SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20074
         (622 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4U5R7 Cluster: Protein 7; n=2; Cypovirus 14|Rep: Prote...    34   3.1  
UniRef50_Q8ID31 Cluster: Alanine--tRNA ligase, putative; n=15; c...    33   5.5  
UniRef50_UPI000150589B Cluster: unknown protein; n=1; Arabidopsi...    33   7.3  
UniRef50_Q9ZU83 Cluster: Putative uncharacterized protein At2g48...    33   7.3  
UniRef50_Q6LFI3 Cluster: Putative uncharacterized protein; n=1; ...    32   9.6  

>UniRef50_Q4U5R7 Cluster: Protein 7; n=2; Cypovirus 14|Rep: Protein
           7 - Heliothis armigera cypovirus 14
          Length = 424

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 22/62 (35%), Positives = 33/62 (53%)
 Frame = +2

Query: 392 LLCLSYASGRGLVHSTKVLQKCMTVASILIVDKTVCVDVTCGQFNVPCPVW*RRLGENVI 571
           +L LSYA   GL   T+++ +C+ VAS+ I  +T C ++   Q  V      R  GEN +
Sbjct: 203 MLDLSYAVD-GLGDLTQIVTECLWVASVAITGRT-CREILTSQVGVEVTYTLRYYGENSM 260

Query: 572 FT 577
            T
Sbjct: 261 LT 262


>UniRef50_Q8ID31 Cluster: Alanine--tRNA ligase, putative; n=15;
           cellular organisms|Rep: Alanine--tRNA ligase, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 1408

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 15/38 (39%), Positives = 25/38 (65%)
 Frame = -1

Query: 181 KRPKNIYYLFIYNLKFIYTNIIKRKDLFVCLFRIGSET 68
           K+ KN    +  + KF+Y N IKRKD+F+ L +I +++
Sbjct: 169 KKEKNKKREYCNHYKFMYLNSIKRKDIFIKLNKINNKS 206


>UniRef50_UPI000150589B Cluster: unknown protein; n=1; Arabidopsis
           thaliana|Rep: unknown protein - Arabidopsis thaliana
          Length = 626

 Score = 32.7 bits (71), Expect = 7.3
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = -1

Query: 169 NIYYLFIYNLKFIYTNIIKRKDLFVCLFRIGSETTGP 59
           NI  L++Y L   ++++I+    F+ LFRI  ET GP
Sbjct: 214 NIVLLYLYQLPINFSDMIRWIASFIGLFRISLETEGP 250


>UniRef50_Q9ZU83 Cluster: Putative uncharacterized protein
           At2g48060; n=1; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein At2g48060 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 621

 Score = 32.7 bits (71), Expect = 7.3
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = -1

Query: 169 NIYYLFIYNLKFIYTNIIKRKDLFVCLFRIGSETTGP 59
           NI  L++Y L   ++++I+    F+ LFRI  ET GP
Sbjct: 281 NIVLLYLYQLPINFSDMIRWIASFIGLFRISLETEGP 317


>UniRef50_Q6LFI3 Cluster: Putative uncharacterized protein; n=1;
            Plasmodium falciparum 3D7|Rep: Putative uncharacterized
            protein - Plasmodium falciparum (isolate 3D7)
          Length = 1948

 Score = 32.3 bits (70), Expect = 9.6
 Identities = 12/36 (33%), Positives = 22/36 (61%)
 Frame = -1

Query: 187  NEKRPKNIYYLFIYNLKFIYTNIIKRKDLFVCLFRI 80
            NEK  K IYYL +YN K+++  +  +  ++  L+ +
Sbjct: 1225 NEKYYKIIYYLLLYNFKYVFKKLKLKYSIYDLLYNL 1260


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 530,648,441
Number of Sequences: 1657284
Number of extensions: 9232234
Number of successful extensions: 21820
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 21141
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21818
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 45221970467
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -