTINNKKVD 222
                 I+ +K +
Sbjct: 70  KDPNPIIDGRKAN 82


>UniRef50_Q94BU4 Cluster: At1g33470/F10C21_14; n=2; Arabidopsis
           thaliana|Rep: At1g33470/F10C21_14 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 244

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+WET    LR++F  +G+I    V TD ++GRS+G+ F+ F  PE+  K    
Sbjct: 8   KVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVD 67

Query: 190 GEHTINNKKVD 222
               I+ ++ +
Sbjct: 68  PAPVIDGRRAN 78



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 24/73 (32%), Positives = 37/73 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ E     +RN+F +FG I+E  +  DK+  + KG+ F+TF   +        P 
Sbjct: 10  FVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPA 69

Query: 435 RTIGGKEVDVKRA 473
             I G+  +   A
Sbjct: 70  PVIDGRRANCNLA 82


>UniRef50_Q8LLE6 Cluster: RNA-binding protein AKIP1; n=7; core
           eudicotyledons|Rep: RNA-binding protein AKIP1 - Vicia
           faba (Broad bean)
          Length = 515

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H K+FV GL W+TT   L + F  YGEIE     TD  +G+S+G+ FI+FK        +
Sbjct: 150 HRKIFVHGLGWDTTSATLINAFSQYGEIEDCKAVTDKASGKSKGYGFILFKKRSGARNAL 209

Query: 184 AAGEHTINNK 213
              +  I N+
Sbjct: 210 KEPQKKIGNR 219



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 23/77 (29%), Positives = 39/77 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV GL  + +   + N FS++G I + +   DK   + KG+ FI F+      + LK P+
Sbjct: 154 FVHGLGWDTTSATLINAFSQYGEIEDCKAVTDKASGKSKGYGFILFKKRSGARNALKEPQ 213

Query: 435 RTIGGKEVDVKRATPKP 485
           + IG +    + A+  P
Sbjct: 214 KKIGNRMTACQLASIGP 230



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 23/82 (28%), Positives = 39/82 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++  +  E+   ++  +FS FG I E  +  DK   + KGFC   ++S +     L+ P 
Sbjct: 254 YISNVGPELDPHKLFAYFSRFGEIEEGPLGLDKATGKPKGFCLFVYKSAESARRSLEEPH 313

Query: 435 RTIGGKEVDVKRATPKPDGPGA 500
           +   G  +  +RA    DGP A
Sbjct: 314 KEFEGHILHCQRAI---DGPKA 332



 Score = 37.5 bits (83), Expect = 0.27
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           K+++  +  E    +L  +F  +GEIE   +  D  TG+ +GF   V+K+ ES
Sbjct: 252 KIYISNVGPELDPHKLFAYFSRFGEIEEGPLGLDKATGKPKGFCLFVYKSAES 304


>UniRef50_UPI0000D9F579 Cluster: PREDICTED: similar to
           testes-specific heterogenous nuclear ribonucleoprotein
           G-T; n=1; Macaca mulatta|Rep: PREDICTED: similar to
           testes-specific heterogenous nuclear ribonucleoprotein
           G-T - Macaca mulatta
          Length = 415

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 34/79 (43%), Positives = 48/79 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R EKLFVGGL+ +T +K L+  F  YG I ++ +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPEKLFVGGLNLKTEEKALKAEFVKYGRIINVFLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA +  +N K +D K  K
Sbjct: 64  AAARD--LNGKYLDGKAIK 80



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/71 (33%), Positives = 39/71 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ +  +  ++  F ++G I+ V +  D+  N+ +GF F+TFES        K   
Sbjct: 11  FVGGLNLKTEEKALKAEFVKYGRIINVFLMKDRETNKSRGFAFVTFESPADA----KAAA 66

Query: 435 RTIGGKEVDVK 467
           R + GK +D K
Sbjct: 67  RDLNGKYLDGK 77


>UniRef50_Q8VXC4 Cluster: Glycine rich RNA binding protein; n=20;
           Magnoliophyta|Rep: Glycine rich RNA binding protein -
           Oryza sativa (Rice)
          Length = 194

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMA 186
           + FVGGL+W T D+ L   F  YGEI    +  D  TGRSRGF F+ F + +++ D +  
Sbjct: 9   RCFVGGLAWATDDRSLEAAFSTYGEILESKIINDRETGRSRGFGFVTFSSEQAMRDAIEG 68

Query: 187 AGEHTINNKKVDPKKAKAR 243
                ++ + +   +A++R
Sbjct: 69  MNGKELDGRNITVNEAQSR 87



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+    D  +   FS +G ILE ++  D+   + +GF F+TF SEQ + D ++   
Sbjct: 11  FVGGLAWATDDRSLEAAFSTYGEILESKIINDRETGRSRGFGFVTFSSEQAMRDAIEGMN 70

Query: 435 -RTIGGKEVDVKRATPKPDGPG 497
            + + G+ + V  A  +  G G
Sbjct: 71  GKELDGRNITVNEAQSRRSGGG 92


>UniRef50_Q8RYD4 Cluster: UBP1 interacting protein 1a; n=5;
           Arabidopsis thaliana|Rep: UBP1 interacting protein 1a -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 344

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 35/98 (35%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H K+FV GL WETT + L   F  YGEIE   V  D  TG+++GF F++FK  +   + +
Sbjct: 104 HRKIFVYGLPWETTRETLVGVFEGYGEIEECTVLIDKATGKAKGFGFVMFKTRKGAKEAL 163

Query: 184 AAGEHTINNKKVDPKKAK---ARHGKILSEDSAVKSQM 288
              +  I N+    + A    A  GK   +   VK  M
Sbjct: 164 KEPKKRILNRTATCQLASMGPAASGKGHDQPGPVKISM 201



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV GL  E + + +   F  +G I E  +  DK   + KGF F+ F++ +   + LK PK
Sbjct: 108 FVYGLPWETTRETLVGVFEGYGEIEECTVLIDKATGKAKGFGFVMFKTRKGAKEALKEPK 167

Query: 435 RTIGGKEVDVKRATPKPDGPG 497
           + I  +    + A+  P   G
Sbjct: 168 KRILNRTATCQLASMGPAASG 188


>UniRef50_Q5K249 Cluster: Putative glycine-rich RNA-binding protein;
           n=1; Guillardia theta|Rep: Putative glycine-rich
           RNA-binding protein - Guillardia theta (Cryptomonas phi)
          Length = 152

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMA 186
           K FV GL W  T ++LRD F  +G I+  NV  D  TGRSRGF F+ F ++ +    + A
Sbjct: 62  KCFVSGLPWALTSEDLRDLFAEFGAIQDANVVYDRETGRSRGFGFVTFAESADCEAAITA 121

Query: 187 AGEHTINNKKVDPKKAKARHGK 252
             +  I  + V  K+A  R  +
Sbjct: 122 MDKANIGGRTVLVKQANVREAR 143



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FV GL   ++ +++R+ F+EFG I +  + +D+   + +GF F+TF ES      +    
Sbjct: 64  FVSGLPWALTSEDLRDLFAEFGAIQDANVVYDRETGRSRGFGFVTFAESADCEAAITAMD 123

Query: 432 KRTIGGKEVDVKRATPKPDGP 494
           K  IGG+ V VK+A  +   P
Sbjct: 124 KANIGGRTVLVKQANVREARP 144


>UniRef50_A7PVU6 Cluster: Chromosome chr8 scaffold_34, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_34, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 907

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 30/70 (42%), Positives = 39/70 (55%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H KLFV GL+W TT + L   F  +GEIE   V  D  TG+SRG+ FI +K  ES    +
Sbjct: 64  HRKLFVRGLAWNTTSETLCAAFRLHGEIEEGAVIVDKTTGKSRGYGFITYKHMESTQSAL 123

Query: 184 AAGEHTINNK 213
            A    I+ +
Sbjct: 124 QAPSKLIDGR 133



 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 28/83 (33%), Positives = 46/83 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KL++GGL+ + T + L   FG +GEIE  +V  D  T  SRGF F+ +K  E+  K +  
Sbjct: 157 KLYIGGLAPDVTSEVLLSFFGRHGEIEEGSVAYDKETNESRGFGFVTYKTVEAAKKAIDD 216

Query: 190 GEHTINNKKVDPKKAKARHGKIL 258
            +  +  + +  K A +  GK++
Sbjct: 217 PQKFLGGRSIIVKLADSHKGKMI 239



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 21/73 (28%), Positives = 45/73 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++GGL+ +++ + + +FF   G I E  + +DK  N+ +GF F+T+++ +     +  P+
Sbjct: 159 YIGGLAPDVTSEVLLSFFGRHGEIEEGSVAYDKETNESRGFGFVTYKTVEAAKKAIDDPQ 218

Query: 435 RTIGGKEVDVKRA 473
           + +GG+ + VK A
Sbjct: 219 KFLGGRSIIVKLA 231



 Score = 35.9 bits (79), Expect = 0.82
 Identities = 19/66 (28%), Positives = 33/66 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV GL+   + + +   F   G I E  +  DKT  + +G+ FIT++  +     L+ P 
Sbjct: 68  FVRGLAWNTTSETLCAAFRLHGEIEEGAVIVDKTTGKSRGYGFITYKHMESTQSALQAPS 127

Query: 435 RTIGGK 452
           + I G+
Sbjct: 128 KLIDGR 133


>UniRef50_Q6MCT2 Cluster: Probable nucleic acid-binding protein;
           n=1; Candidatus Protochlamydia amoebophila UWE25|Rep:
           Probable nucleic acid-binding protein - Protochlamydia
           amoebophila (strain UWE25)
          Length = 112

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 22/59 (37%), Positives = 41/59 (69%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +K+FVG LSW+T++++L+ HF A+G++ S  + TD  TG+S+GF F+  ++    +  +
Sbjct: 2   KKIFVGNLSWKTSEEQLKAHFEAFGKVVSAKIVTDQMTGKSKGFGFVEMESANDAENAI 60



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 16/48 (33%), Positives = 29/48 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           FVG LS + S+++++  F  FG ++  ++  D+   + KGF F+  ES
Sbjct: 5   FVGNLSWKTSEEQLKAHFEAFGKVVSAKIVTDQMTGKSKGFGFVEMES 52


>UniRef50_Q67W00 Cluster: Putative RRM-containing protein; n=2;
           Oryza sativa|Rep: Putative RRM-containing protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 343

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 27/53 (50%), Positives = 35/53 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           K+FVGGL+WET  + LR HF  YGEI    V  D  TGRS+G+ F+ F+  E+
Sbjct: 40  KVFVGGLAWETPSEGLRRHFEQYGEILEAVVIADRLTGRSKGYGFVTFREAEA 92



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 27/92 (29%), Positives = 46/92 (50%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           R + G +T  + FVGGL+ E   + +R  F ++G ILE  +  D+   + KG+ F+TF  
Sbjct: 30  RSRFGDTTLTKVFVGGLAWETPSEGLRRHFEQYGEILEAVVIADRLTGRSKGYGFVTFRE 89

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
            +     ++ P   I G+  +   A+  P  P
Sbjct: 90  AEAARRAVQDPNPMIAGRRANCNIASLGPPRP 121


>UniRef50_Q54D98 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 687

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K+FVGGL   ++++ L+D+F  +GE+ ESI +K      +SRGF F+ F  P  ID+V+ 
Sbjct: 107 KIFVGGLLKTSSNEILKDYFSNFGEVKESIVIKATEKASKSRGFGFVTFVDPSVIDEVIL 166

Query: 187 AGEHTINNKKVDPKKA 234
              H+I  K V+ ++A
Sbjct: 167 I-NHSIEGKNVEIRRA 181



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 29/95 (30%), Positives = 51/95 (53%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           + +KLFVGGL    T  +  ++F  +GEI   N+ T+ N G  +GF FI FK     + +
Sbjct: 192 KKQKLFVGGLPKHITSDDFNNYFSEFGEISEYNLLTEKN-GTIKGFGFICFKDESVNEII 250

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
           +   +H I  K+VD + A +++ ++  +    + Q
Sbjct: 251 LNEQQHIILGKRVDIRIADSQNKRLQQQQQQQQQQ 285



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 31/73 (42%), Positives = 41/73 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   I+ D+  N+FSEFG I E  +  +K     KGF FI F+ E V   +L   +
Sbjct: 197 FVGGLPKHITSDDFNNYFSEFGEISEYNLLTEK-NGTIKGFGFICFKDESVNEIILNEQQ 255

Query: 435 RTIGGKEVDVKRA 473
             I GK VD++ A
Sbjct: 256 HIILGKRVDIRIA 268



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 25/79 (31%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILE-VEMPFDKTKNQRKGFCFITFESEQVVNDLLKTP 431
           FVGGL    S++ ++++FS FG + E + +   +  ++ +GF F+TF    V+++++   
Sbjct: 109 FVGGLLKTSSNEILKDYFSNFGEVKESIVIKATEKASKSRGFGFVTFVDPSVIDEVILI- 167

Query: 432 KRTIGGKEVDVKRATPKPD 488
             +I GK V+++RA PK +
Sbjct: 168 NHSIEGKNVEIRRAIPKEE 186


>UniRef50_Q8GU29 Cluster: Glycin-rich RNA binding protein; n=6;
           cellular organisms|Rep: Glycin-rich RNA binding protein
           - Polytomella sp. Pringsheim 198.80
          Length = 177

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 23/57 (40%), Positives = 37/57 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +L+VG LSW   +++LR +FG +GE+E  ++  D  +GRSRGF F+   A  + D +
Sbjct: 4   RLYVGNLSWNAKEEDLRTYFGKFGEVEEASIALDRESGRSRGFGFVTLPADVAKDAI 60



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 21/80 (26%), Positives = 42/80 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG LS    ++++R +F +FG + E  +  D+   + +GF F+T  ++   + + KT  
Sbjct: 6   YVGNLSWNAKEEDLRTYFGKFGEVEEASIALDRESGRSRGFGFVTLPADVAKDAIEKTNG 65

Query: 435 RTIGGKEVDVKRATPKPDGP 494
               G+ + V  A+P  + P
Sbjct: 66  AEFMGRNIKVNEASPPGERP 85


>UniRef50_Q5ZAN1 Cluster: Putative uncharacterized protein
           OSJNBb0053G03.9; n=5; Oryza sativa|Rep: Putative
           uncharacterized protein OSJNBb0053G03.9 - Oryza sativa
           subsp. japonica (Rice)
          Length = 407

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H K+FVGG+   T++ ELR HF  +G +  +    +  TG +RGFAF+ F  P+     +
Sbjct: 28  HGKVFVGGVPLGTSESELRAHFSRFGTVAFVGAPKNKQTGAARGFAFVQFVNPDDAAAAI 87

Query: 184 AAG--EHTINNKKVDPKKAKARHG 249
           AAG   + I    V  +  +AR G
Sbjct: 88  AAGPDRNVIRGTTVYTRTPQARSG 111



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 30/92 (32%), Positives = 47/92 (51%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL    T+K+L+++F  +GE+    V  D NT   RGF FI F + ES  + +  
Sbjct: 220 KIFVGGLPVSATEKKLKEYFNKFGEVNRAIVVIDLNTKMPRGFGFIQFASEESTARALKK 279

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            +H +  + V+   A  +     S  S +  Q
Sbjct: 280 DKHFLCGQWVEVSLAMPKQQNAASGTSKLSVQ 311



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 25/76 (32%), Positives = 40/76 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    ++ +++ +F++FG +    +  D      +GF FI F SE+     LK  K
Sbjct: 222 FVGGLPVSATEKKLKEYFNKFGEVNRAIVVIDLNTKMPRGFGFIQFASEESTARALKKDK 281

Query: 435 RTIGGKEVDVKRATPK 482
             + G+ V+V  A PK
Sbjct: 282 HFLCGQWVEVSLAMPK 297



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 19/46 (41%), Positives = 26/46 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVGG+    S+ E+R  FS FGT+  V  P +K     +GF F+ F
Sbjct: 32  FVGGVPLGTSESELRAHFSRFGTVAFVGAPKNKQTGAARGFAFVQF 77


>UniRef50_Q5CT90 Cluster: RRM domain containing protein; n=1;
           Cryptosporidium parvum Iowa II|Rep: RRM domain
           containing protein - Cryptosporidium parvum Iowa II
          Length = 199

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 30/77 (38%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-P 431
           FVG L +  S D +R +F +FG I +  M  DK     +GF F+TF S  VV+++++   
Sbjct: 88  FVGNLPTTCSQDILRKYFEQFGQISDCVMMCDKKSGIGRGFGFVTFTSTSVVDEIIRAYD 147

Query: 432 KRTIGGKEVDVKRATPK 482
           +  I G+ V+VKRA+P+
Sbjct: 148 EHYIDGQWVEVKRASPE 164



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R EK+FVG L    +   LR +F  +G+I    +  D  +G  RGF F+ F +   +D++
Sbjct: 83  RTEKIFVGNLPTTCSQDILRKYFEQFGQISDCVMMCDKKSGIGRGFGFVTFTSTSVVDEI 142

Query: 181 MAA-GEHTINNKKVDPKKA 234
           + A  EH I+ + V+ K+A
Sbjct: 143 IRAYDEHYIDGQWVEVKRA 161


>UniRef50_A7RRA7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 409

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 28/63 (44%), Positives = 38/63 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG L+ +T    L ++F  +GEIE + +  D  TG SRGFAFI F  PES  K +  
Sbjct: 63  KVFVGNLNRDTKPVTLAEYFSVFGEIEGLRIVKDHETGISRGFAFITFTEPESASKAIRW 122

Query: 190 GEH 198
            +H
Sbjct: 123 CKH 125



 Score = 33.1 bits (72), Expect = 5.8
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 3/76 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L+ +     +  +FS FG I  + +  D      +GF FITF   +  +  ++  K
Sbjct: 65  FVGNLNRDTKPVTLAEYFSVFGEIEGLRIVKDHETGISRGFAFITFTEPESASKAIRWCK 124

Query: 435 R---TIGGKEVDVKRA 473
                + G+++ +  A
Sbjct: 125 HHHPQLDGRQITISGA 140


>UniRef50_Q9SVM8 Cluster: Glycine-rich RNA-binding protein 2,
           mitochondrial precursor; n=14; Magnoliophyta|Rep:
           Glycine-rich RNA-binding protein 2, mitochondrial
           precursor - Arabidopsis thaliana (Mouse-ear cress)
          Length = 158

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 26/48 (54%), Positives = 31/48 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           KLF+GGLSW T D  LRD F  +G++    V  D  TGRSRGF F+ F
Sbjct: 36  KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           F+GGLS    D  +R+ F+ FG +++ ++  D+   + +GF F+ F  E      + +  
Sbjct: 38  FIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMD 97

Query: 432 KRTIGGKEVDVKRATPKPDGPGA 500
            + + G+ + V  A  +P  P A
Sbjct: 98  GKELNGRHIRVNPANDRPSAPRA 120


>UniRef50_A5BGN9 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 294

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 28/83 (33%), Positives = 46/83 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KL++GGL+ + T + L   FG +GEIE  +V  D  T  SRGF F+ +K  E+  K +  
Sbjct: 109 KLYIGGLAPDVTSEVLLSFFGRHGEIEEGSVAYDKETNESRGFGFVTYKTVEAAKKAIDD 168

Query: 190 GEHTINNKKVDPKKAKARHGKIL 258
            +  +  + +  K A +  GK++
Sbjct: 169 PQKFLGGRSIIVKLADSHKGKMI 191



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 21/73 (28%), Positives = 45/73 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++GGL+ +++ + + +FF   G I E  + +DK  N+ +GF F+T+++ +     +  P+
Sbjct: 111 YIGGLAPDVTSEVLLSFFGRHGEIEEGSVAYDKETNESRGFGFVTYKTVEAAKKAIDDPQ 170

Query: 435 RTIGGKEVDVKRA 473
           + +GG+ + VK A
Sbjct: 171 KFLGGRSIIVKLA 183


>UniRef50_Q4D4H5 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 601

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 29/55 (52%), Positives = 34/55 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           LFV GL    TD EL  HF  YGEIES  V  D +TG+SRG AF+ FK   + +K
Sbjct: 239 LFVSGLHASVTDNELYKHFHPYGEIESAKVMLDIHTGKSRGIAFVKFKEVANAEK 293



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 3/67 (4%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDP---NTGRSRGFAFIVFKAPESIDKV 180
           K FV  +       EL  HFG YGE+  +++  D    ++   R  AF+ +   E+  + 
Sbjct: 327 KTFVRNIPLNMKKAELIQHFGLYGEVVDVSIHNDAAQRSSNNKRNVAFVTYTTKEAAARA 386

Query: 181 MAAGEHT 201
            A   HT
Sbjct: 387 -ARETHT 392


>UniRef50_Q03250 Cluster: Glycine-rich RNA-binding protein 7; n=16;
           cellular organisms|Rep: Glycine-rich RNA-binding protein
           7 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 176

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMA 186
           + FVGGL+W T D+ L   F  YG++    +  D  TGRSRGF F+ FK  +++ D +  
Sbjct: 9   RCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEG 68

Query: 187 AGEHTINNKKVDPKKAKAR 243
                ++ + +   +A++R
Sbjct: 69  MNGQDLDGRSITVNEAQSR 87



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 21/82 (25%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+    D  +   F+++G +++ ++  D+   + +GF F+TF+ E+ + D ++   
Sbjct: 11  FVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMN 70

Query: 435 -RTIGGKEVDVKRATPKPDGPG 497
            + + G+ + V  A  +  G G
Sbjct: 71  GQDLDGRSITVNEAQSRGSGGG 92


>UniRef50_UPI0000E4A88D Cluster: PREDICTED: similar to MGC88935
           protein, partial; n=2; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to MGC88935 protein,
           partial - Strongylocentrotus purpuratus
          Length = 342

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 30/76 (39%), Positives = 40/76 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L+  I D+ +RN F EFGT+  V +  DK     KGF ++ FE    V   LK   
Sbjct: 257 FVGNLAFNIDDEAVRNHFEEFGTVEGVRLIRDKATGVGKGFGYVLFEDSSSVQFALKMDG 316

Query: 435 RTIGGKEVDVKRATPK 482
             + G+ + VKRA  K
Sbjct: 317 TKLNGRPLRVKRAVKK 332



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 21/74 (28%), Positives = 41/74 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFVG L++   D+ +R+HF  +G +E + +  D  TG  +GF +++F+   S+   +   
Sbjct: 256 LFVGNLAFNIDDEAVRNHFEEFGTVEGVRLIRDKATGVGKGFGYVLFEDSSSVQFALKMD 315

Query: 193 EHTINNKKVDPKKA 234
              +N + +  K+A
Sbjct: 316 GTKLNGRPLRVKRA 329


>UniRef50_Q8RWN5 Cluster: RNA-binding protein-like; n=3; Arabidopsis
           thaliana|Rep: RNA-binding protein-like - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 310

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E++D ++   FS FG IL+ ++  ++   + +GF FITF   + +++ ++   
Sbjct: 10  FVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMH 69

Query: 435 -RTIGGKEVDVKRATPK 482
            R  G + + V RA PK
Sbjct: 70  GRDFGDRVISVNRAEPK 86



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 6/79 (7%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVGGLS E TD++L   F  +G+I    +  + +TGRSRGF FI F    ++D+ +  
Sbjct: 8   RIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIRE 67

Query: 190 ------GEHTINNKKVDPK 228
                 G+  I+  + +PK
Sbjct: 68  MHGRDFGDRVISVNRAEPK 86


>UniRef50_O45189 Cluster: Suppressor protein 12; n=2;
           Caenorhabditis|Rep: Suppressor protein 12 -
           Caenorhabditis elegans
          Length = 248

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 27/71 (38%), Positives = 42/71 (59%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL + T+DK L ++F  +G+IE   V TD NT +SRG+ F+  K   S ++    
Sbjct: 36  KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD 95

Query: 190 GEHTINNKKVD 222
               I+ +K +
Sbjct: 96  PNPIIDGRKAN 106



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    SD  +  +F +FG I E  +  D+   + +G+ F+T +         K P 
Sbjct: 38  FVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPN 97

Query: 435 RTIGGKEVDVKRA 473
             I G++ +V  A
Sbjct: 98  PIIDGRKANVNLA 110


>UniRef50_Q09100 Cluster: RNA-binding protein rnp24; n=1;
           Schizosaccharomyces pombe|Rep: RNA-binding protein rnp24
           - Schizosaccharomyces pombe (Fission yeast)
          Length = 369

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 25/63 (39%), Positives = 40/63 (63%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFVG L +ETTD +L++HFG  G+I  + + T  +TG+ +GF F+ F   ++  K M  G
Sbjct: 230 LFVGNLDFETTDADLKEHFGQVGQIRRVRLMTFEDTGKCKGFGFVDFPDIDTCMKAMELG 289

Query: 193 EHT 201
            ++
Sbjct: 290 HNS 292


>UniRef50_Q83CD7 Cluster: Nucleic acid binding domain protein; n=3;
           Coxiella burnetii|Rep: Nucleic acid binding domain
           protein - Coxiella burnetii
          Length = 103

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 30/81 (37%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMA 186
           K++VG LS++ T  EL+  FG YGEIE   +  D  TGRS+GFAFI +   ++  + V  
Sbjct: 5   KIYVGSLSYDVTADELQSFFGQYGEIEEAKLIMDRETGRSKGFAFITYGTQDAAQEAVSK 64

Query: 187 AGEHTINNKKVDPKKAKARHG 249
           A    +  +K+    A+   G
Sbjct: 65  ANGIDLQGRKIRVNIARENTG 85



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/74 (29%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           +VG LS +++ DE+++FF ++G I E ++  D+   + KGF FIT+ ++    + + K  
Sbjct: 7   YVGSLSYDVTADELQSFFGQYGEIEEAKLIMDRETGRSKGFAFITYGTQDAAQEAVSKAN 66

Query: 432 KRTIGGKEVDVKRA 473
              + G+++ V  A
Sbjct: 67  GIDLQGRKIRVNIA 80


>UniRef50_A0H648 Cluster: RNA-binding region RNP-1; n=3;
           Chloroflexus|Rep: RNA-binding region RNP-1 -
           Chloroflexus aggregans DSM 9485
          Length = 103

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/76 (35%), Positives = 38/76 (50%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVG L+W   D  L   F AYG++ S  V  D  TGRSRGF F+     +    +   
Sbjct: 4   KLFVGNLAWSVDDATLEQFFQAYGDVRSARVINDRETGRSRGFGFVEMDVTDVAKVISQT 63

Query: 190 GEHTINNKKVDPKKAK 237
               IN +++   +A+
Sbjct: 64  NGQPINGREIRVNEAE 79



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/76 (26%), Positives = 36/76 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L+  + D  +  FF  +G +    +  D+   + +GF F+  +   V   + +T  
Sbjct: 6   FVGNLAWSVDDATLEQFFQAYGDVRSARVINDRETGRSRGFGFVEMDVTDVAKVISQTNG 65

Query: 435 RTIGGKEVDVKRATPK 482
           + I G+E+ V  A  K
Sbjct: 66  QPINGREIRVNEAEDK 81


>UniRef50_Q3ED69 Cluster: Uncharacterized protein At1g22910.3; n=8;
           Magnoliophyta|Rep: Uncharacterized protein At1g22910.3 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 347

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + K+FVGGL+WET  + ++ HF  +GEI    V TD  +GRS+G+ F+ F+  E+     
Sbjct: 12  YTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSAC 71

Query: 184 AAGEHTINNKKVD 222
                 I+ ++ +
Sbjct: 72  VDATPVIDGRRAN 84



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 24/82 (29%), Positives = 39/82 (47%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G +T  + FVGGL+ E   + ++  F +FG ILE  +  DK   + KG+ F+TF   +  
Sbjct: 8   GDTTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAA 67

Query: 411 NDLLKTPKRTIGGKEVDVKRAT 476
                     I G+  +   A+
Sbjct: 68  RSACVDATPVIDGRRANCNLAS 89


>UniRef50_Q10RZ0 Cluster: RNA recognition motif family protein,
           expressed; n=2; Oryza sativa|Rep: RNA recognition motif
           family protein, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 110

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 28/80 (35%), Positives = 47/80 (58%), Gaps = 4/80 (5%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+   T D++LR HF  +G + S+++  D +TGR  GFAFI F   E +   +A 
Sbjct: 8   KMFVGGIGPYTGDEDLRRHFQLFGYVASVHMPIDRHTGRHHGFAFIQFTCLEHLINALAY 67

Query: 190 GE----HTINNKKVDPKKAK 237
                 HT+  + ++P+ ++
Sbjct: 68  RHTIHGHTLGTRLIEPRLSR 87



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           FVGG+     D+++R  F  FG +  V MP D+   +  GF FI F   E ++N L    
Sbjct: 10  FVGGIGPYTGDEDLRRHFQLFGYVASVHMPIDRHTGRHHGFAFIQFTCLEHLINAL--AY 67

Query: 432 KRTIGGKEVDVKRATPK 482
           + TI G  +  +   P+
Sbjct: 68  RHTIHGHTLGTRLIEPR 84


>UniRef50_A2WN71 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 490

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 26/68 (38%), Positives = 38/68 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FV GL W+ T + L + F AYGEIE + V TD  TG+ +G+ FI+F         +  
Sbjct: 157 KIFVHGLGWDATAETLTEAFSAYGEIEDLRVVTDRATGKCKGYGFILFSRRSGARAALRE 216

Query: 190 GEHTINNK 213
            +  I N+
Sbjct: 217 PQKKIGNR 224



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 2/83 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  + ++I   ++  FFS++G I E  +  DK   + KGF    +++       L+ P 
Sbjct: 270 FVSNVGADIDPQKLLQFFSKYGEIEEGPLGLDKVTGKPKGFALFVYKTLDSAKKALQEPH 329

Query: 435 RTIGGKEVDVKRAT--PKPDGPG 497
           +   G  +  ++A   PKP+  G
Sbjct: 330 KQFEGVVLHCQKAIDGPKPNKGG 352



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           K+FV  +  +   ++L   F  YGEIE   +  D  TG+ +GFA  V+K  +S  K +
Sbjct: 268 KIFVSNVGADIDPQKLLQFFSKYGEIEEGPLGLDKVTGKPKGFALFVYKTLDSAKKAL 325


>UniRef50_A7APD8 Cluster: RNA recognition motif domain containing
           protein; n=1; Babesia bovis|Rep: RNA recognition motif
           domain containing protein - Babesia bovis
          Length = 362

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 28/74 (37%), Positives = 41/74 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K FVGGL     +  L +HF  YG + +  V  D N+GRSRGF F+     E+ + +  +
Sbjct: 82  KFFVGGLHPTVDEGMLTEHFMKYGRVITAQVMRDYNSGRSRGFGFVTLYVQENTENLF-S 140

Query: 190 GEHTINNKKVDPKK 231
            EH +N K VD ++
Sbjct: 141 DEHNVNGKHVDVRR 154



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 25/78 (32%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL    +++ L+  F  +G +E + +    + G SRGF F++F    +++KV+ +
Sbjct: 166 KIFVGGLPKSLSEQMLKTFFERFGAVEKVTIMRQYD-GSSRGFGFVIFAVDGAVEKVLES 224

Query: 190 GEHTINNKKVDPKKAKAR 243
             H +   KVD + A++R
Sbjct: 225 PSHFVYGSKVDVRAAESR 242



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   +S+  ++ FF  FG + +V +   +     +GF F+ F  +  V  +L++P 
Sbjct: 168 FVGGLPKSLSEQMLKTFFERFGAVEKVTI-MRQYDGSSRGFGFVIFAVDGAVEKVLESPS 226

Query: 435 RTIGGKEVDVKRA 473
             + G +VDV+ A
Sbjct: 227 HFVYGSKVDVRAA 239



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/72 (26%), Positives = 38/72 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   + +  +   F ++G ++  ++  D    + +GF F+T   ++   +L  + +
Sbjct: 84  FVGGLHPTVDEGMLTEHFMKYGRVITAQVMRDYNSGRSRGFGFVTLYVQENTENLF-SDE 142

Query: 435 RTIGGKEVDVKR 470
             + GK VDV+R
Sbjct: 143 HNVNGKHVDVRR 154


>UniRef50_A0C337 Cluster: Chromosome undetermined scaffold_146,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_146,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 388

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV  L  E  D +L D F +YG + S  V TDP TG+S+GF F+ F   ES  K   A 
Sbjct: 286 LFVFHLPNEHKDSDLMDLFSSYGNVISARVMTDPKTGKSKGFGFVSFDKQESAQKAKEAM 345

Query: 193 E-HTINNKKV 219
           + H I+ KK+
Sbjct: 346 DGHLIDKKKL 355


>UniRef50_Q9BX46 Cluster: RNA-binding protein 24; n=52;
           Eumetazoa|Rep: RNA-binding protein 24 - Homo sapiens
           (Human)
          Length = 236

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/73 (36%), Positives = 41/73 (56%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + K+FVGGL + TTD  LR +F  +GEIE   V TD  TG+SRG+ F+      + ++  
Sbjct: 10  YTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERAC 69

Query: 184 AAGEHTINNKKVD 222
                 I+ +K +
Sbjct: 70  KDPNPIIDGRKAN 82


>UniRef50_A7QJF1 Cluster: Chromosome chr8 scaffold_106, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_106, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 332

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMA 186
           ++FVGGL W T+++ L D F  YG+I    V  + +TGR RGF FI F    ++ D +  
Sbjct: 8   RIFVGGLGWNTSERHLEDAFSRYGKILESLVMMERDTGRPRGFGFITFADHRAMEDAIRE 67

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDS 270
                ++ + +   KA+ + G   SEDS
Sbjct: 68  MHGRELDGRVISVNKAQPKMG---SEDS 92



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    S+  + + FS +G ILE  +  ++   + +GF FITF   + + D ++   
Sbjct: 10  FVGGLGWNTSERHLEDAFSRYGKILESLVMMERDTGRPRGFGFITFADHRAMEDAIREMH 69

Query: 435 -RTIGGKEVDVKRATPK 482
            R + G+ + V +A PK
Sbjct: 70  GRELDGRVISVNKAQPK 86


>UniRef50_Q4XN28 Cluster: RNA binding protein, putative; n=6;
           Plasmodium|Rep: RNA binding protein, putative -
           Plasmodium chabaudi
          Length = 369

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 24/74 (32%), Positives = 45/74 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K F+GG+    T+K + ++F  YG ++++ +  D  T R+RGFAF+   +  + DK++  
Sbjct: 104 KFFIGGIPQNITNKYISEYFEKYGPVQNVVIAQDHETKRNRGFAFVTMSSHINKDKIL-T 162

Query: 190 GEHTINNKKVDPKK 231
             H +N K+VD ++
Sbjct: 163 DSHELNGKRVDVRE 176



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 24/64 (37%), Positives = 40/64 (62%)
 Frame = +1

Query: 64  HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 243
           +F A+GEI+ + +  D ++GRSR F F+VF    S+ KV+    H I +K V+ +KA+ +
Sbjct: 229 YFSAFGEIDIVQIVVD-SSGRSRCFGFVVFTNESSVAKVLKHKRHKIYDKMVEVRKAEPK 287

Query: 244 HGKI 255
             K+
Sbjct: 288 KPKM 291



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GG+   I++  I  +F ++G +  V +  D    + +GF F+T  S  +  D + T  
Sbjct: 106 FIGGIPQNITNKYISEYFEKYGPVQNVVIAQDHETKRNRGFAFVTM-SSHINKDKILTDS 164

Query: 435 RTIGGKEVDVK 467
             + GK VDV+
Sbjct: 165 HELNGKRVDVR 175


>UniRef50_Q4QAH4 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 692

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAA 189
           LFV GL     DKEL + F  +GEIES  V  D +TGRSRG AF+ FK  E  +  V A 
Sbjct: 232 LFVCGLPVSVRDKELLELFEKHGEIESAKVMLDIHTGRSRGIAFVKFKNVEHAENAVDAL 291

Query: 190 GEHTINNKKVDPKKAKAR 243
              T+N  ++  + A +R
Sbjct: 292 NGTTVNGHQITVRVANSR 309



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 31/135 (22%), Positives = 58/135 (42%), Gaps = 2/135 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K FV  +    +   L ++F  +GE+  +++K+D   GR            +  D  +  
Sbjct: 320 KTFVRNVPLTVSRTTLFEYFAQFGEVTDLSIKSDTAQGRHNPSGRSASTTEDGADDKLNI 379

Query: 190 GEHTINNKKVDPKKAKARHGKI-LSEDSAVKSQMMKSETSSVNLE-LS*KWRCPLTKQRT 363
              T + K+   K A+A H K    E + V      +E +   +E LS + R     + T
Sbjct: 380 VFITYSTKEAAAKAAEATHTKTPFKECNGVPLLAKVAEDTVRRMERLSRRQRPATGAEGT 439

Query: 364 KERASVSSHLNLSKL 408
           +E ++ SS  N++ +
Sbjct: 440 REVSTSSSSTNVASM 454


>UniRef50_Q14011 Cluster: Cold-inducible RNA-binding protein; n=62;
           Eukaryota|Rep: Cold-inducible RNA-binding protein - Homo
           sapiens (Human)
          Length = 172

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMA 186
           KLFVGGLS++T ++ L   F  YG+I  + V  D  T RSRGF F+ F+   ++ D +MA
Sbjct: 7   KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMA 66

Query: 187 AGEHTINNKKV 219
               +++ +++
Sbjct: 67  MNGKSVDGRQI 77



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND-LLKTP 431
           FVGGLS + ++  +   FS++G I EV +  D+   + +GF F+TFE+     D ++   
Sbjct: 9   FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68

Query: 432 KRTIGGKEVDVKRATPKPD 488
            +++ G+++ V +A    D
Sbjct: 69  GKSVDGRQIRVDQAGKSSD 87


>UniRef50_UPI0000E47947 Cluster: PREDICTED: similar to GA10247-PA;
           n=4; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to GA10247-PA - Strongylocentrotus purpuratus
          Length = 519

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 26/57 (45%), Positives = 40/57 (70%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L V GL + TTD+E++++FG YGE+   +VK DP T +S+GF FI +K  +S + V+
Sbjct: 121 LIVLGLDYNTTDEEMKEYFGKYGELLMAHVKRDPVTQKSKGFGFIRYKDVDSQEGVV 177



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 3/82 (3%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KLF+G L+ +TT ++L D F  YGE+  + +         RGFAF+   + +  D+++ 
Sbjct: 205 KKLFIGRLTSDTTKEDLFDIFSKYGEVVDVFIPKP-----FRGFAFVTMNSSKDADEIV- 258

Query: 187 AGEHTI---NNKKVDPKKAKAR 243
            GE  I   N+  ++  + KAR
Sbjct: 259 -GEDLIIKGNSVYINRAEPKAR 279



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 13/44 (29%), Positives = 25/44 (56%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           GL    +D+E++ +F ++G +L   +  D    + KGF FI ++
Sbjct: 125 GLDYNTTDEEMKEYFGKYGELLMAHVKRDPVTQKSKGFGFIRYK 168


>UniRef50_UPI00005A96C6 Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP), partial; n=1; Canis lupus
           familiaris|Rep: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP), partial - Canis familiaris
          Length = 285

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 23/56 (41%), Positives = 37/56 (66%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +FVGG+  +T +   RD+F  YG+IE I + TD  + + RGFAF+ F   +S++K+
Sbjct: 230 IFVGGIKEDTEEHHPRDYFEQYGKIEVIEIMTDQGSDKKRGFAFVTFDDQDSVEKI 285



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/48 (43%), Positives = 30/48 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K F+G LS+ETTD+ LR HF  +G +    V +D NT   RG+ F+ +
Sbjct: 180 KPFIGVLSFETTDESLRSHFEQWGTLMDCVVMSDRNTKCPRGYGFVTY 227



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 16/55 (29%), Positives = 34/55 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDL 419
           FVGG+  +  +   R++F ++G I  +E+  D+  ++++GF F+TF+ +  V  +
Sbjct: 231 FVGGIKEDTEEHHPRDYFEQYGKIEVIEIMTDQGSDKKRGFAFVTFDDQDSVEKI 285



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 14/46 (30%), Positives = 30/46 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+G LS E +D+ +R+ F ++GT+++  +  D+     +G+ F+T+
Sbjct: 182 FIGVLSFETTDESLRSHFEQWGTLMDCVVMSDRNTKCPRGYGFVTY 227


>UniRef50_Q6IRQ4 Cluster: MGC82187 protein; n=6; Tetrapoda|Rep:
           MGC82187 protein - Xenopus laevis (African clawed frog)
          Length = 370

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 33/79 (41%), Positives = 45/79 (56%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLF+GGL+ ET +K L   F  YG +  + +  D  T +SRGFAF+ F++P   D  
Sbjct: 6   RPGKLFIGGLNTETNEKALEAVFCKYGRVVEVLLMKDRETNKSRGFAFVTFESP--ADAK 63

Query: 181 MAAGEHTINNKKVDPKKAK 237
            AA E  +N K +D K  K
Sbjct: 64  DAARE--LNGKALDGKPIK 80



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL++E ++  +   F ++G ++EV +  D+  N+ +GF F+TFES     D  +   
Sbjct: 11  FIGGLNTETNEKALEAVFCKYGRVVEVLLMKDRETNKSRGFAFVTFESPADAKDAARELN 70

Query: 435 -RTIGGKEVDVKRATPKP 485
            + + GK + V++AT KP
Sbjct: 71  GKALDGKPIKVEQAT-KP 87


>UniRef50_A3QQP3 Cluster: Chloroplast single strand DNA binding
           protein; n=1; Mesostigma viride|Rep: Chloroplast single
           strand DNA binding protein - Mesostigma viride
          Length = 299

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 23/56 (41%), Positives = 36/56 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           KL+VG L+W   D+ L   F  +GE+++  V  D  +GRSRGFAF+   +P++ +K
Sbjct: 91  KLYVGNLAWSCDDEMLNQAFSQFGEVKAAEVVLDRESGRSRGFAFVTMASPDAAEK 146



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 24/59 (40%), Positives = 33/59 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +L+VG L W   D  L D F  +G +    V  D ++GRSRGFAF+    PE  ++ MA
Sbjct: 205 RLYVGNLPWSMDDGMLEDLFMEFGTVNYARVVMDRDSGRSRGFAFVALSTPEEANEAMA 263



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND-LLKTP 431
           +VG L   + D  + + F EFGT+    +  D+   + +GF F+   + +  N+ +    
Sbjct: 207 YVGNLPWSMDDGMLEDLFMEFGTVNYARVVMDRDSGRSRGFAFVALSTPEEANEAMANLD 266

Query: 432 KRTIGGKEVDVKRAT 476
              IGG+ + V  AT
Sbjct: 267 GEEIGGRTIRVNLAT 281



 Score = 39.9 bits (89), Expect = 0.050
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG L+    D+ +   FS+FG +   E+  D+   + +GF F+T  S        +   
Sbjct: 93  YVGNLAWSCDDEMLNQAFSQFGEVKAAEVVLDRESGRSRGFAFVTMASPDAAEKARRGLD 152

Query: 435 RT-IGGKEVDVKRATPK 482
            T + G+ + V    PK
Sbjct: 153 GTELAGRAIRVNFPQPK 169


>UniRef50_A7SHQ6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 105

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 28/70 (40%), Positives = 38/70 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFV  L W    + L +HF  YG+I S  V  D  +GRS+ + F+ FK  E+ +K M  
Sbjct: 10  KLFVAKLPWTACRESLTEHFKQYGQILSSKVMFDLKSGRSKKYGFVFFKDEEACEKAMGN 69

Query: 190 GEHTINNKKV 219
             H I  +KV
Sbjct: 70  QPHFIEGQKV 79


>UniRef50_Q7NHK5 Cluster: RNA-binding protein; n=10; cellular
           organisms|Rep: RNA-binding protein - Gloeobacter
           violaceus
          Length = 123

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/77 (32%), Positives = 44/77 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +FVG L +  T++++ + F  YG ++S+ + TD  TGR RGFAF+     E    + +  
Sbjct: 3   VFVGNLPFSVTEQDITEAFSEYGTVKSVKIPTDRETGRPRGFAFVEMADEEEAKVIESLD 62

Query: 193 EHTINNKKVDPKKAKAR 243
             T +N+++   KA+ R
Sbjct: 63  GATWDNRQIRVNKAEPR 79



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 23/81 (28%), Positives = 43/81 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L   +++ +I   FSE+GT+  V++P D+   + +GF F+    E+    +     
Sbjct: 4   FVGNLPFSVTEQDITEAFSEYGTVKSVKIPTDRETGRPRGFAFVEMADEEEAKVIESLDG 63

Query: 435 RTIGGKEVDVKRATPKPDGPG 497
            T   +++ V +A P+P+  G
Sbjct: 64  ATWDNRQIRVNKAEPRPERSG 84


>UniRef50_A2FQN0 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 603

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/59 (42%), Positives = 38/59 (64%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           R   LFVGGL  + T+K+L + F  +G +ES  +K D +TG S+G  F+ FK+ +S +K
Sbjct: 473 RRRTLFVGGLVTDVTEKDLLNFFKQFGTVESCGIKKDKDTGLSKGMGFVCFKSIKSAEK 531



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/58 (36%), Positives = 34/58 (58%)
 Frame = +3

Query: 225 KEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           K+G S     FVGGL +++++ ++ NFF +FGT+    +  DK     KG  F+ F+S
Sbjct: 468 KQGPSRRRTLFVGGLVTDVTEKDLLNFFKQFGTVESCGIKKDKDTGLSKGMGFVCFKS 525


>UniRef50_Q0U9M6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 830

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 32/98 (32%), Positives = 50/98 (51%), Gaps = 1/98 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L++  L +E T+ ELR HF  YG +E ++V    + G+ +GFAFI FK PE        
Sbjct: 310 RLYLRNLHFEVTEDELRQHFAKYGSLEEVHVPLKKSDGKGKGFAFIQFKEPEQAVVAYDD 369

Query: 190 GEHTI-NNKKVDPKKAKARHGKILSEDSAVKSQMMKSE 300
            + TI   + +    AKA+    L+E    K  + K +
Sbjct: 370 TDGTIFQGRLLHIISAKAKKDTSLNEFEISKLPLKKQK 407



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           ++  L  E+++DE+R  F+++G++ EV +P  K+  + KGF FI F E EQ V     T 
Sbjct: 312 YLRNLHFEVTEDELRQHFAKYGSLEEVHVPLKKSDGKGKGFAFIQFKEPEQAVVAYDDTD 371

Query: 432 KRTIGGKEVDVKRATPKPD 488
                G+ + +  A  K D
Sbjct: 372 GTIFQGRLLHIISAKAKKD 390


>UniRef50_UPI000065DEA8 Cluster: RNA-binding protein 24 (RNA-binding
           motif protein 24) (RNA-binding region-containing protein
           6).; n=1; Takifugu rubripes|Rep: RNA-binding protein 24
           (RNA-binding motif protein 24) (RNA-binding
           region-containing protein 6). - Takifugu rubripes
          Length = 258

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 24/48 (50%), Positives = 33/48 (68%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           + K+FVGGL + TTD  LR +F  +G+IE   V TD  TG+SRG+ F+
Sbjct: 10  YTKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFV 57


>UniRef50_Q8LFQ5 Cluster: RNA binding protein-like; n=4; Arabidopsis
           thaliana|Rep: RNA binding protein-like - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 261

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 25/71 (35%), Positives = 41/71 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+W+T  + + DHF  YG+I    + +D  T RS+G+ F+ FK  E+  +    
Sbjct: 18  KVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFKDAEAATRACED 77

Query: 190 GEHTINNKKVD 222
               IN ++ +
Sbjct: 78  STPIINGRRAN 88



 Score = 40.7 bits (91), Expect = 0.029
 Identities = 20/74 (27%), Positives = 37/74 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+ +   + + + F ++G ILE  +  DK   + KG+ F+TF+  +      +   
Sbjct: 20  FVGGLAWDTHKEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFKDAEAATRACEDST 79

Query: 435 RTIGGKEVDVKRAT 476
             I G+  +   A+
Sbjct: 80  PIINGRRANCNLAS 93


>UniRef50_O23189 Cluster: RNA-binding like protein; n=1; Arabidopsis
           thaliana|Rep: RNA-binding like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 306

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 32/83 (38%), Positives = 47/83 (56%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L  E S D++R++F  FG I +  +P D  ++  +GF F+TF +E  V D +    
Sbjct: 187 FVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTF-AENGVADRVARRS 245

Query: 435 RTIGGKEVDVKRATPKPD-GPGA 500
             I G+EV +  ATP  + GP A
Sbjct: 246 HEICGQEVAIDSATPLDEAGPSA 268



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 26/70 (37%), Positives = 37/70 (52%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG L  E +  +LRD+FG +G I+   +  DP     RGF F+ F      D+V A 
Sbjct: 185 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRV-AR 243

Query: 190 GEHTINNKKV 219
             H I  ++V
Sbjct: 244 RSHEICGQEV 253



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           KL V G+ W+     L+D+   +G++E   V  D +TGRSRGF ++ F + E   + M
Sbjct: 4   KLVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKEEM 61



 Score = 36.3 bits (80), Expect = 0.62
 Identities = 13/60 (21%), Positives = 35/60 (58%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           G+  +I  D ++++ S+FG + +  +  D++  + +GF ++TF S +   + ++ P + +
Sbjct: 9   GIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKEEMRQPAKKV 68


>UniRef50_Q7SGB3 Cluster: Predicted protein; n=5; Eukaryota|Rep:
           Predicted protein - Neurospora crassa
          Length = 193

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/46 (56%), Positives = 30/46 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           KLFVGGLSW T D  LR  F  +G +E   V  D +TGRSRGF F+
Sbjct: 3   KLFVGGLSWNTDDNMLRAKFEEFGAVEEAVVVKDRDTGRSRGFGFV 48



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 24/81 (29%), Positives = 42/81 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS    D+ +R  F EFG + E  +  D+   + +GF F+ + ++    + +    
Sbjct: 5   FVGGLSWNTDDNMLRAKFEEFGAVEEAVVVKDRDTGRSRGFGFVRYGNDADAENAI---- 60

Query: 435 RTIGGKEVDVKRATPKPDGPG 497
             + G+EV V +A+ +  G G
Sbjct: 61  ANMDGQEVRVDKASDRAAGGG 81


>UniRef50_Q9H0Z9 Cluster: RNA-binding protein 38; n=16;
           Eutheria|Rep: RNA-binding protein 38 - Homo sapiens
           (Human)
          Length = 216

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/71 (36%), Positives = 40/71 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL + TTD  LR +F  +G+IE   V TD  TG+SRG+ F+      + ++    
Sbjct: 12  KIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD 71

Query: 190 GEHTINNKKVD 222
               I+ +K +
Sbjct: 72  PNPIIDGRKAN 82


>UniRef50_P41891 Cluster: Protein gar2; n=12; Ascomycota|Rep:
           Protein gar2 - Schizosaccharomyces pombe (Fission yeast)
          Length = 500

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 25/66 (37%), Positives = 39/66 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           + +FVG LS+  T+ +L   FG  G+I+SI + TDP +GR +GF ++ F   +S  K + 
Sbjct: 366 DTVFVGNLSFNATEDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVE 425

Query: 187 AGEHTI 204
              H I
Sbjct: 426 MNGHFI 431



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA- 189
           +FVG LSW   D+ L   F  YG I    V  D  +GRS+G+ ++ F+ PE+    +AA 
Sbjct: 265 VFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFETPEAAKAAVAAN 324

Query: 190 GEHTINNKKVD 222
           G   I+ + V+
Sbjct: 325 GTKEIDGRMVN 335



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           ++P +  + T   FVG LS  + D  +   F E+GTI+   +  D    + KG+ ++ FE
Sbjct: 253 TKPSQDSNETCTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFE 312

Query: 396 SEQVVN-DLLKTPKRTIGGKEVDVKRATPKPDGP 494
           + +     +     + I G+ V++  + P+P  P
Sbjct: 313 TPEAAKAAVAANGTKEIDGRMVNLDLSNPRPANP 346



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 21/79 (26%), Positives = 36/79 (45%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG LS   ++D++   F   G I  + +P D    + KGF ++TF         ++   
Sbjct: 369 FVGNLSFNATEDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVEMNG 428

Query: 435 RTIGGKEVDVKRATPKPDG 491
             I G+   +  +TP+  G
Sbjct: 429 HFIAGRPCRLDFSTPRTGG 447


>UniRef50_Q5EUH9 Cluster: Putative uncharacterized protein; n=1;
           Gemmata sp. Wa1-1|Rep: Putative uncharacterized protein
           - Gemmata sp. Wa1-1
          Length = 122

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 24/47 (51%), Positives = 32/47 (68%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           +KL+VG LSW  TD +L+D F  YG + S  V  D +TGRS+GF F+
Sbjct: 40  KKLYVGNLSWGVTDSQLQDMFTPYGSVVSAQVIMDRDTGRSKGFGFV 86



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 19/77 (24%), Positives = 42/77 (54%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TP 431
           +VG LS  ++D ++++ F+ +G+++  ++  D+   + KGF F+   ++Q     +    
Sbjct: 43  YVGNLSWGVTDSQLQDMFTPYGSVVSAQVIMDRDTGRSKGFGFVEMGTDQEAQAAITGMH 102

Query: 432 KRTIGGKEVDVKRATPK 482
            + I G+ + V  A PK
Sbjct: 103 GQVIEGRPLTVNEARPK 119


>UniRef50_Q9FI04 Cluster: Arabidopsis thaliana genomic DNA,
           chromosome 5, P1 clone:MGN6; n=3; Arabidopsis
           thaliana|Rep: Arabidopsis thaliana genomic DNA,
           chromosome 5, P1 clone:MGN6 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 100

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 29/78 (37%), Positives = 41/78 (52%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K++V GL W T  + L  +F  +GEI    V  D  T RS+GF F+ F+  ES  + 
Sbjct: 7   RETKIYVAGLPWITRTEGLISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRA 66

Query: 181 MAAGEHTINNKKVDPKKA 234
                HTI+ + V+ K A
Sbjct: 67  CENPNHTIDGRTVNCKLA 84



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 21/73 (28%), Positives = 35/73 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V GL      + + ++F  FG I+  ++  D    + KGF F+TF   +      + P 
Sbjct: 12  YVAGLPWITRTEGLISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPN 71

Query: 435 RTIGGKEVDVKRA 473
            TI G+ V+ K A
Sbjct: 72  HTIDGRTVNCKLA 84


>UniRef50_A2AX49 Cluster: RNA recognition motif 1; n=1; Guillardia
           theta|Rep: RNA recognition motif 1 - Guillardia theta
           (Cryptomonas phi)
          Length = 199

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 27/58 (46%), Positives = 35/58 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           KLFVGGLSWE  D++L + F  +G  E+  V  D  +GRSRGF F+ F    S  K +
Sbjct: 89  KLFVGGLSWEVDDQQLMEAFQEFGNCEA-KVMVDRYSGRSRGFGFVTFSEEHSAAKAI 145



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P +G     + FVGGLS E+ D ++   F EFG   E ++  D+   + +GF F+TF  E
Sbjct: 80  PPDGPIDPLKLFVGGLSWEVDDQQLMEAFQEFGN-CEAKVMVDRYSGRSRGFGFVTFSEE 138

Query: 402 QVVNDLLKTPK-RTIGGKEVDVKRATPK 482
                 ++    R + G+++ V  A  K
Sbjct: 139 HSAAKAIEEMNGRELLGRQITVTHARQK 166


>UniRef50_P80350 Cluster: Heterogeneous nuclear ribonucleoprotein
           A/B; n=1; Artemia salina|Rep: Heterogeneous nuclear
           ribonucleoprotein A/B - Artemia salina (Brine shrimp)
          Length = 195

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 35/74 (47%), Positives = 40/74 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVG LSWETT+K        YGEIE INVK  PN  R R FA I  K P ++D  +  
Sbjct: 35  KLFVGALSWETTEK--------YGEIEGINVK--PNLNRXRXFAXINIKTPNALDDAIKY 84

Query: 190 GEHTINNKKVDPKK 231
           G  T     +D  K
Sbjct: 85  GTITXAAVVLDKXK 98


>UniRef50_Q03251 Cluster: Glycine-rich RNA-binding protein 8; n=74;
           cellular organisms|Rep: Glycine-rich RNA-binding protein
           8 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 169

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 26/71 (36%), Positives = 41/71 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           + FVGGL+W T D++L+  F  +G++    +  D  +GRSRGF F+ FK     +K M  
Sbjct: 7   RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRD 62

Query: 190 GEHTINNKKVD 222
               +N K++D
Sbjct: 63  AIEEMNGKELD 73



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 23/82 (28%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+   +D++++  FS+FG +++ ++  D+   + +GF F+TF+ E+ + D ++   
Sbjct: 9   FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMN 68

Query: 435 -RTIGGKEVDVKRATPKPDGPG 497
            + + G+ + V  A  +  G G
Sbjct: 69  GKELDGRVITVNEAQSRGSGGG 90


>UniRef50_UPI000049A3A1 Cluster: RNA-binding protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: RNA-binding protein -
           Entamoeba histolytica HM-1:IMSS
          Length = 112

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 18/49 (36%), Positives = 39/49 (79%)
 Frame = +3

Query: 249 EDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           E ++GG++SE+++ +I   FS+FG ++++ MP++  +++ KGFCF+T++
Sbjct: 38  EIYIGGIASELNEGDIIIVFSQFGEVIDINMPWNNERDEHKGFCFLTYK 86



 Score = 37.5 bits (83), Expect = 0.27
 Identities = 14/55 (25%), Positives = 31/55 (56%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           + ++++GG++ E  + ++   F  +GE+  IN+  +      +GF F+ +K P S
Sbjct: 36  NNEIYIGGIASELNEGDIIIVFSQFGEVIDINMPWNNERDEHKGFCFLTYKDPRS 90


>UniRef50_Q7XTU5 Cluster: OSJNBb0034I13.9 protein; n=4; Oryza
           sativa|Rep: OSJNBb0034I13.9 protein - Oryza sativa
           (Rice)
          Length = 515

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG + +++  D +  +FS+FG I E  + FDKT  + KGF    ++S +     L+ P 
Sbjct: 233 FVGNVHADVDVDRLYEYFSQFGEIEEGPLGFDKTTGKPKGFALFVYKSVESARRALEEPT 292

Query: 435 RTIGGKEVDVKRA 473
           R   GK ++V++A
Sbjct: 293 RNFDGKMLNVQKA 305



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           KLFV GL W     +LR  F  +GE+E   V +D  +GRS+G+ F++F++  S
Sbjct: 115 KLFVHGLGWGAGADDLRSAFSRFGELEDCRVISDKQSGRSKGYGFVLFRSRRS 167



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 23/75 (30%), Positives = 40/75 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG +  +     L ++F  +GEIE   +  D  TG+ +GFA  V+K+ ES  + +  
Sbjct: 231 KIFVGNVHADVDVDRLYEYFSQFGEIEEGPLGFDKTTGKPKGFALFVYKSVESARRALEE 290

Query: 190 GEHTINNKKVDPKKA 234
                + K ++ +KA
Sbjct: 291 PTRNFDGKMLNVQKA 305



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/80 (31%), Positives = 38/80 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV GL      D++R+ FS FG + +  +  DK   + KG+ F+ F S +     L+ P+
Sbjct: 117 FVHGLGWGAGADDLRSAFSRFGELEDCRVISDKQSGRSKGYGFVLFRSRRSALRALRRPQ 176

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             IGG+      A   P  P
Sbjct: 177 LQIGGRLAFCHLAASGPAPP 196


>UniRef50_Q109W0 Cluster: RNA recognition motif family protein,
           expressed; n=4; Oryza sativa|Rep: RNA recognition motif
           family protein, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 317

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 23/52 (44%), Positives = 34/52 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           KLF+GG+S+ T D+ L++ F  YGE+    V  D  TGRSRGF F+ + + +
Sbjct: 32  KLFIGGISYGTDDQSLKEAFANYGEVIEARVIVDRTTGRSRGFGFVTYTSTD 83



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 15/48 (31%), Positives = 29/48 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           F+GG+S    D  ++  F+ +G ++E  +  D+T  + +GF F+T+ S
Sbjct: 34  FIGGISYGTDDQSLKEAFANYGEVIEARVIVDRTTGRSRGFGFVTYTS 81


>UniRef50_Q18724 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 114

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 24/72 (33%), Positives = 41/72 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           + +++  + W T   +L  +F  YG I+S+N+  DP+TG  RGFA I F + +  +K + 
Sbjct: 25  QTVYLTHVKWVTGKSQLEHYFKRYGSIQSVNMFYDPDTGLHRGFASITFDSKDGANKAIE 84

Query: 187 AGEHTINNKKVD 222
              H I+  +VD
Sbjct: 85  QRPHVIDGDRVD 96



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/89 (28%), Positives = 43/89 (48%)
 Frame = +3

Query: 213 ESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           E+RPK    T +   V  ++ +    ++ ++F  +G+I  V M +D      +GF  ITF
Sbjct: 17  EARPKNTGQTVYLTHVKWVTGK---SQLEHYFKRYGSIQSVNMFYDPDTGLHRGFASITF 73

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKRATP 479
           +S+   N  ++     I G  VDV+   P
Sbjct: 74  DSKDGANKAIEQRPHVIDGDRVDVEPYIP 102


>UniRef50_Q13595 Cluster: Transformer-2 protein homolog; n=57;
           Eumetazoa|Rep: Transformer-2 protein homolog - Homo
           sapiens (Human)
          Length = 282

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 32/75 (42%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LR+ F  YG +  +NV  D  TGRSRGFAF+ F   E ID    A 
Sbjct: 121 LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYF---ERIDDSKEAM 177

Query: 193 EHTINNKKVDPKKAK 237
           E   N  ++D ++ +
Sbjct: 178 ERA-NGMELDGRRIR 191



 Score = 37.5 bits (83), Expect = 0.27
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R  FS +G +  V + +D+   + +GF F+ FE    ++D  +  +R
Sbjct: 123 VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFER---IDDSKEAMER 179

Query: 438 TIGGKEVDVKR 470
              G E+D +R
Sbjct: 180 A-NGMELDGRR 189


>UniRef50_Q4T824 Cluster: Chromosome undetermined SCAF7912, whole
           genome shotgun sequence; n=3; Clupeocephala|Rep:
           Chromosome undetermined SCAF7912, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 100

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 23/75 (30%), Positives = 46/75 (61%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           +E FV  +   ++ +E++ +F +FG++ +  +PFDK     +GFC+I F SE  +N+ L+
Sbjct: 9   FEVFVSKVPWTVAGNELKEYFGQFGSVKKCLLPFDKETGFHRGFCWIGFTSEDGLNNALQ 68

Query: 426 TPKRTIGGKEVDVKR 470
             +  + G ++ V+R
Sbjct: 69  KEQHLLEGSKLQVQR 83



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 18/74 (24%), Positives = 39/74 (52%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FV  + W     EL+++FG +G ++   +  D  TG  RGF +I F + + ++  +  
Sbjct: 10  EVFVSKVPWTVAGNELKEYFGQFGSVKKCLLPFDKETGFHRGFCWIGFTSEDGLNNALQK 69

Query: 190 GEHTINNKKVDPKK 231
            +H +   K+  ++
Sbjct: 70  EQHLLEGSKLQVQR 83


>UniRef50_Q9C5A7 Cluster: Putative uncharacterized protein
           At5g08700; n=1; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein At5g08700 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 768

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 23/58 (39%), Positives = 37/58 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +LFV GL + TT++EL +HF  +G+I  +++  D +T   RG AF+++  PES    M
Sbjct: 256 RLFVHGLPYSTTEEELMEHFSKFGDISEVHLVLDKDTRSCRGMAFVLYLIPESAKMAM 313


>UniRef50_Q552K5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 699

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 22/57 (38%), Positives = 37/57 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           K+FVGG+SW+  +  L+ +F  +G +    +  D NT +S+G+ FI F+  +SI+KV
Sbjct: 104 KIFVGGISWKADENTLKTYFLQFGNVLECKIIMDYNTNKSKGYGFITFENEDSIEKV 160



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 25/79 (31%), Positives = 47/79 (59%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+S +  ++ ++ +F +FG +LE ++  D   N+ KG+ FITFE+E  + + ++T  
Sbjct: 106 FVGGISWKADENTLKTYFLQFGNVLECKIIMDYNTNKSKGYGFITFENEDSI-EKVRTSN 164

Query: 435 RTIGGKEVDVKRATPKPDG 491
               GK +++     K +G
Sbjct: 165 LLFMGKNMNIGDPVRKHNG 183


>UniRef50_Q4U8S8 Cluster: RNA-binding protein, putative; n=2;
           Theileria|Rep: RNA-binding protein, putative - Theileria
           annulata
          Length = 513

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 29/71 (40%), Positives = 37/71 (52%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K FVGGL   T + EL  HF  YG+I +  V  D  TGR RGF F+  K   +   V   
Sbjct: 128 KFFVGGLHPNTDEGELSAHFAKYGQILASQVMRDMATGRHRGFGFVTLKVQPNTMSVF-K 186

Query: 190 GEHTINNKKVD 222
             H ++ K+VD
Sbjct: 187 DTHVVSGKRVD 197



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 27/79 (34%), Positives = 44/79 (55%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGLS    ++ L+++F  +GE++ + +    + G SRGF FIVF   E     + 
Sbjct: 211 KKIFVGGLSKALNEEMLQEYFSKFGEVDKVTIMRQLD-GTSRGFGFIVFMTEEGATGSLK 269

Query: 187 AGEHTINNKKVDPKKAKAR 243
              H +   KVD + A+ R
Sbjct: 270 NPTHFVYGNKVDVRAAETR 288



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 26/77 (33%), Positives = 45/77 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS  ++++ ++ +FS+FG + +V +   +     +GF FI F +E+     LK P 
Sbjct: 214 FVGGLSKALNEEMLQEYFSKFGEVDKVTI-MRQLDGTSRGFGFIVFMTEEGATGSLKNPT 272

Query: 435 RTIGGKEVDVKRATPKP 485
             + G +VDV+ A  +P
Sbjct: 273 HFVYGNKVDVRAAETRP 289



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 22/76 (28%), Positives = 39/76 (51%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDL 419
           +T + FVGGL     + E+   F+++G IL  ++  D    + +GF F+T + +     +
Sbjct: 125 STLKFFVGGLHPNTDEGELSAHFAKYGQILASQVMRDMATGRHRGFGFVTLKVQPNTMSV 184

Query: 420 LKTPKRTIGGKEVDVK 467
            K     + GK VDV+
Sbjct: 185 FK-DTHVVSGKRVDVR 199


>UniRef50_A5K494 Cluster: Nucleic acid binding factor, putative;
           n=2; Plasmodium|Rep: Nucleic acid binding factor,
           putative - Plasmodium vivax
          Length = 753

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 2/78 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL--KT 428
           FV  L+S  + + +RN+F  FG I+++ MP D   N+ +G  F+TF     V  +L  K 
Sbjct: 666 FVTKLNSVTTIETLRNYFEAFGEIIDIYMPNDVCTNRPRGIAFVTFLDNDCVKKILSNKN 725

Query: 429 PKRTIGGKEVDVKRATPK 482
            K  I GKEV V  A P+
Sbjct: 726 SKHIIDGKEVVVDLADPE 743



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/83 (31%), Positives = 44/83 (53%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + ++FV  L +E   K+L  +F  YG+I  I V  + +  +++GF F+ F+   S+DKV+
Sbjct: 362 YPRIFVTRLPFEAGKKDLEKYFSKYGKIVDIYVSKNLSNNKNKGFGFVSFEKQSSMDKVL 421

Query: 184 AAGEHTINNKKVDPKKAKARHGK 252
               H I  K++    A  R  K
Sbjct: 422 KDKLHIICGKEIVVDVASMRDNK 444



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLFV  L+  TT + LR++F A+GEI  I +  D  T R RG AF+ F   + + K+
Sbjct: 661 RGYKLFVTKLNSVTTIETLRNYFEAFGEIIDIYMPNDVCTNRPRGIAFVTFLDNDCVKKI 720

Query: 181 MA--AGEHTINNKKV 219
           ++    +H I+ K+V
Sbjct: 721 LSNKNSKHIIDGKEV 735



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 23/74 (31%), Positives = 43/74 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  L  E    ++  +FS++G I+++ +  + + N+ KGF F++FE +  ++ +LK   
Sbjct: 366 FVTRLPFEAGKKDLEKYFSKYGKIVDIYVSKNLSNNKNKGFGFVSFEKQSSMDKVLKDKL 425

Query: 435 RTIGGKEVDVKRAT 476
             I GKE+ V  A+
Sbjct: 426 HIICGKEIVVDVAS 439


>UniRef50_A0E382 Cluster: Chromosome undetermined scaffold_76, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_76,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 315

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 30/76 (39%), Positives = 48/76 (63%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++ LFVG L++ TTDK+LR  F  YG I+SI +  D    + RG+AFI +   ES + V 
Sbjct: 145 YKTLFVGRLNYATTDKKLRKEFEEYGPIKSIRIIRDSTQDKPRGYAFIEY---ESKNSVK 201

Query: 184 AAGEHTINNKKVDPKK 231
            A ++ + +K++D +K
Sbjct: 202 QAYKYAV-DKRIDGRK 216



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK--T 428
           FVG L+   +D ++R  F E+G I  + +  D T+++ +G+ FI +ES+  V    K   
Sbjct: 149 FVGRLNYATTDKKLRKEFEEYGPIKSIRIIRDSTQDKPRGYAFIEYESKNSVKQAYKYAV 208

Query: 429 PKRTIGGK-EVDVKR 470
            KR  G K  VD++R
Sbjct: 209 DKRIDGRKLVVDIER 223


>UniRef50_UPI0000E4A86C Cluster: PREDICTED: hypothetical protein,
           partial; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: hypothetical protein, partial -
           Strongylocentrotus purpuratus
          Length = 352

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 32/75 (42%), Positives = 46/75 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GLS  TT+++LRD +  YG + ++NV  D  TGRSRGFAF++F    +     AA 
Sbjct: 116 LGVFGLSLYTTERDLRDVYEHYGTLTNVNVVYDHQTGRSRGFAFVMF---ANTGDATAAR 172

Query: 193 EHTINNKKVDPKKAK 237
           E T N  +VD ++ +
Sbjct: 173 EST-NGTEVDGRRIR 186



 Score = 35.9 bits (79), Expect = 0.82
 Identities = 20/71 (28%), Positives = 36/71 (50%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V GLS   ++ ++R+ +  +GT+  V + +D    + +GF F+ F +     D     + 
Sbjct: 118 VFGLSLYTTERDLRDVYEHYGTLTNVNVVYDHQTGRSRGFAFVMFAN---TGDATAARES 174

Query: 438 TIGGKEVDVKR 470
           T  G EVD +R
Sbjct: 175 T-NGTEVDGRR 184


>UniRef50_UPI0000E4800D Cluster: PREDICTED: similar to RNA binding
           motif protein 28; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to RNA binding motif
           protein 28 - Strongylocentrotus purpuratus
          Length = 619

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 30/104 (28%), Positives = 50/104 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LF+  + +++TD ++RD F  +GE+E   V  DP T  SRG AF+ FK  E  D  +  G
Sbjct: 194 LFIRNVPYDSTDDDIRDLFAPFGELEFARVVVDPMTEHSRGTAFVKFKRKEDADGCLHEG 253

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
           +    N ++          + +   +A K +  + +    NL L
Sbjct: 254 DAVRLNGRLLALSPAISRAEAVKLRTADKDKAKEEQKDKRNLHL 297


>UniRef50_Q9FI08 Cluster: Similarity to RNA-binding protein; n=1;
           Arabidopsis thaliana|Rep: Similarity to RNA-binding
           protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 169

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 28/75 (37%), Positives = 40/75 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K++VGGL W T  + L + F  +GEI  +NV  D  T RS+G+ F+ FK  ES  +    
Sbjct: 14  KIYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKD 73

Query: 190 GEHTINNKKVDPKKA 234
              TI  +  + K A
Sbjct: 74  PNPTIEGRITNCKLA 88



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 23/73 (31%), Positives = 38/73 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL      + + NFF  FG I+ V +  D+  ++ +G+ F+TF+  +      K P 
Sbjct: 16  YVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPN 75

Query: 435 RTIGGKEVDVKRA 473
            TI G+  + K A
Sbjct: 76  PTIEGRITNCKLA 88


>UniRef50_Q012A5 Cluster: Ps16 protein; n=2; Ostreococcus|Rep: Ps16
            protein - Ostreococcus tauri
          Length = 1094

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 27/85 (31%), Positives = 48/85 (56%)
 Frame = +1

Query: 10   KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
            +++VG LSW  TD+ L + F  + ++   +V  D  TGRSRGFAF+     E +++  AA
Sbjct: 915  RVYVGNLSWGVTDESLAELFSEF-DVRDASVMKDRETGRSRGFAFVSMNNEEDVERASAA 973

Query: 190  GEHTINNKKVDPKKAKARHGKILSE 264
                +N ++VD ++ +    +  +E
Sbjct: 974  ----LNGREVDGRELRVSKAQAQAE 994



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = +1

Query: 10   KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
            +++ G LSW     +L+D    +G +E   + TD +TGRSRGF F+        D+V+A
Sbjct: 1016 RVYFGNLSWGMDQYDLQDLCSEFGSVEDSRLITDRDTGRSRGFGFVTMSNTTEADEVVA 1074



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255  FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
            +VG LS  ++D+ +   FSEF  + +  +  D+   + +GF F++  +E+ V        
Sbjct: 917  YVGNLSWGVTDESLAELFSEF-DVRDASVMKDRETGRSRGFAFVSMNNEEDVERASAALN 975

Query: 435  -RTIGGKEVDVKRA 473
             R + G+E+ V +A
Sbjct: 976  GREVDGRELRVSKA 989


>UniRef50_Q6ZR81 Cluster: CDNA FLJ46566 fis, clone THYMU3040829,
           moderately similar to Cold- inducible RNA-binding
           protein; n=1; Homo sapiens|Rep: CDNA FLJ46566 fis, clone
           THYMU3040829, moderately similar to Cold- inducible
           RNA-binding protein - Homo sapiens (Human)
          Length = 135

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMA 186
           KLFVGGLS++T ++ L   F  YG+I  + V  D  T RSRGF F+ F+   ++ D +MA
Sbjct: 7   KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMA 66



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
           FVGGLS + ++  +   FS++G I EV +  D+   + +GF F+TFE+     D +
Sbjct: 9   FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAM 64


>UniRef50_A7TPL8 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 467

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 2/100 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +FVG + +E  ++ L  HF + GEIE + +  D  T   +GFA+I FK  +S++K +   
Sbjct: 297 IFVGNMDFEQDEETLWSHFESCGEIEYVRIIRDSKTNLGKGFAYIQFKDLQSVNKALLLN 356

Query: 193 EHTINNKKVDPK--KAKARHGKILSEDSAVKSQMMKSETS 306
           +   +N K   K   ++ ++ K  S  SA  +   K   S
Sbjct: 357 DKKFDNTKTTRKLRVSRCKNIKKPSSSSATSNNKQKLNES 396



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 19/56 (33%), Positives = 27/56 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
           FVG +  E  ++ + + F   G I  V +  D   N  KGF +I F+  Q VN  L
Sbjct: 298 FVGNMDFEQDEETLWSHFESCGEIEYVRIIRDSKTNLGKGFAYIQFKDLQSVNKAL 353


>UniRef50_Q9D8T7 Cluster: SRA stem-loop-interacting RNA-binding
           protein, mitochondrial precursor; n=6; Eutheria|Rep: SRA
           stem-loop-interacting RNA-binding protein, mitochondrial
           precursor - Mus musculus (Mouse)
          Length = 112

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 2/86 (2%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE 195
           FV  + W     ELR+HF  +G +    V  D  TG  RG  ++ F + E +   +    
Sbjct: 22  FVRKIPWTAAASELREHFAQFGHVRRCTVPFDKETGFHRGMGWVQFSSQEELQNALQQEH 81

Query: 196 HTINNKK--VDPKKAKARHGKILSED 267
           H I+  K  V  ++AKA HG   S++
Sbjct: 82  HIIDGVKIHVQAQRAKALHGAQTSDE 107



 Score = 39.5 bits (88), Expect = 0.066
 Identities = 19/76 (25%), Positives = 37/76 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  +    +  E+R  F++FG +    +PFDK     +G  ++ F S++ + + L+   
Sbjct: 22  FVRKIPWTAAASELREHFAQFGHVRRCTVPFDKETGFHRGMGWVQFSSQEELQNALQQEH 81

Query: 435 RTIGGKEVDVKRATPK 482
             I G ++ V+    K
Sbjct: 82  HIIDGVKIHVQAQRAK 97


>UniRef50_Q83D11 Cluster: RNA-binding protein; n=3; Coxiella
           burnetii|Rep: RNA-binding protein - Coxiella burnetii
          Length = 129

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 22/80 (27%), Positives = 46/80 (57%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +++++VG L +   + +L  +F  +G IES+ +  +  TGRS+G+AF+ +  P+   K +
Sbjct: 43  NDQIYVGNLPYHVVENDLHQYFSRFGAIESVKIVRNFRTGRSKGYAFVTYVTPKQAVKAL 102

Query: 184 AAGEHTINNKKVDPKKAKAR 243
            A    +  + +  + AK+R
Sbjct: 103 DAHGKDLQGRSLVVRIAKSR 122



 Score = 36.7 bits (81), Expect = 0.47
 Identities = 17/73 (23%), Positives = 38/73 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG L   + ++++  +FS FG I  V++  +    + KG+ F+T+ + +     L    
Sbjct: 47  YVGNLPYHVVENDLHQYFSRFGAIESVKIVRNFRTGRSKGYAFVTYVTPKQAVKALDAHG 106

Query: 435 RTIGGKEVDVKRA 473
           + + G+ + V+ A
Sbjct: 107 KDLQGRSLVVRIA 119


>UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2;
           cellular organisms|Rep: RNP-1 like RNA-binding protein -
           Solibacter usitatus (strain Ellin6076)
          Length = 132

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/80 (30%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           + +FVG L +  +++ +R  F  YG++ S  + TD  TGRSRGFAF+  +     D+ ++
Sbjct: 2   KNIFVGNLDFNASEEGVRSLFERYGQVNSARIMTDRETGRSRGFAFVEMENEGEADQAIS 61

Query: 187 A-GEHTINNKKVDPKKAKAR 243
           A   +T++ + ++  +A+ +
Sbjct: 62  ALNGYTLDGRALNVNEARPK 81



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L    S++ +R+ F  +G +    +  D+   + +GF F+  E+E   +  +    
Sbjct: 5   FVGNLDFNASEEGVRSLFERYGQVNSARIMTDRETGRSRGFAFVEMENEGEADQAISALN 64

Query: 435 -RTIGGKEVDVKRATPKPD 488
             T+ G+ ++V  A PKPD
Sbjct: 65  GYTLDGRALNVNEARPKPD 83


>UniRef50_A7PMT7 Cluster: Chromosome chr14 scaffold_21, whole genome
           shotgun sequence; n=11; Viridiplantae|Rep: Chromosome
           chr14 scaffold_21, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 713

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 38/115 (33%), Positives = 62/115 (53%), Gaps = 12/115 (10%)
 Frame = +3

Query: 174 QGHGCW*THHQQQESRPKEG*----STTWED-----FVGGLSSEISDDEIRNFFSE-FGT 323
           +G  C+  H + +  R K+G     S+T E+     FVGGL S +  D +   F E FG+
Sbjct: 320 RGAKCFYAHGEDELRRLKQGTRTQHSSTIEELKRKIFVGGLPSSLDTDSLAKIFEEQFGS 379

Query: 324 ILEVEMPFDKTKNQ--RKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           + E  +  D+  +Q   +GF F+ F+ E+  +D ++    TI GK+V++K A PK
Sbjct: 380 VEEAIVMGDQMGDQIHSRGFGFVIFKHEKSASDAVQAHYITIMGKQVEIKSAVPK 434



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 28/78 (35%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 10  KLFVGGL-SWETTDKELRDHFGAYGEIESINVKTDPNTGR--SRGFAFIVFKAPESIDKV 180
           K+FVGGL S   TD   +     +G +E   V  D    +  SRGF F++FK  +S    
Sbjct: 354 KIFVGGLPSSLDTDSLAKIFEEQFGSVEEAIVMGDQMGDQIHSRGFGFVIFKHEKSASDA 413

Query: 181 MAAGEHTINNKKVDPKKA 234
           + A   TI  K+V+ K A
Sbjct: 414 VQAHYITIMGKQVEIKSA 431


>UniRef50_A3AAN7 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 304

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/48 (47%), Positives = 34/48 (70%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           + K+FVGGL+WETT + LR  +  +GEI    V TD ++GRS+G+ F+
Sbjct: 36  YTKVFVGGLAWETTSERLRRFYDRFGEILEAVVITDRHSGRSKGYGFV 83



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 19/53 (35%), Positives = 32/53 (60%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           G +T  + FVGGL+ E + + +R F+  FG ILE  +  D+   + KG+ F++
Sbjct: 32  GDTTYTKVFVGGLAWETTSERLRRFYDRFGEILEAVVITDRHSGRSKGYGFVS 84


>UniRef50_Q5BXS3 Cluster: SJCHGC01369 protein; n=2; Schistosoma
           japonicum|Rep: SJCHGC01369 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 386

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/70 (38%), Positives = 39/70 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V  L W   +  LRD+F  YG++  I +K DP T +S+G+ FI F A  +   +  A 
Sbjct: 105 LIVLNLPWRADEDTLRDYFSQYGDLVMIQIKRDPVTQQSKGYGFIRF-ADYAAQVMCLAE 163

Query: 193 EHTINNKKVD 222
            HTI N++ D
Sbjct: 164 RHTIENRQCD 173



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 25/75 (33%), Positives = 40/75 (53%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           VGGL+ +IS + +R  FS++G + +V +P        + F FITF+  +V   LL   + 
Sbjct: 194 VGGLTEDISPETLRQHFSQYGRVSDVFIP-----KPFRSFAFITFDDPEVAASLLGKDQE 248

Query: 438 TIGGKEVDVKRATPK 482
            I G  + +  A PK
Sbjct: 249 -IQGVRISIGSAVPK 262



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 18/69 (26%), Positives = 38/69 (55%)
 Frame = +3

Query: 285 DDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDV 464
           +D +R++FS++G ++ +++  D    Q KG+ FI F ++     +    + TI  ++ DV
Sbjct: 116 EDTLRDYFSQYGDLVMIQIKRDPVTQQSKGYGFIRF-ADYAAQVMCLAERHTIENRQCDV 174

Query: 465 KRATPKPDG 491
           +    K +G
Sbjct: 175 RIPISKMEG 183



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 21/52 (40%), Positives = 29/52 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           K+ VGGL+ + + + LR HF  YG +  + +   P   RS  FAFI F  PE
Sbjct: 191 KVHVGGLTEDISPETLRQHFSQYGRVSDVFI---PKPFRS--FAFITFDDPE 237


>UniRef50_Q4PI99 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 640

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/58 (39%), Positives = 37/58 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  TD+ ++  F  +GEIE +++  +P TG+S+GF FI FK  E   K +
Sbjct: 403 RLYVGSLHFSLTDEAVKTVFEPFGEIEYVDLHREPETGKSKGFCFIQFKKAEDAKKAL 460



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   ++D+ ++  F  FG I  V++  +    + KGFCFI F ++E     L +  
Sbjct: 405 YVGSLHFSLTDEAVKTVFEPFGEIEYVDLHREPETGKSKGFCFIQFKKAEDAKKALEQMN 464

Query: 432 KRTIGGKEVDVKRATPKPDGPGA 500
              +  + + V     K  G G+
Sbjct: 465 GFVLADRAIRVGNVNAKGSGGGS 487


>UniRef50_A6RGV4 Cluster: Putative uncharacterized protein; n=1;
            Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized
            protein - Ajellomyces capsulatus NAm1
          Length = 1384

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 5/93 (5%)
 Frame = +1

Query: 10   KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
            ++ V  L W+ T+ +L + F AYG++E+  +    N G S+GF F+VF+A ES +  +A 
Sbjct: 1037 EIHVSNLDWKATEDDLVELFAAYGQVEAARIPRKAN-GASKGFGFVVFQAKESAEASLAM 1095

Query: 190  GEHTINNKKV-----DPKKAKARHGKILSEDSA 273
             E    ++ +      P  AK +   ILS   A
Sbjct: 1096 NEQLFRSRPLHVHISTPTAAKRQAATILSRVGA 1128


>UniRef50_Q6DHU2 Cluster: Zgc:92062; n=4; Clupeocephala|Rep:
           Zgc:92062 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 411

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 20/74 (27%), Positives = 46/74 (62%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +FVG L ++ ++  L++HF   G IE++ +  D ++G  +GF +++F++P+S+   +   
Sbjct: 254 IFVGNLPYDISELPLQNHFQECGNIEAVRLVRDRDSGMGKGFGYVLFESPDSVMLALKLN 313

Query: 193 EHTINNKKVDPKKA 234
             T+  +K+  K++
Sbjct: 314 GSTLQQRKIRVKRS 327



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 27/76 (35%), Positives = 40/76 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L  +IS+  ++N F E G I  V +  D+     KGF ++ FES   V   LK   
Sbjct: 255 FVGNLPYDISELPLQNHFQECGNIEAVRLVRDRDSGMGKGFGYVLFESPDSVMLALKLNG 314

Query: 435 RTIGGKEVDVKRATPK 482
            T+  +++ VKR+  K
Sbjct: 315 STLQQRKIRVKRSVKK 330


>UniRef50_Q1PES4 Cluster: RNA recognition motif-containing protein;
           n=2; Arabidopsis thaliana|Rep: RNA recognition
           motif-containing protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 317

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 26/80 (32%), Positives = 44/80 (55%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVG L+W TT  +LR +F  +G++   NV ++   GRS+G+ FI F+   S  + 
Sbjct: 10  RVTKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVRA 69

Query: 181 MAAGEHTINNKKVDPKKAKA 240
           +   +  I+ +  +   A A
Sbjct: 70  LQNSKPIIDGRTTNCNLASA 89



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 20/74 (27%), Positives = 37/74 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L+   + D++R +F +FG +++  +  +    + KG+ FITF         L+  K
Sbjct: 15  FVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVRALQNSK 74

Query: 435 RTIGGKEVDVKRAT 476
             I G+  +   A+
Sbjct: 75  PIIDGRTTNCNLAS 88


>UniRef50_A7PA84 Cluster: Chromosome chr14 scaffold_9, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr14 scaffold_9, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 597

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +3

Query: 249 EDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 428
           E FVGGLS  I++  IR  FS  G I+EV M  D+   + KG+CF+ F +++  N  +K 
Sbjct: 68  EVFVGGLSRTITESNIREVFSTCGEIIEVRMMTDQ-NGKSKGYCFVRFTTKEAANKAIKE 126

Query: 429 PKR-TIGGKEVDVKRAT 476
                + GK++ V  +T
Sbjct: 127 KSGFMVEGKKIGVVPST 143



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/58 (37%), Positives = 36/58 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++FVGGLS   T+  +R+ F   GEI  + + TD N G+S+G+ F+ F   E+ +K +
Sbjct: 68  EVFVGGLSRTITESNIREVFSTCGEIIEVRMMTDQN-GKSKGYCFVRFTTKEAANKAI 124


>UniRef50_Q0KHQ1 Cluster: CG33714-PA, isoform A; n=2; Diptera|Rep:
           CG33714-PA, isoform A - Drosophila melanogaster (Fruit
           fly)
          Length = 90

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 23/75 (30%), Positives = 43/75 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVG L W    +ELR +F  +G + S NV  D  TG S+G+ F+ F +  +++K+   
Sbjct: 16  RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENE 75

Query: 190 GEHTINNKKVDPKKA 234
            +H +    ++ +K+
Sbjct: 76  QKHILEGNYLNIQKS 90



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 20/73 (27%), Positives = 38/73 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L   +   E+R +F EFG ++   + FDK     KG+ F++F S   +  +    K
Sbjct: 18  FVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQK 77

Query: 435 RTIGGKEVDVKRA 473
             + G  ++++++
Sbjct: 78  HILEGNYLNIQKS 90


>UniRef50_A7SIE8 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 184

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 24/75 (32%), Positives = 45/75 (60%), Gaps = 2/75 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTI--LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 428
           F+GGL  E S+++++   +       LE++M  D+  N+ KG+CF+ F +E +V+ L   
Sbjct: 110 FIGGLKDEHSEEDVKTALAPLSPFAPLEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLV 169

Query: 429 PKRTIGGKEVDVKRA 473
               + GK+V++K+A
Sbjct: 170 RHIQVKGKDVEMKKA 184



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 7/85 (8%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHF-----GAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESI 171
           KLFVGGL+ +TT++ +R +F     G+  ++ S+++   P  G+SR F F+ F    + I
Sbjct: 12  KLFVGGLNEDTTEETVRAYFKSFCEGSEADVSSVSLAKTPE-GKSRKFCFVEFSNGSDII 70

Query: 172 DKVMAAGE-HTINNKKVDPKKAKAR 243
           D ++   E H+I+NK+V+ K+A  R
Sbjct: 71  DNIVFNFESHSIDNKQVEVKRAMPR 95



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKT--DPNTGRSRGFAFIVFKAPESID 174
           R +KLF+GGL  E ++++++           + +K   D  T + +G+ F+ F     +D
Sbjct: 105 RTKKLFIGGLKDEHSEEDVKTALAPLSPFAPLEIKMVRDRETNKFKGYCFVNFPNEHIVD 164

Query: 175 KVMAAGEHTINNKKVDPKKA 234
           K+       +  K V+ KKA
Sbjct: 165 KLYLVRHIQVKGKDVEMKKA 184


>UniRef50_UPI000065FE7B Cluster: RNA-binding protein 38 (RNA-binding
           motif protein 38) (RNA-binding region-containing protein
           1) (HSRNASEB) (ssDNA-binding protein SEB4)
           (CLL-associated antigen KW-5).; n=2; Takifugu
           rubripes|Rep: RNA-binding protein 38 (RNA-binding motif
           protein 38) (RNA-binding region-containing protein 1)
           (HSRNASEB) (ssDNA-binding protein SEB4) (CLL-associated
           antigen KW-5). - Takifugu rubripes
          Length = 287

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 22/48 (45%), Positives = 33/48 (68%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           + K+FVGGL + T D  LR +F ++G+I+   V TD  TG+SRG+ F+
Sbjct: 11  YTKIFVGGLPYHTNDASLRKYFESFGDIDEAVVITDKQTGKSRGYGFV 58



 Score = 36.3 bits (80), Expect = 0.62
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           FVGGL    +D  +R +F  FG I E  +  DK   + +G+ F++
Sbjct: 15  FVGGLPYHTNDASLRKYFESFGDIDEAVVITDKQTGKSRGYGFVS 59


>UniRef50_A0KJ75 Cluster: RNA-binding protein; n=5; Bacteria|Rep:
           RNA-binding protein - Aeromonas hydrophila subsp.
           hydrophila (strain ATCC 7966 / NCIB 9240)
          Length = 95

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 4/84 (4%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF----ESEQVVNDLL 422
           +VG LS  ++ DE+   FS+FG + +V++  D+   Q KGF FI      E+E+ +  L 
Sbjct: 7   YVGNLSYRMTADELTTVFSQFGQVDKVDIIIDRDTGQSKGFGFIEMPVNGEAEKAIAGLH 66

Query: 423 KTPKRTIGGKEVDVKRATPKPDGP 494
            T    IGG+ + V +A PK D P
Sbjct: 67  GT---EIGGRTITVNQAKPKTDAP 87



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K++VG LS+  T  EL   F  +G+++ +++  D +TG+S+GF FI        +K +A 
Sbjct: 5   KIYVGNLSYRMTADELTTVFSQFGQVDKVDIIIDRDTGQSKGFGFIEMPVNGEAEKAIAG 64

Query: 190 GEHT-INNKKVDPKKAKAR 243
              T I  + +   +AK +
Sbjct: 65  LHGTEIGGRTITVNQAKPK 83


>UniRef50_Q5JJM4 Cluster: Peptidylprolyl cis-trans isomerase-like
           protein; n=3; Eukaryota|Rep: Peptidylprolyl cis-trans
           isomerase-like protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 698

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 1/77 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV G S+ TT+++L   F  YG + S  V  D  +G SRGF F+  +  E  D  + A 
Sbjct: 619 LFVAGFSYATTERDLEKKFSKYGRVTSARVVRDKRSGDSRGFGFLSLEKDEDADAAIRAC 678

Query: 193 EHT-INNKKVDPKKAKA 240
           + T  N + +  +K+KA
Sbjct: 679 DETEWNGRIILVEKSKA 695


>UniRef50_Q8IIT2 Cluster: Nucleic acid binding factor, putative;
           n=1; Plasmodium falciparum 3D7|Rep: Nucleic acid binding
           factor, putative - Plasmodium falciparum (isolate 3D7)
          Length = 580

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 26/78 (33%), Positives = 46/78 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F   L  E S  ++  +FS+FG I+++ +  + + N+ KGF F++FE ++ +N +LK   
Sbjct: 229 FATRLPFEASKKDLEKYFSKFGKIVDIYVSRNISNNKNKGFGFVSFEKQESMNKVLKEKL 288

Query: 435 RTIGGKEVDVKRATPKPD 488
             I GKE+ V  A+ + D
Sbjct: 289 HIICGKEIVVDVASMRDD 306



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 2/79 (2%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  KLFV  L+  TT ++LR++F  +GEI  I +  D  T R RG AF+ F   ES+  +
Sbjct: 500 RGYKLFVTKLNSATTIEKLRNYFEKFGEIIDIYMPNDVYTNRPRGIAFVTFLDNESVKNI 559

Query: 181 MA--AGEHTINNKKVDPKK 231
           ++    +H I+ K+V  +K
Sbjct: 560 LSDEHSKHIIDGKEVCNRK 578



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL--KT 428
           FV  L+S  + +++RN+F +FG I+++ MP D   N+ +G  F+TF   + V ++L  + 
Sbjct: 505 FVTKLNSATTIEKLRNYFEKFGEIIDIYMPNDVYTNRPRGIAFVTFLDNESVKNILSDEH 564

Query: 429 PKRTIGGKEV 458
            K  I GKEV
Sbjct: 565 SKHIIDGKEV 574


>UniRef50_Q5BW90 Cluster: SJCHGC05136 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05136 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 184

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 30/75 (40%), Positives = 43/75 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL + TTD+ LR  F  +G I+   V TD  TG+SRG+ F+     E  D ++A 
Sbjct: 13  KIFVGGLPYHTTDESLRCFFDQFGPIDEAVVITDRQTGKSRGYGFVTMSRTE--DALLAI 70

Query: 190 GEHTINNKKVDPKKA 234
            +    N  +D +KA
Sbjct: 71  RD---PNPCIDGRKA 82



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/79 (29%), Positives = 41/79 (51%)
 Frame = +3

Query: 237 STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND 416
           +T  + FVGGL    +D+ +R FF +FG I E  +  D+   + +G+ F+T    +    
Sbjct: 9   TTLTKIFVGGLPYHTTDESLRCFFDQFGPIDEAVVITDRQTGKSRGYGFVTMSRTEDALL 68

Query: 417 LLKTPKRTIGGKEVDVKRA 473
            ++ P   I G++ +V  A
Sbjct: 69  AIRDPNPCIDGRKANVNLA 87


>UniRef50_Q553V5 Cluster: Putative uncharacterized protein; n=4;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 91

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 27/81 (33%), Positives = 46/81 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FV  L W    + L++HF  +G I+   V  D  T RS+GF F+ F++ ES+   + +
Sbjct: 5   KIFVTRLPWSVCKEALKNHFSQFGNIKDCYVVLDRVTKRSKGFGFVQFESKESVQNAINS 64

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            ++ IN +K+   +A A+  K
Sbjct: 65  -DNEINGRKLVVNEALAKDFK 84



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  L   +  + ++N FS+FG I +  +  D+   + KGF F+ FES++ V + + +  
Sbjct: 7   FVTRLPWSVCKEALKNHFSQFGNIKDCYVVLDRVTKRSKGFGFVQFESKESVQNAINSDN 66

Query: 435 RTIGGKEVDVKRATPK 482
             I G+++ V  A  K
Sbjct: 67  E-INGRKLVVNEALAK 81


>UniRef50_Q4MZK1 Cluster: Nucleic acid binding factor, putative;
           n=2; Theileria|Rep: Nucleic acid binding factor,
           putative - Theileria parva
          Length = 421

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVG +++ET+   LR +F  +GE+  + +  DP+T + +GF FI F    SI   +  
Sbjct: 339 KLFVGRIAFETSVHSLRTYFSQFGEVIDVYIPKDPHTQKGKGFGFITFANKNSIHSALDP 398

Query: 190 G-EHTINNKKV 219
             +H ++ +++
Sbjct: 399 SLKHVVDGREI 409



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           FVG ++ E S   +R +FS+FG +++V +P D    + KGF FITF ++  ++  L  + 
Sbjct: 341 FVGRIAFETSVHSLRTYFSQFGEVIDVYIPKDPHTQKGKGFGFITFANKNSIHSALDPSL 400

Query: 432 KRTIGGKEVDVKRA 473
           K  + G+E+ V  A
Sbjct: 401 KHVVDGREIIVDYA 414



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKT-KNQRKGFCFITFESEQVVNDLLKTP 431
           F+  ++ E + D++ ++F +FGT+ +   P         KGF FI+FE+E  +  + ++ 
Sbjct: 121 FITRIAFEATKDDLEDYFKKFGTVYDAYCPRQNNYSGLNKGFGFISFENEDSIRKVFESG 180

Query: 432 KRTIGGKEVDVKRAT 476
              I G+EV V RAT
Sbjct: 181 PHVIMGREVIVDRAT 195



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPN-TGRSRGFAFIVFKAPESIDKVMA 186
           ++F+  +++E T  +L D+F  +G +         N +G ++GF FI F+  +SI KV  
Sbjct: 119 RIFITRIAFEATKDDLEDYFKKFGTVYDAYCPRQNNYSGLNKGFGFISFENEDSIRKVFE 178

Query: 187 AGEHTINNKKV 219
           +G H I  ++V
Sbjct: 179 SGPHVIMGREV 189


>UniRef50_A2QQZ9 Cluster: Similarity to oligouridylate binding
           protein ubp1; n=18; Pezizomycotina|Rep: Similarity to
           oligouridylate binding protein ubp1 - Aspergillus niger
          Length = 497

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 1/102 (0%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H  +FVG LS E  D+ L   F A+G +    V  D  TGRSRG+ F+ F+     DK +
Sbjct: 183 HFHIFVGDLSNEVNDEVLLQAFSAFGSVSEARVMWDMKTGRSRGYGFVAFRERSDADKAL 242

Query: 184 AAGE-HTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETS 306
           ++ +   + ++ +    A  +    +S+  A+ +  M   T+
Sbjct: 243 SSMDGEWLGSRAIRCNWANQKGQPSISQQQAMAAMGMTPTTA 284



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/74 (29%), Positives = 38/74 (51%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           Q  S  KE  S  +  FVG LS+E++D+ +   FS FG++ E  + +D    + +G+ F+
Sbjct: 171 QSNSTNKEDTSNHFHIFVGDLSNEVNDEVLLQAFSAFGSVSEARVMWDMKTGRSRGYGFV 230

Query: 387 TFESEQVVNDLLKT 428
            F      +  L +
Sbjct: 231 AFRERSDADKALSS 244



 Score = 36.3 bits (80), Expect = 0.62
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRG--FAFIVFKAPESIDKVMA 186
           L+VGGL    T+  L+  F   G + S+ +  D N   S+G  + F+ F  P + ++ M 
Sbjct: 93  LYVGGLDPRVTEDILKQIFETTGHVVSVKIIPDKNKFNSKGYNYGFVEFDDPGAAERAM- 151

Query: 187 AGEHTINNKKV 219
               T+N +++
Sbjct: 152 ---QTLNGRRI 159



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 3/76 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKG--FCFITFESEQVVNDLLKT 428
           +VGGL   +++D ++  F   G ++ V++  DK K   KG  + F+ F+        ++T
Sbjct: 94  YVGGLDPRVTEDILKQIFETTGHVVSVKIIPDKNKFNSKGYNYGFVEFDDPGAAERAMQT 153

Query: 429 PK-RTIGGKEVDVKRA 473
              R I   E+ V  A
Sbjct: 154 LNGRRIHQSEIRVNWA 169


>UniRef50_Q08208 Cluster: Nucleolar protein 12; n=5;
           Saccharomycetales|Rep: Nucleolar protein 12 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 459

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 23/79 (29%), Positives = 43/79 (54%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +   +FVG L +E  ++ L  HF   G+IE + +  D  T   +GFA++ FK  +S++K 
Sbjct: 277 KKRSIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKA 336

Query: 181 MAAGEHTINNKKVDPKKAK 237
           +   E  + ++K + +  K
Sbjct: 337 LLLNEKPMKSQKQEDENTK 355



 Score = 35.9 bits (79), Expect = 0.82
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 3/79 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL---K 425
           FVG L  E  ++ +   F   G I  V +  D   N  KGF ++ F+  Q VN  L   +
Sbjct: 282 FVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKALLLNE 341

Query: 426 TPKRTIGGKEVDVKRATPK 482
            P ++   ++ + K+ T K
Sbjct: 342 KPMKSQKQEDENTKKPTKK 360


>UniRef50_UPI00015B48C0 Cluster: PREDICTED: similar to LOC443584
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to LOC443584 protein - Nasonia vitripennis
          Length = 518

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 24/86 (27%), Positives = 48/86 (55%), Gaps = 7/86 (8%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+G + ++ T+ E+R HF + G+IES+ +  D  +G SRG  ++ F+  +S+   +   
Sbjct: 341 VFLGNIPFDITEDEVRKHFDSCGKIESVRIVKDRKSGLSRGIGYVNFENQDSVTLALELN 400

Query: 193 EHTINNKKV-------DPKKAKARHG 249
              + N+++       +PK  K +HG
Sbjct: 401 GTNLKNREIRVQICSPEPKGKKRKHG 426



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+G +  +I++DE+R  F   G I  V +  D+     +G  ++ FE++  V   L+   
Sbjct: 342 FLGNIPFDITEDEVRKHFDSCGKIESVRIVKDRKSGLSRGIGYVNFENQDSVTLALELNG 401

Query: 435 RTIGGKEVDVKRATPKPDG 491
             +  +E+ V+  +P+P G
Sbjct: 402 TNLKNREIRVQICSPEPKG 420


>UniRef50_UPI0000E45D7B Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A3, partial; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           heterogeneous nuclear ribonucleoprotein A3, partial -
           Strongylocentrotus purpuratus
          Length = 614

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 25/83 (30%), Positives = 50/83 (60%), Gaps = 4/83 (4%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQR-KGFCFITFESEQVVNDLLKTP 431
           F+GGLS + +++ +  +F +FG + +  +   K  +++ +GF F+T+ +   V+ ++   
Sbjct: 468 FLGGLSFDTTEESVNEYFKKFGELTDCCVVRHKDGDRKPRGFGFVTYATSACVDKVIDAK 527

Query: 432 K---RTIGGKEVDVKRATPKPDG 491
           K     + G+E+DVKRA PK +G
Sbjct: 528 KDSAHVLDGREIDVKRALPKEEG 550



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 24/79 (30%), Positives = 48/79 (60%), Gaps = 4/79 (5%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K+F+GGLS++TT++ + ++F  +GE+ +   V+      + RGF F+ +     +DKV+ 
Sbjct: 466 KMFLGGLSFDTTEESVNEYFKKFGELTDCCVVRHKDGDRKPRGFGFVTYATSACVDKVID 525

Query: 187 A---GEHTINNKKVDPKKA 234
           A     H ++ +++D K+A
Sbjct: 526 AKKDSAHVLDGREIDVKRA 544



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 21/59 (35%), Positives = 39/59 (66%), Gaps = 1/59 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNT-GRSRGFAFIVFKAPESIDKVM 183
           K FVGGL+  TT ++L+ +F  YG +  +++   P+T G+ R F F+ F+  +++DK++
Sbjct: 558 KAFVGGLAPGTTAEDLKAYFTNYGVVTDVSIP--PSTEGKKRVFGFVTFEDSDTVDKLI 614


>UniRef50_Q11SF1 Cluster: RNA binding protein; n=6; Bacteria|Rep:
           RNA binding protein - Cytophaga hutchinsonii (strain
           ATCC 33406 / NCIMB 9469)
          Length = 143

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 7/86 (8%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF----KAPESIDKV 180
           +FVG L +   + ELR+ F  YGE+ S+ + +D  TGRS+GF F+       A ++ID++
Sbjct: 3   IFVGSLPFSLEENELREFFEEYGEVSSVKIISDKFTGRSKGFGFVEMPDDAAAQKAIDEL 62

Query: 181 MAA---GEHTINNKKVDPKKAKARHG 249
             A   G   + NK  + K    R G
Sbjct: 63  NGAEVNGRTIVVNKSEEKKDGPRRSG 88



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           FVG L   + ++E+R FF E+G +  V++  DK   + KGF F+    +      + +  
Sbjct: 4   FVGSLPFSLEENELREFFEEYGEVSSVKIISDKFTGRSKGFGFVEMPDDAAAQKAIDELN 63

Query: 432 KRTIGGKEVDVKRATPKPDGP 494
              + G+ + V ++  K DGP
Sbjct: 64  GAEVNGRTIVVNKSEEKKDGP 84


>UniRef50_Q015S2 Cluster: Single-stranded DNA binding protein, pu;
           n=1; Ostreococcus tauri|Rep: Single-stranded DNA binding
           protein, pu - Ostreococcus tauri
          Length = 435

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSE-FGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTP 431
           F+GG S E  +D +R  F + FG +  V++ +D+    RKG+ F+ F    V   +    
Sbjct: 85  FIGGTSHESDEDAVRAHFEKNFGPVESVKLIYDRQTMARKGYGFVKFFDVDVARKVKTLE 144

Query: 432 KRTIGGKEVDVKRAT 476
           K  I GK VDVK AT
Sbjct: 145 KLVIDGKAVDVKEAT 159



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGA-YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           R   +F+GG S E+ +  +R HF   +G +ES+ +  D  T   +G+ F+ F   +   K
Sbjct: 80  RERTVFIGGTSHESDEDAVRAHFEKNFGPVESVKLIYDRQTMARKGYGFVKFFDVDVARK 139

Query: 178 VMAAGEHTINNKKVDPKKA 234
           V    +  I+ K VD K+A
Sbjct: 140 VKTLEKLVIDGKAVDVKEA 158



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F GGL  E + + +  FFS +G +L V++ +D+     KG+ FI F ++  V +++K  +
Sbjct: 259 FCGGLPIEATPEALGWFFSHYGVVLSVKLIYDRRTGVSKGYGFIVF-ADVAVAEMVKAQR 317

Query: 435 R-TIGGKEVDVKRA 473
           +    GK +DV  A
Sbjct: 318 QMPFMGKMIDVSEA 331



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 26/80 (32%), Positives = 38/80 (47%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F GGL  E T + L   F  YG + S+ +  D  TG S+G+ FIVF      + V A  
Sbjct: 258 VFCGGLPIEATPEALGWFFSHYGVVLSVKLIYDRRTGVSKGYGFIVFADVAVAEMVKAQR 317

Query: 193 EHTINNKKVDPKKAKARHGK 252
           +     K +D  +A    G+
Sbjct: 318 QMPFMGKMIDVSEAMRHVGR 337


>UniRef50_Q5KP81 Cluster: Transformer-2-beta isoform 3, putative;
           n=2; Filobasidiella neoformans|Rep: Transformer-2-beta
           isoform 3, putative - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 277

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 25/51 (49%), Positives = 34/51 (66%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L V GLS  TT+++L+D F  +GEIE + +  D  TGRSRGF FI  ++ E
Sbjct: 127 LGVFGLSVRTTERDLQDEFSRHGEIEKVVIVYDQRTGRSRGFGFITMRSIE 177



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPK 434
           V GLS   ++ ++++ FS  G I +V + +D+   + +GF FIT  S E     + K   
Sbjct: 129 VFGLSVRTTERDLQDEFSRHGEIEKVVIVYDQRTGRSRGFGFITMRSIEDATQCINKLNG 188

Query: 435 RTIGGKEVDVK-RATPKPDGP 494
            TI G+ + V   ATPKP  P
Sbjct: 189 FTIHGRNIRVDYSATPKPHDP 209


>UniRef50_Q4S5L6 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 9 SCAF14729, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 252

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 22/47 (46%), Positives = 33/47 (70%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAF 144
           + K+FVGGL + T+D  LR +F ++G+I+   V TD  TG+SRG+ F
Sbjct: 8   YTKIFVGGLPYHTSDASLRGYFQSFGDIDEAVVITDKQTGKSRGYGF 54



 Score = 35.9 bits (79), Expect = 0.82
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           FVGGL    SD  +R +F  FG I E  +  DK   + +G+ F
Sbjct: 12  FVGGLPYHTSDASLRGYFQSFGDIDEAVVITDKQTGKSRGYGF 54


>UniRef50_Q01L95 Cluster: OSIGBa0137L20.5 protein; n=7; Oryza
           sativa|Rep: OSIGBa0137L20.5 protein - Oryza sativa
           (Rice)
          Length = 137

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 23/57 (40%), Positives = 35/57 (61%)
 Frame = +3

Query: 243 TWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVN 413
           T+  F+GGLS   ++D +   FS++G +LE  +  DK  N+ KGF F+ F SE+  N
Sbjct: 36  TYRLFIGGLSQFATEDSLAEAFSQYGQVLEATIVTDKMTNRPKGFGFVKFASEEAAN 92



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +LF+GGLS   T+  L + F  YG++    + TD  T R +GF F+ F + E+ +K    
Sbjct: 38  RLFIGGLSQFATEDSLAEAFSQYGQVLEATIVTDKMTNRPKGFGFVKFASEEAANKAKEE 97

Query: 190 GEHTINNKK---VDPKKAK 237
               + N +   VD  KAK
Sbjct: 98  MNGKVLNGRVIYVDIAKAK 116


>UniRef50_Q5I705 Cluster: Transformer 2; n=2; Endopterygota|Rep:
           Transformer 2 - Musca domestica (House fly)
          Length = 232

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 26/48 (54%), Positives = 31/48 (64%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           L V GLS  TT +++R+ F  YG IE I V  D  TGRSRGF FI +K
Sbjct: 99  LGVFGLSVHTTQQQIREIFSKYGPIERIQVVVDAQTGRSRGFCFIYYK 146



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           V GLS   +  +IR  FS++G I  +++  D    + +GFCFI ++
Sbjct: 101 VFGLSVHTTQQQIREIFSKYGPIERIQVVVDAQTGRSRGFCFIYYK 146


>UniRef50_Q32P59 Cluster: SRA stem-loop-interacting RNA-binding
           protein, mitochondrial precursor; n=5;
           Laurasiatheria|Rep: SRA stem-loop-interacting
           RNA-binding protein, mitochondrial precursor - Bos
           taurus (Bovine)
          Length = 111

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 2/86 (2%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE 195
           FV  + W     ELR+HF  +G +    V  D  TG  +G  +I F + E +   +    
Sbjct: 22  FVRKIPWTAASSELREHFAQFGHVRKCTVPFDKETGFHKGMGWIHFSSEEELHNALQQEN 81

Query: 196 HTINNKK--VDPKKAKARHGKILSED 267
           H I+  K  V P++ KA  G   S++
Sbjct: 82  HVIDGVKLHVQPQRPKALQGDQTSDE 107



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 23/76 (30%), Positives = 40/76 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  +    +  E+R  F++FG + +  +PFDK     KG  +I F SE+ +++ L+   
Sbjct: 22  FVRKIPWTAASSELREHFAQFGHVRKCTVPFDKETGFHKGMGWIHFSSEEELHNALQQEN 81

Query: 435 RTIGGKEVDVKRATPK 482
             I G ++ V+   PK
Sbjct: 82  HVIDGVKLHVQPQRPK 97


>UniRef50_A6GJJ1 Cluster: Probable nucleic acid-binding protein;
           n=1; Plesiocystis pacifica SIR-1|Rep: Probable nucleic
           acid-binding protein - Plesiocystis pacifica SIR-1
          Length = 155

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 24/58 (41%), Positives = 32/58 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +LFVGGLSW+T    LR+ F   G +    + TD +TG SRGF F+     +   K M
Sbjct: 77  RLFVGGLSWDTESDSLRELFAKVGAVVDAMIVTDRDTGDSRGFGFVTMANRKDATKAM 134



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS +   D +R  F++ G +++  +  D+     +GF F+T  + +   D  K  K
Sbjct: 79  FVGGLSWDTESDSLRELFAKVGAVVDAMIVTDRDTGDSRGFGFVTMANRK---DATKAMK 135

Query: 435 RTIGGKEVD 461
             +GG E+D
Sbjct: 136 E-LGGTELD 143


>UniRef50_Q9LES2 Cluster: Putative uncharacterized protein
           T8M16_190; n=3; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein T8M16_190 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 478

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 22/52 (42%), Positives = 33/52 (63%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           H K+FV GL W+T  + L + F  YGEIE      D  +G+S+G+ FI++K+
Sbjct: 139 HRKIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V  + +E+   ++  FFS+FG I E  +  DK   + KGFC   ++S +     L+ P 
Sbjct: 248 YVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPH 307

Query: 435 RTIGGKEVDVKRAT--PKP 485
           +T  G  +  ++A   PKP
Sbjct: 308 KTFEGHILHCQKAIDGPKP 326



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 24/82 (29%), Positives = 41/82 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV GL  +   + +   F ++G I + +  FDK   + KG+ FI ++S     + LK P+
Sbjct: 143 FVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQ 202

Query: 435 RTIGGKEVDVKRATPKPDGPGA 500
           + IG +    + A+  P   GA
Sbjct: 203 KKIGSRMTACQLASKGPVFGGA 224



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 22/76 (28%), Positives = 37/76 (48%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K++V  +  E   ++L   F  +GEIE   +  D  TGR +GF   V+K+ ES  + + 
Sbjct: 245 KKIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALE 304

Query: 187 AGEHTINNKKVDPKKA 234
               T     +  +KA
Sbjct: 305 EPHKTFEGHILHCQKA 320


>UniRef50_O24306 Cluster: Ribonucleoprotein; n=3; Pisum sativum|Rep:
           Ribonucleoprotein - Pisum sativum (Garden pea)
          Length = 291

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 23/60 (38%), Positives = 34/60 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +++VG LSWE  D  L   F  +G++ S  V  D  TGRSRGF F+     + ++  +AA
Sbjct: 207 RVYVGNLSWELDDSRLEQVFSEHGKVVSARVVYDRETGRSRGFGFVTMSDEKEMNDAIAA 266



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/94 (26%), Positives = 46/94 (48%), Gaps = 1/94 (1%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           ++E RP          +VG LS E+ D  +   FSE G ++   + +D+   + +GF F+
Sbjct: 193 EREERPPRTFEPVLRVYVGNLSWELDDSRLEQVFSEHGKVVSARVVYDRETGRSRGFGFV 252

Query: 387 TFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKP 485
           T   E+ +ND +     + + G+ + V  A  +P
Sbjct: 253 TMSDEKEMNDAIAALDGQILEGRTIKVSVAEDRP 286



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           FVG L  ++  +++   F   GT+   E+ +++  +Q +GF F+T  + E+      K  
Sbjct: 112 FVGNLPYDVDSEKLAMLFEPAGTVEIAEVIYNRETDQSRGFGFVTMSTVEEAEAGAAKFN 171

Query: 432 KRTIGGKEVDVKRATPKPDGP 494
           +    G+ + V +A P+   P
Sbjct: 172 RYDYNGRPLTVNKAAPRGSRP 192



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVG L ++   ++L   F   G +E   V  +  T +SRGF F+     E  +   A 
Sbjct: 110 KLFVGNLPYDVDSEKLAMLFEPAGTVEIAEVIYNRETDQSRGFGFVTMSTVEEAEAGAAK 169

Query: 190 -GEHTINNKKVDPKKAKAR 243
              +  N + +   KA  R
Sbjct: 170 FNRYDYNGRPLTVNKAAPR 188


>UniRef50_A7NXI6 Cluster: Chromosome chr5 scaffold_2, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_2, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 283

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 23/58 (39%), Positives = 30/58 (51%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           KLFVG LSW  T + L   F  YG +    V  D  TGRSRG+ F+ +     +D  +
Sbjct: 203 KLFVGNLSWSVTSESLNQVFQEYGNVIGARVLYDGETGRSRGYGFVCYSTKAEMDTAL 260



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 20/58 (34%), Positives = 30/58 (51%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           KL+ G L +     +L      YG  E + V  + +TGRSRGFAF+   + E  + V+
Sbjct: 112 KLYFGNLPYSCDSAQLAGIIQNYGSPELVEVLYNRDTGRSRGFAFVTMSSVEDCNAVI 169



 Score = 36.7 bits (81), Expect = 0.47
 Identities = 13/63 (20%), Positives = 35/63 (55%)
 Frame = +3

Query: 240 TTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDL 419
           T ++ FVG LS  ++ + +   F E+G ++   + +D    + +G+ F+ + ++  ++  
Sbjct: 200 TEYKLFVGNLSWSVTSESLNQVFQEYGNVIGARVLYDGETGRSRGYGFVCYSTKAEMDTA 259

Query: 420 LKT 428
           L++
Sbjct: 260 LES 262


>UniRef50_Q8IE99 Cluster: Splicing factor, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Splicing factor, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 864

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 31/107 (28%), Positives = 56/107 (52%), Gaps = 4/107 (3%)
 Frame = +1

Query: 10  KLFVGGLSW---ETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDK 177
           KL++GGL       T++EL+  F  +G+I  + +  DP TG+S+GF FI F KA E+I+ 
Sbjct: 587 KLYIGGLLGPLSNITEQELKQLFNPFGDILDVEIHRDPYTGKSKGFGFIQFHKASEAIEA 646

Query: 178 VMAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNL 318
           +       +  +++  K   A+  K L      +  ++K +  + N+
Sbjct: 647 LTVMNGMEVAGREI--KVGYAQDSKYLLACDNTQENILKQQQMAKNI 691


>UniRef50_Q5D9L3 Cluster: SJCHGC09366 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC09366 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 324

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 28/56 (50%), Positives = 33/56 (58%)
 Frame = +1

Query: 25  GLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           GLS  T ++ L D    YGEIE I V  D  +GRSRGFAFI F++ ES     A G
Sbjct: 120 GLSMRTEERHLYDIMKKYGEIEEIKVVQDNLSGRSRGFAFIYFRSIESARSARADG 175


>UniRef50_A2EKZ8 Cluster: Putative uncharacterized protein; n=2;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 220

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 26/78 (33%), Positives = 44/78 (56%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 198
           +G L +E T+ +L++ FG YGE+    + T+P  GRSRG+ F+ F   E   K +     
Sbjct: 33  IGNLPFEYTEAKLKEIFGKYGEVLDSKIPTNP-AGRSRGYGFVSFALKEDAQKAV----D 87

Query: 199 TINNKKVDPKKAKARHGK 252
            +NNK+++ +K +    K
Sbjct: 88  ELNNKEMEGRKVEVAFAK 105


>UniRef50_Q6BQ88 Cluster: Debaryomyces hansenii chromosome E of
           strain CBS767 of Debaryomyces hansenii; n=3;
           Saccharomycetaceae|Rep: Debaryomyces hansenii chromosome
           E of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 183

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 20/55 (36%), Positives = 35/55 (63%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +H +LFVG L  + TD+ L + FG Y  +  + V  D  TG+++G+ F+ F++P+
Sbjct: 84  KHFRLFVGNLGTDATDELLANAFGKYKTLSKVKVPMDNKTGKNKGYGFVAFESPD 138



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L ++ +D+ + N F ++ T+ +V++P D    + KG+ F+ FES        K   
Sbjct: 89  FVGNLGTDATDELLANAFGKYKTLSKVKVPMDNKTGKNKGYGFVAFESPDDYFQAFKDMN 148

Query: 435 -RTIGGKEVDVKRA 473
            + IG   V +KRA
Sbjct: 149 GKYIGQHPVQLKRA 162


>UniRef50_Q15414 Cluster: RNA-binding motif protein, Y chromosome,
           family 1 member A1; n=37; Homo/Pan/Gorilla group|Rep:
           RNA-binding motif protein, Y chromosome, family 1 member
           A1 - Homo sapiens (Human)
          Length = 496

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 33/81 (40%), Positives = 45/81 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GGL+ ET +K L+  FG +G I  + +  D  T +SRGFAFI F+ P   D   AA
Sbjct: 9   KLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKD-RTSKSRGFAFITFENP--ADAKNAA 65

Query: 190 GEHTINNKKVDPKKAKARHGK 252
            +  +N K +  K  K    K
Sbjct: 66  KD--MNGKSLHGKAIKVEQAK 84



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/74 (33%), Positives = 42/74 (56%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E ++  ++  F + G I EV +  D+T   R GF FITFE+     +  K   
Sbjct: 11  FIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSR-GFAFITFENPADAKNAAKDMN 69

Query: 435 -RTIGGKEVDVKRA 473
            +++ GK + V++A
Sbjct: 70  GKSLHGKAIKVEQA 83


>UniRef50_Q14498 Cluster: RNA-binding protein 39; n=55;
           Euteleostomi|Rep: RNA-binding protein 39 - Homo sapiens
           (Human)
          Length = 530

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 31/105 (29%), Positives = 50/105 (47%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L+VG L +  T+  LR  F  +G IESI +  D  TGRS+G+ FI F   E   K +  
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKAL-- 308

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
               +N  ++  +  K  H    ++ S+  S +   E     ++L
Sbjct: 309 --EQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDL 351



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++D +R  F  FG I  +++  D    + KG+ FITF +SE     L +  
Sbjct: 253 YVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312

Query: 432 KRTIGGKEVDVKRATPKPDGPGA 500
              + G+ + V   T + D   A
Sbjct: 313 GFELAGRPMKVGHVTERTDASSA 335


>UniRef50_UPI0000DB7056 Cluster: PREDICTED: similar to RNA binding
           motif protein 34; n=1; Apis mellifera|Rep: PREDICTED:
           similar to RNA binding motif protein 34 - Apis mellifera
          Length = 277

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 1/123 (0%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           + +F+G L +   D  +  HF   GEIES+ V  D  TG  +GF ++ FK  +++   + 
Sbjct: 116 KSIFLGNLHYNIDDNTIIKHFKQCGEIESVRVIRDNKTGVGKGFGYVNFKNEDAVTLALE 175

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSV-NLELS*KWRCPLTKQRT 363
               TI+N++V  K    ++ K   +D   K       T +V + +L      P +KQ  
Sbjct: 176 LDGTTISNREVRVKPVVDQYKK--KKDKYRKRSHSTENTQTVSHKKLKNDIEVPASKQTN 233

Query: 364 KER 372
            ++
Sbjct: 234 SQQ 236



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 24/71 (33%), Positives = 34/71 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+G L   I D+ I   F + G I  V +  D      KGF ++ F++E  V   L+   
Sbjct: 119 FLGNLHYNIDDNTIIKHFKQCGEIESVRVIRDNKTGVGKGFGYVNFKNEDAVTLALELDG 178

Query: 435 RTIGGKEVDVK 467
            TI  +EV VK
Sbjct: 179 TTISNREVRVK 189


>UniRef50_Q1LV83 Cluster: Novel protein; n=4; Danio rerio|Rep: Novel
           protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 865

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 30/107 (28%), Positives = 58/107 (54%), Gaps = 2/107 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+  LS+++ ++ L +    +GE+  + V  +P+TG S+G AF  FK+ E+ +K +AA 
Sbjct: 441 IFIRNLSFDSEEEGLEEVLLQFGELSYVRVVMNPDTGVSKGCAFAQFKSKEAAEKCIAAA 500

Query: 193 --EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLELS 327
             E   +  K+D ++          + +  K + +K+ T S NL L+
Sbjct: 501 LDEKEFSGIKLDGRRLNILMAINRDDAAKFKDKKVKTHTGSRNLYLA 547



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/46 (41%), Positives = 30/46 (65%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           +  LS +  DDE++  FS+FGT+LE  +P  K   ++KGF F+ F+
Sbjct: 128 IRNLSFKCEDDELKQIFSKFGTVLETRIPL-KPDGKKKGFAFVQFK 172



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 17/46 (36%), Positives = 31/46 (67%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           +  LS +  +D+++  FSEFGT+LE ++P  K   +++GF F+ F+
Sbjct: 240 IRNLSFKCEEDDLKQIFSEFGTVLEAKIPL-KPDGKKRGFAFVLFK 284



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 29/105 (27%), Positives = 54/105 (51%), Gaps = 1/105 (0%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMA 186
           +L +  LS++  + +L+  F  +G +    +   P+ G+ RGFAF++FK  PE+   + A
Sbjct: 237 RLIIRNLSFKCEEDDLKQIFSEFGTVLEAKIPLKPD-GKKRGFAFVLFKRMPEAGKALTA 295

Query: 187 AGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLE 321
                I +++V    A A+  K L+  SA  +  +K E  +  +E
Sbjct: 296 MNGKKIKDRQVAVDWAIAK-DKYLATQSASAAGNIKEENVTGKVE 339



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           L +  LS++  D EL+  F  +G +    +   P+ G+ +GFAF+ FK     +K  AA
Sbjct: 126 LIIRNLSFKCEDDELKQIFSKFGTVLETRIPLKPD-GKKKGFAFVQFKCVSEAEKARAA 183


>UniRef50_Q1IV44 Cluster: RNA-binding protein, RNP-1; n=2;
           Bacteria|Rep: RNA-binding protein, RNP-1 - Acidobacteria
           bacterium (strain Ellin345)
          Length = 107

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 26/87 (29%), Positives = 50/87 (57%), Gaps = 6/87 (6%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF----KAPESID 174
           +K+FVG  ++  T+ ++R  F  YG+++S+++ TD +TGR+RGF F+      +A  +I+
Sbjct: 2   KKIFVGNFAFTATEDDIRQLFTPYGKVDSVSLVTDRDTGRARGFGFVEMPNDTEAAAAIE 61

Query: 175 KVMA--AGEHTINNKKVDPKKAKARHG 249
            +    +G   +N  +  PK  +   G
Sbjct: 62  GLNGRDSGGRALNVNEARPKTERGNSG 88



 Score = 40.7 bits (91), Expect = 0.029
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE-QVVNDLLKTP 431
           FVG  +   ++D+IR  F+ +G +  V +  D+   + +GF F+   ++ +    +    
Sbjct: 5   FVGNFAFTATEDDIRQLFTPYGKVDSVSLVTDRDTGRARGFGFVEMPNDTEAAAAIEGLN 64

Query: 432 KRTIGGKEVDVKRATPKPD 488
            R  GG+ ++V  A PK +
Sbjct: 65  GRDSGGRALNVNEARPKTE 83


>UniRef50_A7CQC8 Cluster: RNP-1 like RNA-binding protein; n=1;
           Opitutaceae bacterium TAV2|Rep: RNP-1 like RNA-binding
           protein - Opitutaceae bacterium TAV2
          Length = 106

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           + KL+VG LS+ T++ +LR  F   G +  + + TD  TGR RGFAF+ F   E
Sbjct: 2   NSKLYVGNLSFNTSEADLRTAFSTCGTLTDVFLATDRETGRPRGFAFVTFDTAE 55



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VG LS   S+ ++R  FS  GT+ +V +  D+   + +GF F+TF+ +E+      K  
Sbjct: 6   YVGNLSFNTSEADLRTAFSTCGTLTDVFLATDRETGRPRGFAFVTFDTAEESQLATEKLN 65

Query: 432 KRTIGGKEVDVKRATPK 482
              +GG+ + V  A PK
Sbjct: 66  GTDLGGRAITVNEARPK 82


>UniRef50_Q4Q941 Cluster: Putative uncharacterized protein; n=5;
           Trypanosomatidae|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 218

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 26/55 (47%), Positives = 35/55 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           KLFVG L +E T++ LR+ F AYG +E I++  D N+ RSRG AFI     +  D
Sbjct: 102 KLFVGQLPFECTEERLRNLFSAYGNVEHIHILRD-NSNRSRGAAFITLSTVQEAD 155



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 201 HQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFC 380
           H  Q+ +PK   ST  + FVG L  E +++ +RN FS +G +  + +  D + N+ +G  
Sbjct: 87  HSIQQQQPKLS-STAAKLFVGQLPFECTEERLRNLFSAYGNVEHIHILRDNS-NRSRGAA 144

Query: 381 FITFESEQVVNDLLKT 428
           FIT  + Q  +  + T
Sbjct: 145 FITLSTVQEADTAIFT 160


>UniRef50_Q4H2Q6 Cluster: Ci-Tardbp protein; n=1; Ciona
           intestinalis|Rep: Ci-Tardbp protein - Ciona intestinalis
           (Transparent sea squirt)
          Length = 440

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 26/72 (36%), Positives = 43/72 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL W+  + +L+++F  YGE+  + VK D N G+SRG+ FI F + E + +++ + 
Sbjct: 141 LIVLGLPWKIAEDDLKEYFAKYGELVMVLVKRDEN-GKSRGYGFIRFSSYE-VQELVLSQ 198

Query: 193 EHTINNKKVDPK 228
            H I  +  D K
Sbjct: 199 RHIIGERWCDVK 210



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 24/76 (31%), Positives = 40/76 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG ++ +++ DEIR +F +FG + +V +P        + F F+TF    V  +L+    
Sbjct: 226 FVGRITEKMTKDEIRQYFEQFGDVDDVYIPI-----PFRAFAFVTFRDSNVAANLI-GED 279

Query: 435 RTIGGKEVDVKRATPK 482
           + I G  V +  A PK
Sbjct: 280 QVINGVSVYINTADPK 295



 Score = 32.7 bits (71), Expect = 7.6
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 5/81 (6%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG ++ + T  E+R +F  +G+++ + +         R FAF+ F+   ++   +  
Sbjct: 224 KIFVGRITEKMTKDEIRQYFEQFGDVDDVYIPIP-----FRAFAFVTFR-DSNVAANLIG 277

Query: 190 GEHTINNKKV-----DPKKAK 237
            +  IN   V     DPK +K
Sbjct: 278 EDQVINGVSVYINTADPKGSK 298


>UniRef50_Q75AJ0 Cluster: ADL063Wp; n=1; Eremothecium gossypii|Rep:
           ADL063Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 320

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 22/55 (40%), Positives = 35/55 (63%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           +FVG L ++  + EL+ HF  +GEIE + +  D  T + RG+AF++F+ PE   K
Sbjct: 109 IFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKK 163



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 16/50 (32%), Positives = 28/50 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           FVG L  ++ + E++  F +FG I  V +  DK  N+ +G+ F+ F   +
Sbjct: 110 FVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPE 159


>UniRef50_Q2GTP8 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 250

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 2/78 (2%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +  +FVG + + T+ +EL+ HF + G I  + +  D  TG+ +G+A++ F  P  + + +
Sbjct: 126 NRSIFVGNVDYSTSPEELQAHFQSCGSINRVTILLDKFTGQPKGYAYVEFSEPNLVAQAL 185

Query: 184 AAGEHTI--NNKKVDPKK 231
              +      N KV+PK+
Sbjct: 186 VLNDSVFKGRNIKVEPKR 203



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 19/71 (26%), Positives = 32/71 (45%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG +    S +E++  F   G+I  V +  DK   Q KG+ ++ F    +V   L    
Sbjct: 130 FVGNVDYSTSPEELQAHFQSCGSINRVTILLDKFTGQPKGYAYVEFSEPNLVAQALVLND 189

Query: 435 RTIGGKEVDVK 467
               G+ + V+
Sbjct: 190 SVFKGRNIKVE 200


>UniRef50_Q5KBW2 Cluster: Polyadenylate-binding protein, cytoplasmic
           and nuclear (Poly(A)- binding protein); n=2;
           Eukaryota|Rep: Polyadenylate-binding protein,
           cytoplasmic and nuclear (Poly(A)- binding protein) -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 673

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAA 189
           +F+  L     +K L D F A+G+I S  V TD N G+SRGFAF+ +   E+ D  + A 
Sbjct: 136 IFIKNLDQSIDNKALHDTFAAFGDILSCKVGTDEN-GKSRGFAFVHYSTGEAADAAIKAV 194

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLELS 327
               +N+KKV       +  + LS+   +++Q       +V+LE++
Sbjct: 195 NGMLLNDKKVYVGHHVGKKER-LSKVEELRAQFTNVYIKNVDLEVT 239



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 22/58 (37%), Positives = 32/58 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           L+V  L  E  D  LR  F A+G I S  V  D ++G SRGF F+ + +P+   K ++
Sbjct: 332 LYVKNLDDEWDDDRLRAEFEAFGTITSSKVMRD-DSGVSRGFGFVCYSSPDEATKAVS 388


>UniRef50_Q4RJP2 Cluster: Chromosome 13 SCAF15035, whole genome
           shotgun sequence; n=2; Euteleostomi|Rep: Chromosome 13
           SCAF15035, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 720

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 2/107 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+  LS++T ++EL      +GE+  + +   P T  S+G AF  F++ ES DK +AA 
Sbjct: 312 IFIRNLSFDTEEEELEKVLLQFGELNYVKIVIQPETEHSKGCAFAQFRSKESADKCIAAA 371

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAV--KSQMMKSETSSVNLELS 327
           +    +  +     K      +S++ AV  K   +K ET + NL L+
Sbjct: 372 QVDSESGGIRVDGRKLFIVTAVSKEDAVKLKENKVKVETGTRNLYLA 418



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +3

Query: 267 LSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTI 443
           LS + S+++++   S+FG ILE ++P  K   + +GF F+ F++       L     + I
Sbjct: 113 LSFQCSENDLKQVCSKFGPILEAKIPL-KPDGKMRGFAFVQFKNMSSAAKALNGLNMKEI 171

Query: 444 GGKEVDVKRATPK 482
            G++V V  A PK
Sbjct: 172 KGRQVAVDWAVPK 184



 Score = 33.5 bits (73), Expect = 4.4
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L    LS++ ++ +L+     +G I    +   P+ G+ RGFAF+ FK   S  K +
Sbjct: 107 RLIFRNLSFQCSENDLKQVCSKFGPILEAKIPLKPD-GKMRGFAFVQFKNMSSAAKAL 163


>UniRef50_Q9SIX3 Cluster: Putative glycine-rich RNA-binding protein;
           n=1; Arabidopsis thaliana|Rep: Putative glycine-rich
           RNA-binding protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 185

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 171
           + FVGGL+W T ++ +   F  +GE+    +  D  TGRS+GF F+ FK  +S+
Sbjct: 45  RCFVGGLAWATDEQSIERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSM 98



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 26/81 (32%), Positives = 44/81 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+    +  I   F+EFG + + ++  D+   + KGF F+TF+ E    D ++T  
Sbjct: 47  FVGGLAWATDEQSIERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDE----DSMRTAI 102

Query: 435 RTIGGKEVDVKRATPKPDGPG 497
             + G+E+D +  T +  G G
Sbjct: 103 DRMNGQELDGRNITAQARGSG 123


>UniRef50_A7QX84 Cluster: Chromosome undetermined scaffold_215,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_215, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 273

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/76 (32%), Positives = 42/76 (55%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL    T++  R +F A+  +  + V  D +  R  GF F+ F   + +D+V+ 
Sbjct: 115 KKIFVGGLPPALTEEGFRQYFEAFSNVTDVVVMYDQSIQRPCGFRFVSFDIEDVVDRVLY 174

Query: 187 AGEHTINNKKVDPKKA 234
              H +N K+V+ K A
Sbjct: 175 KTFHDLNGKQVEVKWA 190



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 23/72 (31%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGLS    ++  R +F A+G +  + V  D +  R RGF F+ F   + +++V+  
Sbjct: 10  KIFVGGLSPALIEEGFRQYFEAFGHVTDLVVMYDQSIQRPRGFGFVSFDTEDLVNRVLYK 69

Query: 190 GEHTIN-NKKVD 222
             H +N ++++D
Sbjct: 70  TFHDLNVSRRLD 81



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 19/56 (33%), Positives = 38/56 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
           FVGGLS  + ++  R +F  FG + ++ + +D++  + +GF F++F++E +VN +L
Sbjct: 12  FVGGLSPALIEEGFRQYFEAFGHVTDLVVMYDQSIQRPRGFGFVSFDTEDLVNRVL 67


>UniRef50_A7PX80 Cluster: Chromosome chr12 scaffold_36, whole genome
           shotgun sequence; n=2; core eudicotyledons|Rep:
           Chromosome chr12 scaffold_36, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 103

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 19/45 (42%), Positives = 30/45 (66%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           V GLSW   +K L+D F ++G++  + +  D ++GRSRGF F+ F
Sbjct: 5   VEGLSWSVDEKSLKDAFSSFGDVTEVRIMYDKDSGRSRGFGFVYF 49



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           V GLS  + +  +++ FS FG + EV + +DK   + +GF F+ F  E
Sbjct: 5   VEGLSWSVDEKSLKDAFSSFGDVTEVRIMYDKDSGRSRGFGFVYFSKE 52


>UniRef50_A2XEH7 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 206

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/46 (50%), Positives = 29/46 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           KLFVGGL WET    +R HF  +GEI    V  D +T RS+G+ F+
Sbjct: 9   KLFVGGLPWETRGDAVRRHFEQFGEIVEAVVIADKHTSRSKGYGFV 54



 Score = 40.7 bits (91), Expect = 0.029
 Identities = 20/53 (37%), Positives = 31/53 (58%)
 Frame = +3

Query: 228 EG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           +G +T  + FVGGL  E   D +R  F +FG I+E  +  DK  ++ KG+ F+
Sbjct: 2   DGDTTFTKLFVGGLPWETRGDAVRRHFEQFGEIVEAVVIADKHTSRSKGYGFV 54


>UniRef50_Q95QL3 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 394

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAY-GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +FVG L +E T+  L   F A  G +E++ +  D +TG+ +GFAF+ FK   S+   +A 
Sbjct: 248 IFVGNLPFEITEDALITFFSAQIGPVEAVRIVRDKDTGKGKGFAFVNFKQDSSVS--LAL 305

Query: 190 GEHTINNKKVDPKKAKA-RHGKILSEDSAVK-SQMMKSETSSVNLELS*KWRCPLTKQRT 363
              TI  +K D +  K  + G +    +A K +   K   + +  +L  K++    K+RT
Sbjct: 306 SMETIKMEKRDLRITKVMKKGHLTKIQTAKKRTSHGKKNQNEITGKLH-KFKFSTKKERT 364

Query: 364 KER 372
            E+
Sbjct: 365 TEQ 367


>UniRef50_Q8IMX4 Cluster: CG5422-PD, isoform D; n=14;
           Endopterygota|Rep: CG5422-PD, isoform D - Drosophila
           melanogaster (Fruit fly)
          Length = 470

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKV 180
           H  +FVG LS E   + LR+ F  +GEI +  +  DP+T +S+G+AF+ F K  E+ + +
Sbjct: 94  HHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAI 153

Query: 181 MAAGEHTINNKKV 219
            A     I ++ +
Sbjct: 154 QAMNGQWIGSRSI 166



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF- 392
           ++PK   S+    FVG LS EI  + +R  F+ FG I    +  D    + KG+ F++F 
Sbjct: 85  NQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFV 144

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           +  +  N +     + IG + +    +T K   P
Sbjct: 145 KKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPP 178


>UniRef50_Q8I2Y5 Cluster: RNA-binding protein, putative; n=4;
           Plasmodium|Rep: RNA-binding protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 388

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 28/70 (40%), Positives = 39/70 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFV  LS +T    LR  F  YG++E   +  D N G+S+G+ F+ F +P    KVM  
Sbjct: 225 KLFVRNLSQKTNVSTLRSIFEKYGKLEECVIIHD-NEGKSKGYGFLTFSSPREAFKVMQQ 283

Query: 190 GEHTINNKKV 219
            E  I+N+ V
Sbjct: 284 PERIIDNRVV 293



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 23/70 (32%), Positives = 42/70 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L V  + + T D++   +F ++GEIE   +      GRS+G+ F+ FK  ES+ K + +
Sbjct: 142 RLMVRNIPFSTRDEQFLKYFESFGEIED-GIIVREKEGRSKGYGFVTFKYVESVQKCLKS 200

Query: 190 GEHTINNKKV 219
             HT++NK++
Sbjct: 201 -SHTLDNKEL 209



 Score = 36.3 bits (80), Expect = 0.62
 Identities = 19/68 (27%), Positives = 37/68 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  LS + +   +R+ F ++G + E  +  D  + + KG+ F+TF S +    +++ P+
Sbjct: 227 FVRNLSQKTNVSTLRSIFEKYGKLEECVIIHDN-EGKSKGYGFLTFSSPREAFKVMQQPE 285

Query: 435 RTIGGKEV 458
           R I  + V
Sbjct: 286 RIIDNRVV 293


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 548,937,558
Number of Sequences: 1657284
Number of extensions: 10354401
Number of successful extensions: 34083
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 30856
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33880
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 47296372782
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -