SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20079
         (698 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9VZS3 Cluster: Protein translation factor SUI1 homolog...    92   1e-17
UniRef50_O60739 Cluster: Eukaryotic translation initiation facto...    81   3e-14
UniRef50_P41567 Cluster: Eukaryotic translation initiation facto...    79   1e-13
UniRef50_UPI0000DD7914 Cluster: PREDICTED: similar to suppressor...    69   1e-10
UniRef50_Q94JV4 Cluster: Protein translation factor SUI1 homolog...    60   7e-08
UniRef50_Q7XN79 Cluster: OSJNBa0089N06.3 protein; n=6; Oryza sat...    54   3e-06
UniRef50_Q00RG6 Cluster: H0303G06.6 protein; n=2; Oryza sativa|R...    54   3e-06
UniRef50_Q5CLR9 Cluster: Translation initiation factor SUI1; n=2...    52   1e-05
UniRef50_Q38LF1 Cluster: Eukaryotic translation initiation facto...    51   3e-05
UniRef50_Q00T99 Cluster: Translation initiation factor SUI1, put...    50   5e-05
UniRef50_Q6MVC9 Cluster: Probable translation initiation factor ...    46   9e-04
UniRef50_A6SQI8 Cluster: Translation initiation factor 3; n=15; ...    46   0.001
UniRef50_A7ES43 Cluster: Predicted protein; n=1; Sclerotinia scl...    42   0.011
UniRef50_Q5KLG3 Cluster: Suppressor of initiator codon mutations...    42   0.015
UniRef50_Q86AU4 Cluster: Similar to translation initiation facto...    41   0.025
UniRef50_Q4QAL1 Cluster: Translation factor SUI1, putative; n=5;...    39   0.14 
UniRef50_UPI000150A7AF Cluster: Translation initiation factor SU...    38   0.31 
UniRef50_Q40537 Cluster: Nicotiana tabacum (clone 12) activating...    37   0.41 
UniRef50_A0CXT2 Cluster: Chromosome undetermined scaffold_30, wh...    35   1.7  
UniRef50_UPI0000498D7F Cluster: Translation initiation factor; n...    35   2.2  
UniRef50_Q4TGS9 Cluster: Chromosome undetermined SCAF3502, whole...    34   3.9  
UniRef50_A7T1N0 Cluster: Predicted protein; n=1; Nematostella ve...    33   5.1  
UniRef50_Q0PQL7 Cluster: Phenylalanyl-tRNA synthetase beta subun...    33   6.7  
UniRef50_Q9LNV2 Cluster: F22G5.33; n=2; Arabidopsis thaliana|Rep...    33   8.9  

>UniRef50_Q9VZS3 Cluster: Protein translation factor SUI1 homolog;
           n=11; Bilateria|Rep: Protein translation factor SUI1
           homolog - Drosophila melanogaster (Fruit fly)
          Length = 110

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 39/43 (90%), Positives = 41/43 (95%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEVLQLQGDQRENICQWLTK GL KP+QLKVHGF
Sbjct: 68  GTVIEHPEYGEVLQLQGDQRENICQWLTKVGLAKPDQLKVHGF 110



 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 32/39 (82%), Positives = 37/39 (94%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           MSIQNLNT DPFADAIK ++DD+QDGLVH+RIQQRNGR+
Sbjct: 1   MSIQNLNTRDPFADAIKGNDDDIQDGLVHIRIQQRNGRK 39



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 25/27 (92%), Positives = 27/27 (100%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQGLS+EYDLKKIVR+CKKEFAC
Sbjct: 40  TLTTVQGLSAEYDLKKIVRSCKKEFAC 66


>UniRef50_O60739 Cluster: Eukaryotic translation initiation factor
           1b; n=44; Fungi/Metazoa group|Rep: Eukaryotic
           translation initiation factor 1b - Homo sapiens (Human)
          Length = 113

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 34/43 (79%), Positives = 40/43 (93%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + G+VK EQLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/40 (52%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL +FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   TIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>UniRef50_P41567 Cluster: Eukaryotic translation initiation factor
           1; n=53; Eukaryota|Rep: Eukaryotic translation
           initiation factor 1 - Homo sapiens (Human)
          Length = 113

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 33/43 (76%), Positives = 39/43 (90%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+QLQGDQR+NICQ+L + GL K +QLKVHGF
Sbjct: 71  GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +IQNL++FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 3   AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRK 42



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/27 (66%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A KK+FAC
Sbjct: 43  TLTTVQGIADDYDKKKLVKAFKKKFAC 69


>UniRef50_UPI0000DD7914 Cluster: PREDICTED: similar to suppressor of
           initiator codon mutations, related sequence 1; n=1; Homo
           sapiens|Rep: PREDICTED: similar to suppressor of
           initiator codon mutations, related sequence 1 - Homo
           sapiens
          Length = 288

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 30/43 (69%), Positives = 35/43 (81%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEV+Q QGDQ  NICQ+L + GL K +QLKVH F
Sbjct: 246 GTVIEHPEYGEVIQPQGDQCNNICQFLVELGLAKDDQLKVHVF 288



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/54 (42%), Positives = 39/54 (72%), Gaps = 2/54 (3%)
 Frame = +2

Query: 101 SVSLKQRDPTFNRMSIQNLNTFDPFADAIKSSE--DDVQDGLVHVRIQQRNGRR 256
           +VS ++++ ++ + +IQNL++FDPFADA K  +      +  +H+RIQQRNGR+
Sbjct: 166 AVSTEEKE-SYCKFAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRK 218



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 17/27 (62%), Positives = 22/27 (81%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG++ +YD KK+V+A  K FAC
Sbjct: 219 TLTTVQGIADDYDKKKLVKAF-KNFAC 244


>UniRef50_Q94JV4 Cluster: Protein translation factor SUI1 homolog 2;
           n=42; Eukaryota|Rep: Protein translation factor SUI1
           homolog 2 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 113

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 24/43 (55%), Positives = 35/43 (81%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTVV+  E G+V+QLQGDQR+N+  +L ++GLVK + +K+HGF
Sbjct: 71  GTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           + +Q    FDPFADA            VH+R+QQRNGR+
Sbjct: 4   LEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRK 42



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGL  EY   KI++  KKEF C
Sbjct: 43  SLTTVQGLKKEYSYSKILKDLKKEFCC 69


>UniRef50_Q7XN79 Cluster: OSJNBa0089N06.3 protein; n=6; Oryza
           sativa|Rep: OSJNBa0089N06.3 protein - Oryza sativa
           (Rice)
          Length = 580

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 21/43 (48%), Positives = 32/43 (74%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           G VVE  E G+++QLQGD R ++  +L K+G+V+ + +KVHGF
Sbjct: 538 GNVVEDKELGKIIQLQGDHRNSVSDFLAKAGMVRKDNIKVHGF 580



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG+  EY+  K++R  K+E  C
Sbjct: 510 TLTTVQGIGGEYNYAKVLRDLKRELCC 536


>UniRef50_Q00RG6 Cluster: H0303G06.6 protein; n=2; Oryza sativa|Rep:
           H0303G06.6 protein - Oryza sativa (Rice)
          Length = 241

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 21/43 (48%), Positives = 32/43 (74%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           G VVE  E G+++QLQGD R ++  +L K+G+V+ + +KVHGF
Sbjct: 199 GNVVEDKELGKIIQLQGDHRNSVSDFLAKAGMVRKDNIKVHGF 241



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG+  EY+  K++R  K+E  C
Sbjct: 171 TLTTVQGIGGEYNYAKVLRDLKRELCC 197


>UniRef50_Q5CLR9 Cluster: Translation initiation factor SUI1; n=2;
           Cryptosporidium|Rep: Translation initiation factor SUI1
           - Cryptosporidium hominis
          Length = 112

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 17/42 (40%), Positives = 31/42 (73%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHG 464
           GT+++ PE+G +LQ+QGD R N+ ++L    +V  +++K+HG
Sbjct: 70  GTIIDDPEHGPILQIQGDHRHNVARFLVGENIVNSDEIKIHG 111



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 17/27 (62%), Positives = 25/27 (92%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGLS+E+DLK++++A KK F+C
Sbjct: 42  SLTTVQGLSAEFDLKRLLKAFKKNFSC 68


>UniRef50_Q38LF1 Cluster: Eukaryotic translation initiation factor
           1; n=9; Apicomplexa|Rep: Eukaryotic translation
           initiation factor 1 - Toxoplasma gondii
          Length = 163

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 18/42 (42%), Positives = 31/42 (73%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHG 464
           GTV+E PE+G ++QLQGDQR  + ++L +  +   +Q+++HG
Sbjct: 121 GTVIEDPEHGSIIQLQGDQRHAVKEFLEREAICSVDQIRIHG 162



 Score = 40.7 bits (91), Expect = 0.034
 Identities = 17/27 (62%), Positives = 22/27 (81%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           ++TTVQGL    DLKK+VRA KK+F+C
Sbjct: 93  SVTTVQGLDKSLDLKKMVRALKKQFSC 119


>UniRef50_Q00T99 Cluster: Translation initiation factor SUI1,
           putative; n=1; Ostreococcus tauri|Rep: Translation
           initiation factor SUI1, putative - Ostreococcus tauri
          Length = 129

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 21/42 (50%), Positives = 30/42 (71%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHG 464
           G +VE  E+G+++QLQGDQR+NI Q+L    + K   +KVHG
Sbjct: 86  GCIVEDSEHGDIVQLQGDQRKNIAQFLVDERISKKALIKVHG 127



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 15/27 (55%), Positives = 22/27 (81%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGL+ + +LK +V+ CKK+F C
Sbjct: 58  SLTTVQGLNPKINLKLVVKECKKKFNC 84


>UniRef50_Q6MVC9 Cluster: Probable translation initiation factor
           SUI1; n=2; Neurospora crassa|Rep: Probable translation
           initiation factor SUI1 - Neurospora crassa
          Length = 117

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIK--SSEDDVQDGLVHVRIQQRNGRRR*LRCKAFPR 286
           MSI+NL T+DPFA+A +  S +       +H+RIQQRNGR+     +  P+
Sbjct: 1   MSIENLKTYDPFAEADEEDSGQTKQTQEYIHIRIQQRNGRKTLTTVQGIPK 51



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 17/27 (62%), Positives = 22/27 (81%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG+  ++D KKI++  KKEFAC
Sbjct: 42  TLTTVQGIPKKFDAKKILKVVKKEFAC 68



 Score = 37.5 bits (83), Expect = 0.31
 Identities = 22/48 (45%), Positives = 31/48 (64%), Gaps = 5/48 (10%)
 Frame = +3

Query: 339 GTVV--EHPEYGEVLQLQGDQRENICQWLTK--SGL-VKPEQLKVHGF 467
           GT++  E  + G+V+QLQGDQR  I  +LT    GL +  + +KVHGF
Sbjct: 70  GTIIGDEDSKMGDVIQLQGDQRAKIKDFLTNKDEGLGLDAKTIKVHGF 117


>UniRef50_A6SQI8 Cluster: Translation initiation factor 3; n=15;
           Pezizomycotina|Rep: Translation initiation factor 3 -
           Botryotinia fuckeliana B05.10
          Length = 169

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +2

Query: 146 IQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRRR*LRCKAFPR 286
           I+NL  FDPFA+A +   D      +H+RIQQRNGR+     +  P+
Sbjct: 60  IENLKVFDPFAEADEEPGDQKAAEYIHIRIQQRNGRKTLTTVQGLPK 106



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/45 (48%), Positives = 34/45 (75%), Gaps = 2/45 (4%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLT-KSGL-VKPEQLKVHGF 467
           GT+V     G+V+QLQGDQR+++ ++LT K GL ++ + +KVHGF
Sbjct: 125 GTIVNDVIMGDVIQLQGDQRKDVQEFLTGKDGLELEAKTIKVHGF 169



 Score = 40.7 bits (91), Expect = 0.034
 Identities = 17/27 (62%), Positives = 22/27 (81%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQGL  ++D KKI++  KK+FAC
Sbjct: 97  TLTTVQGLPKKFDQKKILKVIKKKFAC 123


>UniRef50_A7ES43 Cluster: Predicted protein; n=1; Sclerotinia
           sclerotiorum 1980|Rep: Predicted protein - Sclerotinia
           sclerotiorum 1980
          Length = 165

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 24/53 (45%), Positives = 32/53 (60%)
 Frame = +1

Query: 178 RCYQKLGGRRSRWFSPRPYPATKRA*TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           RC Q+ GGR  R    +  P       LTTVQGL   +++KK+V+A KK+FAC
Sbjct: 74  RC-QQTGGRPKRNMEGKKKPHM-----LTTVQGLPDRFNMKKVVKAFKKKFAC 120



 Score = 39.1 bits (87), Expect = 0.10
 Identities = 20/43 (46%), Positives = 30/43 (69%), Gaps = 2/43 (4%)
 Frame = +3

Query: 342 TVVEHPEYGEVLQLQGDQRENICQWL-TKSGL-VKPEQLKVHG 464
           ++VE   +GEV+Q+QGD R+ I ++L TK GL +  E + VHG
Sbjct: 123 SIVEDKVFGEVIQIQGDYRQKIYEFLTTKDGLELDEENVVVHG 165


>UniRef50_Q5KLG3 Cluster: Suppressor of initiator codon mutations,
           putative; n=1; Filobasidiella neoformans|Rep: Suppressor
           of initiator codon mutations, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 159

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 18/27 (66%), Positives = 23/27 (85%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG+ S+Y+  KI++A KKEFAC
Sbjct: 71  TLTTVQGIPSKYNHSKILKAMKKEFAC 97



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 4/39 (10%)
 Frame = +3

Query: 363 YGEVLQLQGDQRENICQWLTKSGLVKPEQLK----VHGF 467
           +G+VLQLQGDQR    Q+L  SG+V  ++ K    VHG+
Sbjct: 121 HGDVLQLQGDQRVAAKQFLIDSGIVAQKEAKDLIVVHGY 159


>UniRef50_Q86AU4 Cluster: Similar to translation initiation factor 3
           (EIF3); Sui1p; n=2; Dictyostelium discoideum|Rep:
           Similar to translation initiation factor 3 (EIF3); Sui1p
           - Dictyostelium discoideum (Slime mold)
          Length = 110

 Score = 41.1 bits (92), Expect = 0.025
 Identities = 15/51 (29%), Positives = 31/51 (60%)
 Frame = +3

Query: 315 MQEGVRVQGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           +++ +   G +VE    G +++LQGD+R+ I  +L +  + +   +K+HGF
Sbjct: 60  LKKSLNCNGNIVEEENLGMIIKLQGDKRKEIALFLIEEKISQKPSIKIHGF 110



 Score = 36.3 bits (80), Expect = 0.72
 Identities = 21/58 (36%), Positives = 31/58 (53%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRRR*LRCKAFPRNMT*RRSCGH 316
           SIQNLN+ DPFA+   +   D     VH+RI QR+GR+     +  P  +  ++   H
Sbjct: 3   SIQNLNSADPFAED-SNLGGDSGISYVHIRIFQRSGRKAVTTVEGLPPKIDLKKILKH 59


>UniRef50_Q4QAL1 Cluster: Translation factor SUI1, putative; n=5;
           Trypanosomatidae|Rep: Translation factor SUI1, putative
           - Leishmania major
          Length = 107

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVH 461
           GTV+  P+ G V+QLQG+  ENI Q+L    +     L++H
Sbjct: 65  GTVISTPDAGTVIQLQGNWSENIKQFLLDEHMATENNLEIH 105


>UniRef50_UPI000150A7AF Cluster: Translation initiation factor SUI1
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           Translation initiation factor SUI1 family protein -
           Tetrahymena thermophila SB210
          Length = 101

 Score = 37.5 bits (83), Expect = 0.31
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = +3

Query: 342 TVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHG 464
           T+VE  E  +V++L GD R  I Q+L++ G+   + + +HG
Sbjct: 60  TIVEEDEGKKVIKLNGDHRNQIQQFLSEEGIAAVDNITIHG 100


>UniRef50_Q40537 Cluster: Nicotiana tabacum (clone 12) activating
           factor DNA sequence; n=1; Nicotiana tabacum|Rep:
           Nicotiana tabacum (clone 12) activating factor DNA
           sequence - Nicotiana tabacum (Common tobacco)
          Length = 81

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 17/39 (43%), Positives = 26/39 (66%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           + +Q  + FDPFA+A  S     ++  VH+RIQQRNG++
Sbjct: 35  IDVQIPSAFDPFAEAKDSGAPGAKE-YVHIRIQQRNGKK 72


>UniRef50_A0CXT2 Cluster: Chromosome undetermined scaffold_30, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_30,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 107

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 2/44 (4%)
 Frame = +3

Query: 339 GTVVEHPEYGE--VLQLQGDQRENICQWLTKSGLVKPEQLKVHG 464
           G + +  +YG+   ++L GD R+ I ++L + G+   + +KVHG
Sbjct: 63  GIISKDEDYGDQVTIRLTGDNRQQIAKFLVEEGIALQDNIKVHG 106



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           T T + G+  E+DL KI+R  KK+F C
Sbjct: 34  TQTIIVGIPDEFDLNKIIRFWKKQFNC 60


>UniRef50_UPI0000498D7F Cluster: Translation initiation factor; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: Translation
           initiation factor - Entamoeba histolytica HM-1:IMSS
          Length = 110

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 366 GEV-LQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GEV  +L GDQR+    +    G++ PE +K+HGF
Sbjct: 76  GEVEFKLSGDQRKAASNFFLAEGILLPENIKIHGF 110


>UniRef50_Q4TGS9 Cluster: Chromosome undetermined SCAF3502, whole
           genome shotgun sequence; n=3; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF3502,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 399

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 21/64 (32%), Positives = 28/64 (43%)
 Frame = -2

Query: 367 PYSGCSTTVPCTRTPSCMPARSSSGHIPRKGLAP*SASTPVSLLDTDVD*TILNVVLRAF 188
           P++    T  CTR+  C P  +        G  P +   P+SLLD       LN VL AF
Sbjct: 222 PWTSSRRTWTCTRSWPCPPCWAGPSPPMAPGAQPGTLQPPMSLLDFQPLACFLNNVLSAF 281

Query: 187 DSIG 176
           +  G
Sbjct: 282 NDCG 285


>UniRef50_A7T1N0 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1551

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 19/72 (26%), Positives = 36/72 (50%)
 Frame = +3

Query: 369  EVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF*AALLKHNMSTLNMYYERLRVVIINPI 548
            +VL+    QR++  QW    G+V+P QL      A   +  M+ LN+  E  +  I   I
Sbjct: 1408 KVLEFVAIQRKDNNQWAIPGGMVEPGQLVTQALKAEFGEEAMAKLNVSQEE-KERIAKQI 1466

Query: 549  KNMYLESTDVYR 584
            + ++ +  ++Y+
Sbjct: 1467 ERLFQQGQEIYK 1478


>UniRef50_Q0PQL7 Cluster: Phenylalanyl-tRNA synthetase beta subunit;
           n=1; Endoriftia persephone 'Hot96_1+Hot96_2'|Rep:
           Phenylalanyl-tRNA synthetase beta subunit - Endoriftia
           persephone 'Hot96_1+Hot96_2'
          Length = 287

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 28/105 (26%), Positives = 43/105 (40%), Gaps = 2/105 (1%)
 Frame = -2

Query: 397 RWSP*SCSTSPYSGCSTTVPCTRTPSCMPARSSSGHIPRKGL-AP*SASTPVSLLDTDVD 221
           RW     + +P S     + C+R  S  P RSS+  +P   +  P +AS+  S+      
Sbjct: 7   RWPASWAARAPGSAPRPAISCSRALSSAPPRSSARRVPMGCIPTPRTASSAASIPSLQAQ 66

Query: 220 *TILNVVLRAFDSI-GEWVECVEILDGHTIERRVSLFQRNAAILR 89
             +        D + GE    VE+ D   IE R  +  R+  I R
Sbjct: 67  -AMQRATALLLDIVGGEAGPVVEVSDEEKIEARPQILLRHQRIQR 110


>UniRef50_Q9LNV2 Cluster: F22G5.33; n=2; Arabidopsis thaliana|Rep:
           F22G5.33 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 753

 Score = 32.7 bits (71), Expect = 8.9
 Identities = 17/53 (32%), Positives = 26/53 (49%)
 Frame = +2

Query: 101 SVSLKQRDPTFNRMSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRRR 259
           SV   +  P+F  + I+  N F PF+      E+  +  L H R  +RN RR+
Sbjct: 64  SVFYLRNHPSFKLLHIKTDNWFSPFSQKRSEEEETRKADLKHQRSVRRNARRK 116


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 672,635,022
Number of Sequences: 1657284
Number of extensions: 13138699
Number of successful extensions: 36194
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 34499
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36156
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55371905986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -