SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20075
         (715 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000D5762A Cluster: PREDICTED: similar to CG6040-PA;...   112   7e-24
UniRef50_Q9VE02 Cluster: CG6040-PA; n=4; Sophophora|Rep: CG6040-...    91   3e-17
UniRef50_UPI0000DB7898 Cluster: PREDICTED: similar to CG6040-PA ...    80   6e-14
UniRef50_A4H9S4 Cluster: Putative uncharacterized protein; n=1; ...    37   0.57 
UniRef50_A0BFS9 Cluster: Chromosome undetermined scaffold_104, w...    35   1.7  
UniRef50_A6PTT6 Cluster: Response regulator receiver protein; n=...    34   4.0  
UniRef50_Q44M55 Cluster: Similar to ATPase; n=4; Bacteria|Rep: S...    33   5.3  
UniRef50_A1VQG7 Cluster: Acriflavin resistance protein; n=1; Pol...    33   5.3  
UniRef50_Q6ZVI3 Cluster: CDNA FLJ42547 fis, clone BRACE3004880; ...    33   5.3  
UniRef50_UPI0000EBD2AB Cluster: PREDICTED: hypothetical protein;...    33   7.0  
UniRef50_Q4D9V9 Cluster: Putative uncharacterized protein; n=2; ...    33   7.0  
UniRef50_UPI0001553357 Cluster: PREDICTED: similar to novel memb...    33   9.2  

>UniRef50_UPI0000D5762A Cluster: PREDICTED: similar to CG6040-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG6040-PA - Tribolium castaneum
          Length = 1048

 Score =  112 bits (270), Expect = 7e-24
 Identities = 50/79 (63%), Positives = 64/79 (81%)
 Frame = +3

Query: 9   DQNDLTPKTTTNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLR 188
           D +D      T+KLR RKGRS+VH+NLEDNYGAV++ANHEALAQVLE +QQ+  +QP+LR
Sbjct: 687 DDHDWIQNGRTHKLRSRKGRSIVHKNLEDNYGAVIVANHEALAQVLENIQQTTHIQPALR 746

Query: 189 GLKACTNLRWSDFTVQPKS 245
           GLK  +NLRW+DF+V+  S
Sbjct: 747 GLKTLSNLRWTDFSVKSTS 765



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 34/86 (39%), Positives = 48/86 (55%), Gaps = 2/86 (2%)
 Frame = +2

Query: 257  GRRIFCPAVWNSNSPVNVTLMLYKEQMASQIVCQQSVQPQTLSLNAITEFCDLVPRQQFG 436
            G R F  A+WN+    +VTL++    + S      ++   T SL  ITEF DLVP +  G
Sbjct: 771  GCRTFHQAIWNTQ---HVTLVVNTGAVPSS-----TLTLGTSSLMTITEFSDLVPAKFVG 822

Query: 437  EDGDD--LVQATIVVLAQAQVDTLQS 508
             + ++  LVQAT+ VL   QV T+QS
Sbjct: 823  NESEEEKLVQATVAVLPWLQVSTIQS 848



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/52 (46%), Positives = 36/52 (69%)
 Frame = +1

Query: 532  EALSTNSQLVPTEQVHEAIFMMLQLINGLKCLQARGVEEISETLSSFVALRE 687
            E+L   +Q +  E   +A F+MLQL+N LK LQA+G+EE+  +L+SFV  +E
Sbjct: 851  ESLKKGAQTLE-EAWKDASFIMLQLVNALKILQAQGIEELLLSLNSFVLCKE 901


>UniRef50_Q9VE02 Cluster: CG6040-PA; n=4; Sophophora|Rep: CG6040-PA -
            Drosophila melanogaster (Fruit fly)
          Length = 1784

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 41/65 (63%), Positives = 53/65 (81%)
 Frame = +3

Query: 39   TNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRGLKACTNLRW 218
            TN+LR+RKGRSVVH+ +EDNY AVV+ANHEALAQVL+Q+QQ+  +  +LR L    NLR+
Sbjct: 1355 TNRLRMRKGRSVVHKTIEDNYTAVVVANHEALAQVLDQLQQTPVVPAALRPLANAINLRY 1414

Query: 219  SDFTV 233
             DFT+
Sbjct: 1415 EDFTI 1419



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 5/93 (5%)
 Frame = +2

Query: 257  GRRIFCPAVWNSNSPVNVTLMLYKEQMASQIVCQQSVQPQTLS--LNAITEFCDLVPRQQ 430
            G++ F  A+W+S SPV + L     Q+   +  + S     +S  LN +TEFCDLVP  Q
Sbjct: 1429 GKKAFHAALWSS-SPVTLALSADCNQLGG-VAGELSQLSGGVSDVLNPVTEFCDLVPSYQ 1486

Query: 431  ---FGEDGDDLVQATIVVLAQAQVDTLQSMAKV 520
                      L+QATI VL + Q++TLQS+  +
Sbjct: 1487 LPLMPSTEVTLLQATISVLPRLQLETLQSIGSI 1519



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 3/52 (5%)
 Frame = +1

Query: 541  STNSQLVPT---EQVHEAIFMMLQLINGLKCLQARGVEEISETLSSFVALRE 687
            STN+  +P        E  F+MLQL+NG+K LQA+ +EE   +LS+ V  ++
Sbjct: 1582 STNANAMPAFDDVMTREVAFIMLQLVNGMKNLQAKAIEETPLSLSNVVLSKD 1633


>UniRef50_UPI0000DB7898 Cluster: PREDICTED: similar to CG6040-PA
            isoform 2; n=1; Apis mellifera|Rep: PREDICTED: similar to
            CG6040-PA isoform 2 - Apis mellifera
          Length = 1417

 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 39/70 (55%), Positives = 52/70 (74%)
 Frame = +3

Query: 42   NKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRGLKACTNLRWS 221
            ++LR R+GRS+VHR+LEDNYGAVV+ANHEALAQ L+Q+ Q+  +   LR LK  TN R S
Sbjct: 1072 SRLRQRRGRSIVHRSLEDNYGAVVVANHEALAQFLDQLNQTPQVPAGLRALKN-TNPRVS 1130

Query: 222  DFTVQPKSSV 251
             F +   +S+
Sbjct: 1131 HFGIDANTSI 1140



 Score = 40.3 bits (90), Expect = 0.046
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +1

Query: 574  VHEAIFMMLQLINGLKCLQARGVEEISETLSSFVALRE 687
            + E+ F++LQ +  LK LQARG+EE + +L++ V  RE
Sbjct: 1233 IRESSFVLLQFVTALKSLQARGIEESARSLNNVVLCRE 1270



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 3/86 (3%)
 Frame = +2

Query: 257  GRRIFCPAVWNSNSPVNVTLMLYKEQMASQIVCQQSVQPQTLSLNAITEFCDLVPRQQFG 436
            GRRIFC A WN    +NVTL +  + +A+       V  +   L  I EF D  P++   
Sbjct: 1143 GRRIFCSATWNE---LNVTLCIAFD-LATH------VSRKEFYLAPIIEFIDSPPKEIID 1192

Query: 437  E---DGDDLVQATIVVLAQAQVDTLQ 505
                  +  ++ATI VL + QV T+Q
Sbjct: 1193 NGCLPTNKQLEATISVLPRLQVSTIQ 1218


>UniRef50_A4H9S4 Cluster: Putative uncharacterized protein; n=1;
            Leishmania braziliensis|Rep: Putative uncharacterized
            protein - Leishmania braziliensis
          Length = 2833

 Score = 36.7 bits (81), Expect = 0.57
 Identities = 28/79 (35%), Positives = 33/79 (41%), Gaps = 4/79 (5%)
 Frame = +3

Query: 471  WFWPKHRWTPYKAWPKSSLRR---SSFDQLPTRA-N*TGARSYLHDAATDQRPQVPSGAR 638
            W  P H W  +  W     RR   +   Q  T     TG   Y  DA T   P VP+   
Sbjct: 1651 WLLP-HHWAAHTPWDAQLGRRIIRNLLRQTHTATPTDTGELFYERDAET---PDVPATLA 1706

Query: 639  GRGNLGDFVLVRGAEGSPG 695
            G GN GD  L+   +GSPG
Sbjct: 1707 GAGNEGDQPLLTDEQGSPG 1725


>UniRef50_A0BFS9 Cluster: Chromosome undetermined scaffold_104,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_104,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1175

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 25/89 (28%), Positives = 43/89 (48%)
 Frame = +3

Query: 12  QNDLTPKTTTNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRG 191
           Q DL+ K   NK    + ++V+  N+  N    +I N++   Q L+QVQ+ +  Q    G
Sbjct: 105 QVDLSQKEEKNK----ESKAVLTSNVSSNNNKCIIQNNQQEIQ-LQQVQKDSQQQDEYIG 159

Query: 192 LKACTNLRWSDFTVQPKSSVKPAGEYSVR 278
           LK   N+   D   Q + + K + E  ++
Sbjct: 160 LKQGQNIIQFDIDQQVEQNTKLSDEQQIQ 188


>UniRef50_A6PTT6 Cluster: Response regulator receiver protein; n=1;
           Victivallis vadensis ATCC BAA-548|Rep: Response
           regulator receiver protein - Victivallis vadensis ATCC
           BAA-548
          Length = 537

 Score = 33.9 bits (74), Expect = 4.0
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +2

Query: 290 SNSPVNVTLMLYKEQMASQIVCQQSVQPQTLSLNA-ITEFCDLVPRQQFGED 442
           S SP +V +M  ++  A   VC + +QP T S++A + EFC+ V      E+
Sbjct: 377 SESPDDVFIMALQKNCAIPTVCFRQLQPTTNSISAGVLEFCNFVQHHTGDEE 428


>UniRef50_Q44M55 Cluster: Similar to ATPase; n=4; Bacteria|Rep:
           Similar to ATPase - Chlorobium limicola DSM 245
          Length = 600

 Score = 33.5 bits (73), Expect = 5.3
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +3

Query: 504 KAWPKSSLRRSSFDQLPTRAN*TGARSYLHDAATDQRPQVPSGARGRGNLGDFVLVRG 677
           +A+P+  LR   F  + +  +    R  L+DA +        G  G+G +G+FVL+ G
Sbjct: 9   EAFPRGLLRHELFIGVLSSVSAQAVRFNLNDAGSPSGAHFLGGRYGKGEVGEFVLIEG 66


>UniRef50_A1VQG7 Cluster: Acriflavin resistance protein; n=1;
           Polaromonas naphthalenivorans CJ2|Rep: Acriflavin
           resistance protein - Polaromonas naphthalenivorans
           (strain CJ2)
          Length = 1108

 Score = 33.5 bits (73), Expect = 5.3
 Identities = 23/88 (26%), Positives = 36/88 (40%)
 Frame = -2

Query: 639 PSRLKALEAVDQLQHHEDSFVHLFSWHELGVGRKSFDGAKTLAMLCKVSTCAWAKTTMVA 460
           P+R  ++ + DQL    D    + +W   G   +  + A+ +         AWA      
Sbjct: 251 PTRSYSINSNDQLLAASDYQNLIIAWRN-GAAVRVSNVARVVEGAENTQLGAWASIACAP 309

Query: 459 CTKSSPSSPNCCLGTKSQNSVMAFRLSV 376
              +SP  P  CLGT  +  V A  L+V
Sbjct: 310 GASASPDEPGDCLGTPGRRLVPAIILNV 337


>UniRef50_Q6ZVI3 Cluster: CDNA FLJ42547 fis, clone BRACE3004880;
           n=5; Homo/Pan/Gorilla group|Rep: CDNA FLJ42547 fis,
           clone BRACE3004880 - Homo sapiens (Human)
          Length = 256

 Score = 33.5 bits (73), Expect = 5.3
 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 8/76 (10%)
 Frame = -2

Query: 498 VSTCAWAKTTMVACTKSSPSSPNCCLG--TKSQNSVMAFRLSVCGCTDCWQTICE----- 340
           +S C  + TT+ AC  SS +   C L   T S   +    LS CG +    + C      
Sbjct: 123 LSACGLSSTTLFACRLSSVTVSTCSLSSVTLSACGLSRVTLSACGLSSMTPSACGLSRVT 182

Query: 339 -AICSLYSMRVTLTGL 295
            + C L SM V+  GL
Sbjct: 183 LSACHLSSMTVSTCGL 198


>UniRef50_UPI0000EBD2AB Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 213

 Score = 33.1 bits (72), Expect = 7.0
 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = -1

Query: 712 RPERV*PGLPSAPRTRTKSPRF-PRPLAPEGT 620
           RP R  PG PSAP   T+SP F  R  AP+ T
Sbjct: 73  RPSRSLPGFPSAPNRSTQSPGFHTRSEAPQNT 104


>UniRef50_Q4D9V9 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 341

 Score = 33.1 bits (72), Expect = 7.0
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = -3

Query: 617 RPLISCSIMKIASCTCSVGTSWELVERASTERRLWPCFV 501
           R L+SC +  +  C    GTSW LV R +   + W C V
Sbjct: 147 RRLLSCDVFGVVICI--TGTSWSLVYRGNACSQNWSCHV 183


>UniRef50_UPI0001553357 Cluster: PREDICTED: similar to novel member
           of the keratin associated protein 4 (Krtap4) family;
           n=1; Mus musculus|Rep: PREDICTED: similar to novel
           member of the keratin associated protein 4 (Krtap4)
           family - Mus musculus
          Length = 292

 Score = 32.7 bits (71), Expect = 9.2
 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 3/61 (4%)
 Frame = -2

Query: 504 CKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSV---MAFRLSVCGCTDCWQTICEAI 334
           C VS+C   +     C + +   P+CC+ +   +S         S CG + C  T C + 
Sbjct: 29  CCVSSCCRPQCCQSVCCQPTCCHPSCCISSCRVSSCCCPSCVNSSCCGSSSCRPTCCVSS 88

Query: 333 C 331
           C
Sbjct: 89  C 89


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 753,213,259
Number of Sequences: 1657284
Number of extensions: 15574282
Number of successful extensions: 51823
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 49014
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51764
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57438021881
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -