SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20078
         (633 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000DB70D1 Cluster: PREDICTED: similar to Karyopheri...    87   3e-16
UniRef50_Q5T576 Cluster: RAN binding protein 5; n=9; Euteleostom...    80   4e-14
UniRef50_UPI0000DA3D66 Cluster: PREDICTED: similar to RAN bindin...    65   2e-09
UniRef50_O60518 Cluster: Ran-binding protein 6; n=68; Eumetazoa|...    64   3e-09
UniRef50_Q5C159 Cluster: SJCHGC08761 protein; n=1; Schistosoma j...    55   1e-06
UniRef50_Q00WP4 Cluster: Karyopherin (Importin) beta 3; n=1; Ost...    44   0.002
UniRef50_A7PYL2 Cluster: Chromosome chr12 scaffold_38, whole gen...    41   0.022
UniRef50_A5AVQ9 Cluster: Putative uncharacterized protein; n=2; ...    41   0.022
UniRef50_A7PW36 Cluster: Chromosome chr8 scaffold_34, whole geno...    40   0.066
UniRef50_Q9N5V3 Cluster: Importin beta family protein 3; n=2; Ca...    39   0.087
UniRef50_A5ZSJ8 Cluster: Putative uncharacterized protein; n=2; ...    35   1.9  
UniRef50_Q11QW5 Cluster: Putative uncharacterized protein; n=1; ...    34   2.5  
UniRef50_A0CES7 Cluster: Chromosome undetermined scaffold_172, w...    34   3.3  
UniRef50_A4S6V4 Cluster: Predicted protein; n=1; Ostreococcus lu...    33   4.3  
UniRef50_UPI0000E22FCB Cluster: PREDICTED: tumor necrosis factor...    33   5.7  
UniRef50_A7R7P4 Cluster: Chromosome undetermined scaffold_1922, ...    33   5.7  
UniRef50_A4N750 Cluster: Putative Type I restriction enzyme EcoR...    33   7.5  
UniRef50_A4LZG4 Cluster: Putative uncharacterized protein precur...    33   7.5  
UniRef50_Q2UN71 Cluster: Karyopherin; n=14; Pezizomycotina|Rep: ...    33   7.5  
UniRef50_Q89JE6 Cluster: Bll5337 protein; n=1; Bradyrhizobium ja...    32   10.0 

>UniRef50_UPI0000DB70D1 Cluster: PREDICTED: similar to Karyopherin
           3 CG1059-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to Karyopherin  3 CG1059-PA - Apis mellifera
          Length = 1040

 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 5/117 (4%)
 Frame = +1

Query: 16  NADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRKVC 195
           NA + E++R  AAVLLRRLFS+             Q  L+EQ+LL++Q + ++ +RRKVC
Sbjct: 65  NATLTEEMRAMAAVLLRRLFSSEFMDFYPKIPPEAQAQLKEQILLSVQNEQTETIRRKVC 124

Query: 196 DVVSELARNHIDDDGNNQWPSSYS---SCL--PVPVRKIQTSKKLVLECLRLYQVYL 351
           +V +E+ARN ID+DGNNQWP        C   PVP  K    +    + +R    ++
Sbjct: 125 EVAAEVARNLIDEDGNNQWPEFLQFLFQCANSPVPALKENALRMFTFQAVRAIGAFI 181



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 21/37 (56%), Positives = 26/37 (70%)
 Frame = +3

Query: 396 ISALQPNESMALRTQAVKAVGAFILLHDKEPIIQKHF 506
           + AL+ N       QAV+A+GAFI+LHDKE  IQKHF
Sbjct: 158 VPALKENALRMFTFQAVRAIGAFIILHDKEENIQKHF 194



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 18/40 (45%), Positives = 26/40 (65%)
 Frame = +2

Query: 497 KAFQDVLLPLMQVIVLSIEAADDDSALKVLIELADQHLNF 616
           K F ++L  ++QVI  S+E   DD+ LKVLI+LA+    F
Sbjct: 192 KHFSELLPAIVQVIAQSVEKQGDDALLKVLIDLAESTPKF 231


>UniRef50_Q5T576 Cluster: RAN binding protein 5; n=9;
           Euteleostomi|Rep: RAN binding protein 5 - Homo sapiens
           (Human)
          Length = 126

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 36/74 (48%), Positives = 49/74 (66%)
 Frame = +1

Query: 34  DVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRKVCDVVSEL 213
           + RQ AAVLLRRL S+             QT ++ +LL+ +QM+    +R+KVCD+ +EL
Sbjct: 28  EARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAEL 87

Query: 214 ARNHIDDDGNNQWP 255
           ARN ID+DGNNQWP
Sbjct: 88  ARNLIDEDGNNQWP 101


>UniRef50_UPI0000DA3D66 Cluster: PREDICTED: similar to RAN binding
           protein 5; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to RAN binding protein 5 - Rattus norvegicus
          Length = 1056

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/73 (42%), Positives = 45/73 (61%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           I+N   AE+ RQ AAVLLRRL S+             QT ++ +LL+ +QM+    +R+K
Sbjct: 173 IRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKK 232

Query: 190 VCDVVSELARNHI 228
           +CD+ +ELARN I
Sbjct: 233 ICDIAAELARNLI 245


>UniRef50_O60518 Cluster: Ran-binding protein 6; n=68;
           Eumetazoa|Rep: Ran-binding protein 6 - Homo sapiens
           (Human)
          Length = 1105

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 30/82 (36%), Positives = 48/82 (58%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           ++N     +VRQ AA LLRRL S+             Q  ++ +L+L ++++    +R+K
Sbjct: 57  VRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPADVQRDVKIELILAVKLETHASMRKK 116

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           +CD+ + LARN ID+DG N WP
Sbjct: 117 LCDIFAVLARNLIDEDGTNHWP 138



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 25/84 (29%), Positives = 47/84 (55%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+     +++  + E  + +F   PG+FG ++  +LD+IK +L   +Q  E  A+R
Sbjct: 139 EGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGTQERHDLDIIKRLLDQCIQDQEHPAIR 198

Query: 435 TQAVKAVGAFILLHDKEPIIQKHF 506
           T + +A  AF+L ++    + K F
Sbjct: 199 TLSARAAAAFVLANENNIALFKDF 222


>UniRef50_Q5C159 Cluster: SJCHGC08761 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08761 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 183

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +1

Query: 10  IQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRK 189
           + +  +    R  AA+L RRL                +   ++QL+L +  +  Q +RRK
Sbjct: 63  LNDKSVVSQSRHMAAILGRRLLVNDYGSAFEPLPDETKNSAKQQLVLIVVHENEQLMRRK 122

Query: 190 VCDVVSELARNHIDDDGNNQWP 255
           V D++SEL R   DDDGN++WP
Sbjct: 123 VADLISELVRMEFDDDGNSRWP 144



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 12/39 (30%), Positives = 23/39 (58%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTEN 371
           EF   +   +++ D  ++E    +F SVP +FGN+Q ++
Sbjct: 145 EFTPILLDWSTSPDSGLREIACHIFGSVPSLFGNQQAQS 183


>UniRef50_Q00WP4 Cluster: Karyopherin (Importin) beta 3; n=1;
           Ostreococcus tauri|Rep: Karyopherin (Importin) beta 3 -
           Ostreococcus tauri
          Length = 1024

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 26/88 (29%), Positives = 46/88 (52%), Gaps = 3/88 (3%)
 Frame = +3

Query: 234 RWQQPVAEF---LQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISA 404
           RW  P  E+   L+FM  CA++ +   +    R+F S+     +  +E+   + G+  +A
Sbjct: 57  RWCVPTNEWPELLEFMGQCANSPETAHRALAFRLFESLTETIASALSEHFGTLAGLFANA 116

Query: 405 LQPNESMALRTQAVKAVGAFILLHDKEP 488
           L+ +E   +RT A++AVGA +     EP
Sbjct: 117 LR-DECDEVRTSALRAVGALVANSSGEP 143


>UniRef50_A7PYL2 Cluster: Chromosome chr12 scaffold_38, whole genome
           shotgun sequence; n=9; Magnoliophyta|Rep: Chromosome
           chr12 scaffold_38, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 1048

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 19/71 (26%), Positives = 38/71 (53%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           + L F+F C+ +   + +E  + +F+S+    G     +   ++ +L+  LQ   S  +R
Sbjct: 118 DLLPFLFQCSQSAQEDHREVALILFSSLTETIGIAFRPHFADLQALLLKCLQDETSNRVR 177

Query: 435 TQAVKAVGAFI 467
             A+KAVG+F+
Sbjct: 178 VAALKAVGSFL 188


>UniRef50_A5AVQ9 Cluster: Putative uncharacterized protein; n=2;
           Magnoliophyta|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1028

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 19/71 (26%), Positives = 38/71 (53%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           + L F+F C+ +   + +E  + +F+S+    G     +   ++ +L+  LQ   S  +R
Sbjct: 118 DLLPFLFQCSQSAQEDHREVALILFSSLTETIGIAFRPHFADLQALLLKCLQDETSNRVR 177

Query: 435 TQAVKAVGAFI 467
             A+KAVG+F+
Sbjct: 178 VAALKAVGSFL 188


>UniRef50_A7PW36 Cluster: Chromosome chr8 scaffold_34, whole genome
           shotgun sequence; n=15; Magnoliophyta|Rep: Chromosome
           chr8 scaffold_34, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 1116

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 27/102 (26%), Positives = 45/102 (44%)
 Frame = +1

Query: 34  DVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRKVCDVVSEL 213
           + R  AA+LLR+  +              Q  L+  LL  +Q + ++ + +K+CD VSEL
Sbjct: 72  EARAMAAILLRKQLTRDDSYLWPNLSATTQANLKSILLDCVQRETAKTISKKLCDTVSEL 131

Query: 214 ARNHIDDDGNNQWPSSYSSCLPVPVRKIQTSKKLVLECLRLY 339
           A   + D G  +       C+     K+Q +  L+   L  Y
Sbjct: 132 ASGILPDGGWPELLPFMFQCVTSSNFKLQEAALLIFAQLSQY 173


>UniRef50_Q9N5V3 Cluster: Importin beta family protein 3; n=2;
           Caenorhabditis|Rep: Importin beta family protein 3 -
           Caenorhabditis elegans
          Length = 1092

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 19/73 (26%), Positives = 35/73 (47%)
 Frame = +1

Query: 34  DVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRKVCDVVSEL 213
           D R T  V LRR+ +              +  +  ++L  +  +    +++K+ D++SE+
Sbjct: 52  DARSTVLVFLRRVLARDWDAIWETLNEENKQRILAKVLEMIVHETELSIKKKIADLISEI 111

Query: 214 ARNHIDDDGNNQW 252
           A N IDD G+  W
Sbjct: 112 ASNLIDDSGDMTW 124


>UniRef50_A5ZSJ8 Cluster: Putative uncharacterized protein; n=2;
           Ruminococcus|Rep: Putative uncharacterized protein -
           Ruminococcus obeum ATCC 29174
          Length = 732

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 133 REQLLLTLQM-DLSQYLRRKVCDVVSELARNHIDDDGNNQWPSSYSSCLP 279
           R QL+L +   D++ YL  ++CD+V +    +I  D N    ++YS+ LP
Sbjct: 443 RSQLVLDMSREDVTDYLTERICDIVEKADIQYIKWDMNRSLMAAYSAKLP 492


>UniRef50_Q11QW5 Cluster: Putative uncharacterized protein; n=1;
            Cytophaga hutchinsonii ATCC 33406|Rep: Putative
            uncharacterized protein - Cytophaga hutchinsonii (strain
            ATCC 33406 / NCIMB 9469)
          Length = 1888

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 3/52 (5%)
 Frame = +1

Query: 118  QQTVLREQLLLTLQMDLSQYLRRKVCDVVSEL-ARNHIDDD--GNNQWPSSY 264
            Q   L E  +L L  DL ++L  K+CD++  L ARN  +D     N W S Y
Sbjct: 1782 QHDPLEEYKILWLSEDLFEFLELKICDIIEGLFARNSTNDVVLKYNYWSSDY 1833


>UniRef50_A0CES7 Cluster: Chromosome undetermined scaffold_172,
           whole genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_172,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1081

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 9/33 (27%), Positives = 23/33 (69%)
 Frame = +1

Query: 154 LQMDLSQYLRRKVCDVVSELARNHIDDDGNNQW 252
           +++++S  +R ++CD + E+  +  +DD +N+W
Sbjct: 98  IEVEMSHIVRNQLCDTIGEIGGSLYEDDSHNEW 130


>UniRef50_A4S6V4 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 979

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 3/88 (3%)
 Frame = +3

Query: 234 RWQQPVAEF---LQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISA 404
           RW  P  E+   L+F+  CAS+ +   +    ++F S+     +  + +   + G+  + 
Sbjct: 67  RWTVPQGEWNELLEFLGQCASSPETAHRALAFKLFESLTETIVSSLSHHFKTLAGLFANG 126

Query: 405 LQPNESMALRTQAVKAVGAFILLHDKEP 488
           L       +R  A++AVGA +     EP
Sbjct: 127 LVDAHD-EVRVSALRAVGALVANASGEP 153


>UniRef50_UPI0000E22FCB Cluster: PREDICTED: tumor necrosis factor
           receptor 1; n=1; Pan troglodytes|Rep: PREDICTED: tumor
           necrosis factor receptor 1 - Pan troglodytes
          Length = 496

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 4/96 (4%)
 Frame = -3

Query: 556 CFNRQNYYLHQR*KNILKCF-CMMGSLSCSSIKAPTALTA*VRKAIDSFGCKADINMPFI 380
           C  R+N Y H   +N+ +CF C +       +  P         A+ SF CK  +     
Sbjct: 168 CGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSWPL-----FTSAVSSFSCKKSLE---- 218

Query: 379 TSKFSV*RFPNTPGTD---VNILIPASLMFGSCALA 281
            +K  + +  N  GT+     +L+P  + FG C L+
Sbjct: 219 CTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLS 254


>UniRef50_A7R7P4 Cluster: Chromosome undetermined scaffold_1922, whole
            genome shotgun sequence; n=1; Vitis vinifera|Rep:
            Chromosome undetermined scaffold_1922, whole genome
            shotgun sequence - Vitis vinifera (Grape)
          Length = 1180

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 3/76 (3%)
 Frame = +1

Query: 121  QTVLREQLLLTLQMDLSQYLRRKVCDVVSELARNHIDDDGNNQWPSSYS---SCLPVPVR 291
            Q  L+  LL  +Q   ++ + +K+CD VSELA + + ++G   WP+  S    C+     
Sbjct: 838  QLSLKSILLGCIQRKNAKSISKKLCDTVSELASSILLENG---WPNLLSFMFQCMTFDST 894

Query: 292  KIQTSKKLVLECLRLY 339
            K+Q +  L+   L  Y
Sbjct: 895  KLQEAVFLIFAQLAQY 910


>UniRef50_A4N750 Cluster: Putative Type I restriction enzyme
           EcoR124II specificity protein; n=1; Haemophilus
           influenzae R3021|Rep: Putative Type I restriction enzyme
           EcoR124II specificity protein - Haemophilus influenzae
           R3021
          Length = 259

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
 Frame = +1

Query: 202 VSELARNHIDDDGNNQWPSSYSS-CLPVPVRKIQTSKKLVLECL 330
           ++ L  N +D D   QW S+Y++  +P+P   +QT    +L+ L
Sbjct: 119 LNTLPNNQLDSDHKRQWISNYANKLIPIPPLSVQTEIVKILDAL 162


>UniRef50_A4LZG4 Cluster: Putative uncharacterized protein
           precursor; n=1; Geobacter bemidjiensis Bem|Rep: Putative
           uncharacterized protein precursor - Geobacter
           bemidjiensis Bem
          Length = 229

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 16/43 (37%), Positives = 27/43 (62%)
 Frame = -3

Query: 376 SKFSV*RFPNTPGTDVNILIPASLMFGSCALAQVNMNCRNSAT 248
           S F+V R     G+  ++L+ A+L+FG C LA+V++N  +  T
Sbjct: 23  STFNVQRSGVRVGSGASLLLLAALLFGGCTLAKVDVNVVSERT 65


>UniRef50_Q2UN71 Cluster: Karyopherin; n=14; Pezizomycotina|Rep:
           Karyopherin - Aspergillus oryzae
          Length = 1095

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 16/70 (22%), Positives = 39/70 (55%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L  +F  + + D  ++EA  R+F++ PG+    +  + D ++G+     + ++ +++R
Sbjct: 141 ELLGVLFQASQSPDAGLREAAFRIFSTTPGII---EKPHEDAVQGVFGKGFK-DDVVSVR 196

Query: 435 TQAVKAVGAF 464
             A++A  +F
Sbjct: 197 IAAMEAFASF 206


>UniRef50_Q89JE6 Cluster: Bll5337 protein; n=1; Bradyrhizobium
           japonicum|Rep: Bll5337 protein - Bradyrhizobium
           japonicum
          Length = 345

 Score = 32.3 bits (70), Expect = 10.0
 Identities = 12/29 (41%), Positives = 22/29 (75%)
 Frame = +2

Query: 527 MQVIVLSIEAADDDSALKVLIELADQHLN 613
           ++++ + I+A DDDS+L V++E  D HL+
Sbjct: 111 LKLLTVPIQAVDDDSSLPVIVEDIDDHLS 139


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 628,290,659
Number of Sequences: 1657284
Number of extensions: 12331026
Number of successful extensions: 27042
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 26264
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27036
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46881492319
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -