SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20070
         (639 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8NCW5 Cluster: Apolipoprotein A-I-binding protein prec...   108   1e-22
UniRef50_Q4TBP7 Cluster: Chromosome undetermined SCAF7101, whole...    93   4e-18
UniRef50_A6QTN1 Cluster: Predicted protein; n=4; Pezizomycotina|...    93   4e-18
UniRef50_Q17GW6 Cluster: Apolipoprotein a binding protein; n=1; ...    91   2e-17
UniRef50_O13725 Cluster: Meiotically up-regulated gene 182 prote...    90   5e-17
UniRef50_A1CAM2 Cluster: AI-BP family protein; n=4; Trichocomace...    88   2e-16
UniRef50_Q5KJ55 Cluster: Protein-binding protein, putative; n=2;...    85   1e-15
UniRef50_Q4PB52 Cluster: Putative uncharacterized protein; n=1; ...    83   7e-15
UniRef50_A3LR70 Cluster: Predicted protein; n=5; Saccharomycetal...    83   7e-15
UniRef50_UPI000049849E Cluster: conserved hypothetical protein; ...    80   4e-14
UniRef50_Q9XW15 Cluster: Putative uncharacterized protein; n=2; ...    79   9e-14
UniRef50_UPI00006CBCE8 Cluster: YjeF-related protein, N-terminus...    73   8e-12
UniRef50_A0E3W6 Cluster: Chromosome undetermined scaffold_77, wh...    71   2e-11
UniRef50_A4RCG8 Cluster: Putative uncharacterized protein; n=2; ...    71   2e-11
UniRef50_Q6CDL0 Cluster: Yarrowia lipolytica chromosome B of str...    70   4e-11
UniRef50_Q7QU52 Cluster: GLP_725_13171_12350; n=1; Giardia lambl...    68   2e-10
UniRef50_UPI0001555A9B Cluster: PREDICTED: similar to apoliprote...    65   2e-09
UniRef50_Q7RDA5 Cluster: Homo sapiens TGR-CL10C; n=6; Plasmodium...    64   4e-09
UniRef50_A6XGL0 Cluster: Apolipoprotein A1 binding protein; n=19...    59   1e-07
UniRef50_P40165 Cluster: Uncharacterized protein YNL200C; n=6; S...    58   2e-07
UniRef50_Q67K78 Cluster: Putative sugar kinase; n=1; Symbiobacte...    56   7e-07
UniRef50_Q28S78 Cluster: YjeF-related protein-like protein; n=3;...    56   1e-06
UniRef50_Q01GB8 Cluster: ABL161Cp; n=2; Ostreococcus|Rep: ABL161...    54   4e-06
UniRef50_A6DCM9 Cluster: Putative uncharacterized protein; n=1; ...    53   5e-06
UniRef50_Q1Q4I3 Cluster: Putative uncharacterized protein; n=1; ...    53   7e-06
UniRef50_A6P119 Cluster: Putative uncharacterized protein; n=1; ...    53   7e-06
UniRef50_A7HLS8 Cluster: Carbohydrate kinase, YjeF related prote...    52   1e-05
UniRef50_A6LNX7 Cluster: Carbohydrate kinase, YjeF related prote...    52   2e-05
UniRef50_Q2S580 Cluster: Predicted sugar kinase; n=1; Salinibact...    51   2e-05
UniRef50_A7HCT7 Cluster: Carbohydrate kinase, YjeF related prote...    50   6e-05
UniRef50_A5D4H8 Cluster: Predicted Carbohydrate kinase; n=4; Clo...    50   6e-05
UniRef50_P74217 Cluster: Uncharacterized protein sll1433; n=2; C...    50   6e-05
UniRef50_Q7NIE6 Cluster: Glr2237 protein; n=1; Gloeobacter viola...    49   1e-04
UniRef50_A6FF52 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_A2BLC0 Cluster: Conserved archaeal protein; n=1; Hypert...    49   1e-04
UniRef50_A5UYR5 Cluster: Carbohydrate kinase, YjeF related prote...    48   1e-04
UniRef50_Q648I4 Cluster: Predicted sugar kinase; n=3; Archaea|Re...    48   1e-04
UniRef50_Q8KD16 Cluster: YjeF family protein; n=10; Chlorobiacea...    48   2e-04
UniRef50_A6Q6K8 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_Q3SF10 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_Q30U34 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_A5IIL1 Cluster: Carbohydrate kinase, YjeF related prote...    48   3e-04
UniRef50_Q3A726 Cluster: Sugar kinase domain containing protein;...    47   3e-04
UniRef50_Q0AQ13 Cluster: Carbohydrate kinase, YjeF related prote...    47   3e-04
UniRef50_A6Q1C5 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_A5GUP7 Cluster: Predicted sugar kinase fused to a uncha...    47   3e-04
UniRef50_Q4DSR2 Cluster: Putative uncharacterized protein; n=3; ...    47   3e-04
UniRef50_A7I9D2 Cluster: Carbohydrate kinase, YjeF related prote...    47   3e-04
UniRef50_A2ST57 Cluster: Carbohydrate kinase, YjeF related prote...    47   3e-04
UniRef50_Q98N17 Cluster: Mlr0346 protein; n=10; Rhizobiales|Rep:...    47   4e-04
UniRef50_Q1ILG7 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_A0LCV3 Cluster: Carbohydrate kinase, YjeF related prote...    47   4e-04
UniRef50_Q7VAU0 Cluster: Predicted sugar kinase fused to unchara...    46   6e-04
UniRef50_Q2CHQ7 Cluster: YjeF family protein; n=4; Rhodobacterac...    46   6e-04
UniRef50_Q0AVS2 Cluster: Putative uncharacterized protein; n=1; ...    46   6e-04
UniRef50_Q026C1 Cluster: Carbohydrate kinase, YjeF related prote...    46   6e-04
UniRef50_Q5ZS19 Cluster: Sugar kinase; n=4; Legionella pneumophi...    46   8e-04
UniRef50_A6VWR0 Cluster: Carbohydrate kinase, YjeF related prote...    46   8e-04
UniRef50_A4XIB8 Cluster: Carbohydrate kinase, YjeF related prote...    46   8e-04
UniRef50_Q48A27 Cluster: YjeF family protein; n=1; Colwellia psy...    46   0.001
UniRef50_Q1VNF0 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q1GTW5 Cluster: YjeF-related protein-like protein; n=1;...    46   0.001
UniRef50_Q0F3J2 Cluster: Predicted sugar kinase; n=1; Mariprofun...    46   0.001
UniRef50_Q8R858 Cluster: Predicted sugar kinase; n=3; Thermoanae...    45   0.001
UniRef50_Q1W0C7 Cluster: Putative YjeF-related sugar kinase; n=1...    45   0.001
UniRef50_Q1NJB8 Cluster: Putative uncharacterized protein; n=2; ...    45   0.001
UniRef50_A4M5Z8 Cluster: Carbohydrate kinase, YjeF related prote...    45   0.001
UniRef50_A3CW60 Cluster: Carbohydrate kinase, YjeF related prote...    45   0.001
UniRef50_Q5FUR1 Cluster: Putative sugar kinase; n=1; Gluconobact...    45   0.002
UniRef50_Q3JE81 Cluster: Putative uncharacterized protein; n=2; ...    45   0.002
UniRef50_Q1NAH1 Cluster: Sugar kinase; n=1; Sphingomonas sp. SKA...    45   0.002
UniRef50_Q1JY28 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A5VFD0 Cluster: Carbohydrate kinase, YjeF related prote...    45   0.002
UniRef50_Q6LM25 Cluster: Putative uncharacterized protein YJEF; ...    44   0.003
UniRef50_Q3AEB4 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q8TX67 Cluster: Short chain dehydrogenase fused to suga...    44   0.003
UniRef50_Q2AG96 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q1FLI2 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q1AXV8 Cluster: YjeF-related protein-like protein; n=1;...    44   0.004
UniRef50_Q0BSJ4 Cluster: Sugar kinase; n=2; Acetobacteraceae|Rep...    44   0.004
UniRef50_A3UD03 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q97CH2 Cluster: Putative uncharacterized protein TVG013...    44   0.004
UniRef50_A3DLN4 Cluster: Carbohydrate kinase, YjeF related prote...    44   0.004
UniRef50_Q74C72 Cluster: YjeF family protein; n=7; Desulfuromona...    43   0.005
UniRef50_Q3YSD9 Cluster: Sugar kinase; n=7; Anaplasmataceae|Rep:...    43   0.005
UniRef50_Q2JY00 Cluster: Carbohydrate kinase family protein; n=2...    43   0.005
UniRef50_O67377 Cluster: Putative uncharacterized protein; n=1; ...    43   0.005
UniRef50_A1HST2 Cluster: Carbohydrate kinase, YjeF related prote...    43   0.005
UniRef50_A0HCP3 Cluster: Carbohydrate kinase, YjeF related prote...    43   0.005
UniRef50_A4FZT3 Cluster: Carbohydrate kinase, YjeF related prote...    43   0.005
UniRef50_Q8D630 Cluster: Predicted sugar kinase; n=26; Vibrio|Re...    43   0.007
UniRef50_Q3ZZH2 Cluster: Carbohydrate kinase, yjeF-family; n=3; ...    43   0.007
UniRef50_A5ZVX2 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_A3ER71 Cluster: Putative sugar kinase; n=1; Leptospiril...    43   0.007
UniRef50_Q2NE83 Cluster: Predicted sugar kinase; n=1; Methanosph...    43   0.007
UniRef50_Q82Y67 Cluster: Possible sugar kinase; n=5; Betaproteob...    42   0.009
UniRef50_Q73MY6 Cluster: YjeF-related protein; n=1; Treponema de...    42   0.013
UniRef50_Q5LR39 Cluster: YjeF family protein; n=6; Rhodobacteral...    42   0.013
UniRef50_Q5KZV4 Cluster: Hypothetical conserved protein; n=2; Ge...    42   0.013
UniRef50_Q2NA19 Cluster: Sugar kinase; n=1; Erythrobacter litora...    42   0.013
UniRef50_A6GKI5 Cluster: Putative uncharacterized protein; n=1; ...    42   0.013
UniRef50_Q2G7E7 Cluster: YjeF-related protein-like protein; n=3;...    42   0.017
UniRef50_Q7NST2 Cluster: Putative uncharacterized protein; n=1; ...    41   0.022
UniRef50_Q5QW92 Cluster: C-terminal predicted sugar kinase fused...    41   0.022
UniRef50_A6D4V6 Cluster: Putative uncharacterized protein; n=1; ...    41   0.022
UniRef50_A0LK98 Cluster: Carbohydrate kinase, YjeF related prote...    41   0.022
UniRef50_A3H9S7 Cluster: Carbohydrate kinase, YjeF related prote...    41   0.022
UniRef50_P56176 Cluster: Uncharacterized protein HP_1363; n=4; H...    41   0.022
UniRef50_Q9A6W7 Cluster: YjeF family protein; n=4; Alphaproteoba...    41   0.029
UniRef50_Q7ULX4 Cluster: Putative uncharacterized protein; n=1; ...    41   0.029
UniRef50_Q0AB65 Cluster: Carbohydrate kinase, YjeF related prote...    41   0.029
UniRef50_A6DFZ1 Cluster: Putative YjeF-related sugar kinase; n=1...    41   0.029
UniRef50_Q7VVH8 Cluster: Putative uncharacterized protein; n=3; ...    40   0.038
UniRef50_Q72IV4 Cluster: Putative sugar kinase; n=2; Thermus the...    40   0.038
UniRef50_Q7CYK7 Cluster: AGR_C_3249p; n=2; Agrobacterium tumefac...    40   0.038
UniRef50_A2C456 Cluster: Predicted sugar kinase fused to unchara...    40   0.038
UniRef50_A1K788 Cluster: Putative uncharacterized protein; n=2; ...    40   0.038
UniRef50_Q6L1G0 Cluster: Putative sugar kinase; n=1; Picrophilus...    40   0.038
UniRef50_Q18HS3 Cluster: Predicted sugar kinase; n=5; Halobacter...    40   0.038
UniRef50_A6BEC2 Cluster: Putative uncharacterized protein; n=1; ...    40   0.051
UniRef50_O27324 Cluster: Conserved protein; n=1; Methanothermoba...    40   0.051
UniRef50_Q1U8B7 Cluster: YjeF-related protein-like; n=3; Lactoba...    40   0.067
UniRef50_Q1GHV9 Cluster: YjeF-related protein-like protein; n=3;...    40   0.067
UniRef50_A5KQZ2 Cluster: Putative uncharacterized protein; n=1; ...    40   0.067
UniRef50_A0B850 Cluster: Carbohydrate kinase, YjeF related prote...    40   0.067
UniRef50_P31806 Cluster: Uncharacterized protein yjeF; n=44; Ent...    40   0.067
UniRef50_UPI000038E147 Cluster: hypothetical protein Faci_030010...    39   0.12 
UniRef50_Q97LR4 Cluster: Predicted sugar kinase, N-terminal regi...    39   0.12 
UniRef50_Q6AK13 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_Q1IZ92 Cluster: YjeF-related protein-like protein; n=2;...    39   0.12 
UniRef50_A6GUK0 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_A1WUU1 Cluster: Carbohydrate kinase, YjeF related prote...    39   0.12 
UniRef50_A1I7Y5 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_Q89ZJ4 Cluster: Putative sugar kinase; n=5; Bacteroidal...    38   0.15 
UniRef50_A4A6L0 Cluster: Putative uncharacterized protein; n=1; ...    38   0.15 
UniRef50_A0NJZ4 Cluster: Sugar kinase; n=2; Oenococcus oeni|Rep:...    38   0.15 
UniRef50_A0M1H7 Cluster: Carbohydrate kinase; n=8; Bacteroidetes...    38   0.15 
UniRef50_Q5JER5 Cluster: YjeF-ralted probable carbohydrate kinas...    38   0.15 
UniRef50_Q4JCJ3 Cluster: Conserved Archaeal protein; n=4; Sulfol...    38   0.15 
UniRef50_A5UM68 Cluster: Sugar kinase, YjeF-related protein fami...    38   0.15 
UniRef50_Q7VF29 Cluster: Putative uncharacterized protein; n=1; ...    38   0.20 
UniRef50_Q6NEG9 Cluster: Putative uncharacterized protein; n=1; ...    38   0.20 
UniRef50_Q609D4 Cluster: YjeF-related protein; n=4; Bacteria|Rep...    38   0.20 
UniRef50_Q2SBB6 Cluster: Uncharacterized conserved protein; n=1;...    38   0.20 
UniRef50_A4EWA3 Cluster: YjeF family protein; n=6; Rhodobacterac...    38   0.20 
UniRef50_Q9Y9C5 Cluster: Putative uncharacterized protein; n=1; ...    38   0.20 
UniRef50_O29407 Cluster: Putative uncharacterized protein; n=1; ...    38   0.20 
UniRef50_Q89KF8 Cluster: Bll4947 protein; n=16; Alphaproteobacte...    38   0.27 
UniRef50_Q31EL4 Cluster: YjeF family protein; n=1; Thiomicrospir...    38   0.27 
UniRef50_A7AZ62 Cluster: Putative uncharacterized protein; n=1; ...    38   0.27 
UniRef50_Q12UW3 Cluster: YjeF-related protein; n=2; Methanosarci...    38   0.27 
UniRef50_Q41FT3 Cluster: Putative uncharacterized protein; n=1; ...    37   0.36 
UniRef50_Q0C0G6 Cluster: Carbohydrate kinase family protein; n=1...    37   0.36 
UniRef50_A4BHY6 Cluster: Fused predicted sugar kinase fused/unch...    37   0.36 
UniRef50_A3ZQ50 Cluster: Putative uncharacterized protein; n=1; ...    37   0.36 
UniRef50_Q4QFL5 Cluster: Putative uncharacterized protein; n=3; ...    37   0.36 
UniRef50_Q0LLI8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.47 
UniRef50_A6C2V3 Cluster: Putative uncharacterized protein; n=1; ...    37   0.47 
UniRef50_A2E0R1 Cluster: Putative uncharacterized protein; n=1; ...    37   0.47 
UniRef50_Q46AS3 Cluster: Putative uncharacterized protein; n=2; ...    37   0.47 
UniRef50_Q6MF43 Cluster: Putative uncharacterized protein; n=1; ...    36   0.62 
UniRef50_Q5WLC1 Cluster: Putative uncharacterized protein; n=1; ...    36   0.62 
UniRef50_Q15NR5 Cluster: Carbohydrate kinase, YjeF related prote...    36   0.62 
UniRef50_Q04U35 Cluster: Sugar kinase; n=2; Leptospira borgpeter...    36   0.62 
UniRef50_A2U7X6 Cluster: Carbohydrate kinase, YjeF related prote...    36   0.62 
UniRef50_A1U4D0 Cluster: Carbohydrate kinase, YjeF related prote...    36   0.62 
UniRef50_A7DRE3 Cluster: Carbohydrate kinase, YjeF related prote...    36   0.62 
UniRef50_Q7MRY0 Cluster: Putative uncharacterized protein; n=1; ...    36   0.82 
UniRef50_Q21H97 Cluster: Putative uncharacterized protein; n=2; ...    36   0.82 
UniRef50_A6M301 Cluster: Carbohydrate kinase, YjeF related prote...    36   0.82 
UniRef50_A0KGR6 Cluster: YjeF protein; n=1; Aeromonas hydrophila...    36   0.82 
UniRef50_A5Z6Q1 Cluster: Putative uncharacterized protein; n=1; ...    36   1.1  
UniRef50_A1ZZG6 Cluster: YjeF family protein; n=1; Microscilla m...    36   1.1  
UniRef50_Q58981 Cluster: Uncharacterized protein MJ1586; n=2; Me...    36   1.1  
UniRef50_Q8F7K5 Cluster: Putative uncharacterized protein; n=2; ...    35   1.4  
UniRef50_Q64XD8 Cluster: Putative sugar kinase; n=2; Bacteroides...    35   1.4  
UniRef50_A0RRH5 Cluster: YjeF-related protein; n=2; Proteobacter...    35   1.4  
UniRef50_Q8ESK8 Cluster: Hypothetical conserved protein; n=1; Oc...    35   1.9  
UniRef50_Q1YRZ2 Cluster: Putative uncharacterized protein; n=1; ...    35   1.9  
UniRef50_Q1N268 Cluster: Putative uncharacterized protein; n=1; ...    35   1.9  
UniRef50_A7GW49 Cluster: YjeF-related protein; n=2; Campylobacte...    35   1.9  
UniRef50_A3RYF0 Cluster: Nitric-oxide reductase subunit C; n=18;...    35   1.9  
UniRef50_A3HYM1 Cluster: Putative sugar kinase; n=1; Algoriphagu...    35   1.9  
UniRef50_A3DIW6 Cluster: Carbohydrate kinase, YjeF related prote...    35   1.9  
UniRef50_Q8NSS3 Cluster: Predicted sugar kinase; n=3; Corynebact...    34   2.5  
UniRef50_Q7VH02 Cluster: Putative uncharacterized protein; n=2; ...    34   2.5  
UniRef50_Q62JL9 Cluster: Carbohydrate kinase, putative; n=18; Bu...    34   2.5  
UniRef50_Q18A74 Cluster: Putative carbohydrate kinase; n=3; Clos...    34   2.5  
UniRef50_Q03UV9 Cluster: Putative uncharacterized protein; n=1; ...    34   2.5  
UniRef50_Q8EJ73 Cluster: YjeF protein; n=16; Shewanella|Rep: Yje...    34   3.3  
UniRef50_Q4JU58 Cluster: Putative uncharacterized protein; n=1; ...    34   3.3  
UniRef50_Q3VXG5 Cluster: Twin-arginine translocation pathway sig...    34   3.3  
UniRef50_Q0IC48 Cluster: Carbohydrate kinase family protein; n=9...    34   3.3  
UniRef50_A4C8M1 Cluster: Putative uncharacterized protein; n=1; ...    34   3.3  
UniRef50_UPI00015BAF79 Cluster: carbohydrate kinase, YjeF relate...    33   4.4  
UniRef50_A5CSB9 Cluster: Putative uncharacterized protein; n=1; ...    33   4.4  
UniRef50_A2BXZ7 Cluster: Predicted sugar kinase fused to unchara...    33   4.4  
UniRef50_Q89ZF4 Cluster: Xylulose kinase; n=1; Bacteroides theta...    33   5.8  
UniRef50_Q31NR6 Cluster: Putative uncharacterized protein; n=2; ...    33   5.8  
UniRef50_A6SY82 Cluster: Uncharacterized conserved protein; n=2;...    33   5.8  
UniRef50_Q45H72 Cluster: Laminin alpha 1; n=9; Euteleostomi|Rep:...    33   7.7  
UniRef50_A6F3K0 Cluster: Putative carbohydrate kinase; n=1; Mari...    33   7.7  

>UniRef50_Q8NCW5 Cluster: Apolipoprotein A-I-binding protein
           precursor; n=32; Eukaryota|Rep: Apolipoprotein
           A-I-binding protein precursor - Homo sapiens (Human)
          Length = 288

 Score =  108 bits (260), Expect = 1e-22
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (4%)
 Frame = +2

Query: 257 NIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP 436
           N G    S    +TV +YL+Q EA A+DQ+LF EY+FSVDQLMELAGLS A+AIAK +PP
Sbjct: 42  NSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPP 101

Query: 437 STHS----SALIVCGPGNNGGDGLVAAR 508
           ++ S    + L++CGPGNNGGDGLV AR
Sbjct: 102 TSMSRSPPTVLVICGPGNNGGDGLVCAR 129



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++LFGY  +++YPKR  KPL+  L+ QC + ++  + ++P
Sbjct: 130 HLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP 170


>UniRef50_Q4TBP7 Cluster: Chromosome undetermined SCAF7101, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF7101,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 244

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 46/72 (63%), Positives = 55/72 (76%), Gaps = 4/72 (5%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFP-PS---THSSALIVCGP 472
           +YL Q EA  +DQ+LF +Y FSVDQLMELAGLS A+A+A+ +P PS      S L+VCGP
Sbjct: 55  KYLGQEEAQRIDQELFGQYGFSVDQLMELAGLSCATAVARAYPLPSLLKASPSVLVVCGP 114

Query: 473 GNNGGDGLVAAR 508
           GNNGGDGLV AR
Sbjct: 115 GNNGGDGLVCAR 126


>UniRef50_A6QTN1 Cluster: Predicted protein; n=4;
           Pezizomycotina|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 182

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 43/68 (63%), Positives = 53/68 (77%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           R +N  +AA+LD+DL  E  FS+DQLMELAGLSV+ A+ +V PPS   + L+ CGPGNNG
Sbjct: 26  RTINAKDAASLDRDLMNEGGFSLDQLMELAGLSVSQAVYRVHPPSKGRNVLVACGPGNNG 85

Query: 485 GDGLVAAR 508
           GDGLVAAR
Sbjct: 86  GDGLVAAR 93


>UniRef50_Q17GW6 Cluster: Apolipoprotein a binding protein; n=1;
           Aedes aegypti|Rep: Apolipoprotein a binding protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 311

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 46/71 (64%), Positives = 53/71 (74%), Gaps = 3/71 (4%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVF--PPST-HSSALIVCGPG 475
           +YLNQ EA ++D++LF EYKFSVDQLMELAGLS A  I   +  P ST     L+ CGPG
Sbjct: 81  KYLNQHEAISVDEELFNEYKFSVDQLMELAGLSCAHVINDCYGSPQSTVKRKVLVCCGPG 140

Query: 476 NNGGDGLVAAR 508
           NNGGDGLVAAR
Sbjct: 141 NNGGDGLVAAR 151



 Score = 35.9 bits (79), Expect = 0.82
 Identities = 14/41 (34%), Positives = 23/41 (56%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLP 630
           +++L  ++  V+YPKRT K L+ NL  QC    + +    P
Sbjct: 152 HLKLMNFDAHVYYPKRTEKDLFINLQHQCESMGITVSKDCP 192


>UniRef50_O13725 Cluster: Meiotically up-regulated gene 182 protein;
           n=9; Ascomycota|Rep: Meiotically up-regulated gene 182
           protein - Schizosaccharomyces pombe (Fission yeast)
          Length = 242

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 42/66 (63%), Positives = 51/66 (77%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           L+ S A ALD +L +   FS+DQLMELAGLSV+ A+ + +PPS +S  LI CGPGNNGGD
Sbjct: 6   LSASAAKALDAELMSAGAFSIDQLMELAGLSVSQAVYREYPPSQYSQVLICCGPGNNGGD 65

Query: 491 GLVAAR 508
           GLVAAR
Sbjct: 66  GLVAAR 71


>UniRef50_A1CAM2 Cluster: AI-BP family protein; n=4;
           Trichocomaceae|Rep: AI-BP family protein - Aspergillus
           clavatus
          Length = 260

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 40/66 (60%), Positives = 52/66 (78%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           ++  +AAALD+DL     +S+DQLMELAGLSV+ A+ ++ PPS   + L+VCGPGNNGGD
Sbjct: 29  ISSKDAAALDKDLMEVGGWSLDQLMELAGLSVSQAVYRLHPPSAAKNVLVVCGPGNNGGD 88

Query: 491 GLVAAR 508
           GLVAAR
Sbjct: 89  GLVAAR 94


>UniRef50_Q5KJ55 Cluster: Protein-binding protein, putative; n=2;
           Filobasidiella neoformans|Rep: Protein-binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 249

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 40/69 (57%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEY-KFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNN 481
           RY++Q  A  +D +L +    FS+DQLMELAGLS A A+AK FPP+ H   ++ CGPGN 
Sbjct: 4   RYISQKLAQQIDVELMSASGAFSLDQLMELAGLSCAQALAKSFPPTKHKHVMVACGPGNQ 63

Query: 482 GGDGLVAAR 508
           GGDGLVAAR
Sbjct: 64  GGDGLVAAR 72


>UniRef50_Q4PB52 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 333

 Score = 82.6 bits (195), Expect = 7e-15
 Identities = 38/69 (55%), Positives = 51/69 (73%), Gaps = 1/69 (1%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYK-FSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNN 481
           RY++ S A  +D+DL +    FS+DQLMELAGLS A A+ + +PP+ + + L+ CGPGN 
Sbjct: 102 RYIDASTAQKIDEDLMSASGGFSLDQLMELAGLSCAQAVFECYPPTKYPNVLVACGPGNQ 161

Query: 482 GGDGLVAAR 508
           GGDGLVAAR
Sbjct: 162 GGDGLVAAR 170


>UniRef50_A3LR70 Cluster: Predicted protein; n=5;
           Saccharomycetales|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 247

 Score = 82.6 bits (195), Expect = 7e-15
 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSS---ALIVCGPGNN 481
           L+   AA LDQ+L +   FS+DQLMELAGLSVA AI K +PP T S     L++ GPGNN
Sbjct: 9   LSAKAAAQLDQELMSTGAFSIDQLMELAGLSVAQAIYKQYPPPTASKVSRVLVLVGPGNN 68

Query: 482 GGDGLVAAR 508
           GGDGLVAAR
Sbjct: 69  GGDGLVAAR 77



 Score = 37.5 bits (83), Expect = 0.27
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 523 GYNVSVHYPKRTPKPLYENLLEQCIRFNVNIIDKLPDTK 639
           GY+  ++YPKRT  PLY NL+ Q    +V  ++ L + K
Sbjct: 84  GYDPVLYYPKRTKNPLYANLVTQLQDLDVGEVETLDEVK 122


>UniRef50_UPI000049849E Cluster: conserved hypothetical protein;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: conserved
           hypothetical protein - Entamoeba histolytica HM-1:IMSS
          Length = 240

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFP-PSTHSSALIVCGPGNN 481
           +YL Q +A  LD++L  +YK+S+ QLME+AGL+VA  + K +P    +   LI+CGPGNN
Sbjct: 19  QYLTQEQAIKLDEELMGKYKYSLVQLMEIAGLAVAQVVTKEYPIEKGNKRVLILCGPGNN 78

Query: 482 GGDGLVAARICS 517
           GGDGLV  R  S
Sbjct: 79  GGDGLVCGRYLS 90


>UniRef50_Q9XW15 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 348

 Score = 79.0 bits (186), Expect = 9e-14
 Identities = 37/67 (55%), Positives = 48/67 (71%)
 Frame = +2

Query: 308 YLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGG 487
           ++ Q  AA +D+ LFT+Y F V+QLMELAGL+ A AIA  +P    S+  ++CGPGNNGG
Sbjct: 125 FIGQKLAAQIDEQLFTKYGFKVEQLMELAGLAAAQAIAAHYP---KSNVAVLCGPGNNGG 181

Query: 488 DGLVAAR 508
           DG V AR
Sbjct: 182 DGFVCAR 188


>UniRef50_UPI00006CBCE8 Cluster: YjeF-related protein, N-terminus
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: YjeF-related protein, N-terminus containing
           protein - Tetrahymena thermophila SB210
          Length = 248

 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 45/94 (47%), Positives = 56/94 (59%), Gaps = 4/94 (4%)
 Frame = +2

Query: 281 MNQCNTVTRYLNQSEAAALDQDLFTE-YKFSVDQLMELAGLSVASA---IAKVFPPSTHS 448
           MNQ  T   YL+Q EA   DQDL +    +S+D LMELAG SVA     I K +      
Sbjct: 1   MNQSIT---YLSQKEAYESDQDLMSNRVGYSIDILMELAGQSVAHCFHHINKKYHNQKLK 57

Query: 449 SALIVCGPGNNGGDGLVAARICSCSDTMYRYIIL 550
           + L++CGPGNNGGDG+VAAR  +  D  Y+  IL
Sbjct: 58  NILVICGPGNNGGDGMVAARHIAHLDKAYKLTIL 91


>UniRef50_A0E3W6 Cluster: Chromosome undetermined scaffold_77, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_77,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 233

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 35/78 (44%), Positives = 55/78 (70%), Gaps = 2/78 (2%)
 Frame = +2

Query: 281 MNQCNTVTRYLNQSEAAALDQDLFTE-YKFSVDQLMELAGLSVASAIAKVFPPS-THSSA 454
           M Q N ++ YLNQ ++   D +L +E   F++DQLMELAG S+A+ + ++     +++  
Sbjct: 1   MQQLNKIS-YLNQIQSQQFDVELMSEEVGFTLDQLMELAGQSIANTVVQLNKEGKSYNKI 59

Query: 455 LIVCGPGNNGGDGLVAAR 508
           L++CGPGNNGGDG+V+AR
Sbjct: 60  LVLCGPGNNGGDGIVSAR 77


>UniRef50_A4RCG8 Cluster: Putative uncharacterized protein; n=2;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 205

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 33/58 (56%), Positives = 41/58 (70%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           L+   A ALDQ+L +   FS+DQLMELAGLSV+ A+ KV PP+     L+ CGPGNNG
Sbjct: 6   LSAKAATALDQELMSTCAFSLDQLMELAGLSVSQAVFKVHPPTRGRRILVACGPGNNG 63


>UniRef50_Q6CDL0 Cluster: Yarrowia lipolytica chromosome B of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome B of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 245

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 2/72 (2%)
 Frame = +2

Query: 299 VTRYLNQSEAAALDQDLFTEYK-FSVDQLMELAGLSVASAIAKVFPPSTHSS-ALIVCGP 472
           + + L  S+AAALD +L      FS+DQLMELAGLSVA A+ K           L++ GP
Sbjct: 7   IMKCLTSSKAAALDAELMAPSGGFSIDQLMELAGLSVAQAVYKYDKSLAQGKQVLVLVGP 66

Query: 473 GNNGGDGLVAAR 508
           GNNGGDGLVAAR
Sbjct: 67  GNNGGDGLVAAR 78


>UniRef50_Q7QU52 Cluster: GLP_725_13171_12350; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_725_13171_12350 - Giardia lamblia
           ATCC 50803
          Length = 273

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 33/65 (50%), Positives = 44/65 (67%), Gaps = 3/65 (4%)
 Frame = +2

Query: 323 EAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSS---ALIVCGPGNNGGDG 493
           +A  LD+DL  +  +S++QLME+AG +VA A       ++  S    L+VCGPGNNGGDG
Sbjct: 17  QALKLDEDLINKCNYSIEQLMEIAGTAVAQATTHYIESTSSVSKAGVLVVCGPGNNGGDG 76

Query: 494 LVAAR 508
           LVAAR
Sbjct: 77  LVAAR 81


>UniRef50_UPI0001555A9B Cluster: PREDICTED: similar to apoliprotein
           A-I binding protein, partial; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to apoliprotein A-I
           binding protein, partial - Ornithorhynchus anatinus
          Length = 237

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/38 (81%), Positives = 35/38 (92%)
 Frame = +2

Query: 314 NQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKV 427
           +Q EA A+DQDLFTEY+FSVDQLMELAGLS A+AIAKV
Sbjct: 46  SQQEAQAVDQDLFTEYRFSVDQLMELAGLSCATAIAKV 83


>UniRef50_Q7RDA5 Cluster: Homo sapiens TGR-CL10C; n=6;
           Plasmodium|Rep: Homo sapiens TGR-CL10C - Plasmodium
           yoelii yoelii
          Length = 162

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 30/62 (48%), Positives = 42/62 (67%), Gaps = 1/62 (1%)
 Frame = +2

Query: 326 AAALDQDLFTEYK-FSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           A  +D++L ++   ++  QLMELAGLS++  I K +  +     +I CGPGNNGGDGLVA
Sbjct: 7   AKTIDEELMSDVVGYTTSQLMELAGLSISQIIFKNYDLANFKKIIICCGPGNNGGDGLVA 66

Query: 503 AR 508
           AR
Sbjct: 67  AR 68


>UniRef50_A6XGL0 Cluster: Apolipoprotein A1 binding protein; n=19;
           Euteleostomi|Rep: Apolipoprotein A1 binding protein -
           Homo sapiens (Human)
          Length = 299

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)
 Frame = +2

Query: 320 SEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFP-PS---THSSALIVCGPGNNGG 487
           +EAAAL+++L  +Y+F   QL+EL G + A A+ K FP P+      + L+VCGP  NG 
Sbjct: 72  AEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGA 131

Query: 488 DGLVAAR 508
            GLV AR
Sbjct: 132 VGLVCAR 138


>UniRef50_P40165 Cluster: Uncharacterized protein YNL200C; n=6;
           Saccharomycetales|Rep: Uncharacterized protein YNL200C -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 246

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/68 (45%), Positives = 41/68 (60%), Gaps = 7/68 (10%)
 Frame = +2

Query: 326 AAALDQDLF-TEYKFSVDQLMELAGLSVASAIAKVFP------PSTHSSALIVCGPGNNG 484
           AA +D++L   +  F++ QLMELAG SVA A+ + FP              ++ GPGNNG
Sbjct: 12  AAEIDKELMGPQIGFTLQQLMELAGFSVAQAVCRQFPLRGKTETEKGKHVFVIAGPGNNG 71

Query: 485 GDGLVAAR 508
           GDGLV AR
Sbjct: 72  GDGLVCAR 79



 Score = 32.7 bits (71), Expect = 7.7
 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
 Frame = +1

Query: 508 NMQLFGYNVSVHYPKRTPK-PLYENLLEQCIRFNVNIIDK 624
           +++LFGYN  V YPKR+ +   Y+ L+ Q   F V ++ +
Sbjct: 80  HLKLFGYNPVVFYPKRSERTEFYKQLVHQLNFFKVPVLSQ 119


>UniRef50_Q67K78 Cluster: Putative sugar kinase; n=1;
           Symbiobacterium thermophilum|Rep: Putative sugar kinase
           - Symbiobacterium thermophilum
          Length = 520

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 30/68 (44%), Positives = 41/68 (60%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           + ++  +  A++  LF +Y F+   LMELAG  VA  IA+          ++VCG GNNG
Sbjct: 2   KVVSGEQMRAIEARLFDQYGFTSAILMELAGRQVA-LIARRMMQGRSGPIVVVCGKGNNG 60

Query: 485 GDGLVAAR 508
           GDGLVAAR
Sbjct: 61  GDGLVAAR 68


>UniRef50_Q28S78 Cluster: YjeF-related protein-like protein; n=3;
           Alphaproteobacteria|Rep: YjeF-related protein-like
           protein - Jannaschia sp. (strain CCS1)
          Length = 581

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 28/71 (39%), Positives = 42/71 (59%)
 Frame = +2

Query: 299 VTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGN 478
           +T  +  +E  A++ D     + +  +LME AG  V  AI + +P +   SA ++CGPGN
Sbjct: 1   MTELVTAAEMRAIEADAIASGEVTGLELMERAGRGVVDAILRQWPDA--QSATVLCGPGN 58

Query: 479 NGGDGLVAARI 511
           NGGDG V AR+
Sbjct: 59  NGGDGYVIARL 69


>UniRef50_Q01GB8 Cluster: ABL161Cp; n=2; Ostreococcus|Rep: ABL161Cp
           - Ostreococcus tauri
          Length = 547

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 3/89 (3%)
 Frame = +2

Query: 290 CNTVTRYLNQSEAAALDQDLFTEY---KFSVDQLMELAGLSVASAIAKVFPPSTHSSALI 460
           C    ++L+ +EA ALD DL         +++ LM  AG   ASA  +    +   +  +
Sbjct: 269 CRYGGKFLSAAEARALDDDLIAGVGCEASTLEALMRRAGEQAASATLERARDA--ETFAV 326

Query: 461 VCGPGNNGGDGLVAARICSCSDTMYRYII 547
           +CGPGNNGGDGLV AR C+      R ++
Sbjct: 327 LCGPGNNGGDGLVLARACALRREGVRVVV 355


>UniRef50_A6DCM9 Cluster: Putative uncharacterized protein; n=1;
           Caminibacter mediatlanticus TB-2|Rep: Putative
           uncharacterized protein - Caminibacter mediatlanticus
           TB-2
          Length = 463

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 32/82 (39%), Positives = 41/82 (50%)
 Frame = +2

Query: 323 EAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           E  + D+  +  YK + D LME A  S+A  I K FP    S   IV GPGNNG DG+  
Sbjct: 7   EVYSFDKKCYERYKLTEDILMEHAAYSIALEIYKRFPK--FSKINIVAGPGNNGADGITL 64

Query: 503 ARICSCSDTMYRYIILNAHPNL 568
           ARI      +  Y+ L    N+
Sbjct: 65  ARILWGDYIVNLYLPLGTKSNM 86


>UniRef50_Q1Q4I3 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Kuenenia stuttgartiensis|Rep: Putative
           uncharacterized protein - Candidatus Kuenenia
           stuttgartiensis
          Length = 227

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 28/66 (42%), Positives = 33/66 (50%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           L + E   LD+    EYK     LME AG +VA  + +           IVCG GNNGGD
Sbjct: 5   LTREEMRELDRKAIEEYKIPGILLMENAGRNVAEEVVRETDDLQREKIAIVCGKGNNGGD 64

Query: 491 GLVAAR 508
           G V AR
Sbjct: 65  GFVTAR 70


>UniRef50_A6P119 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 509

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 25/58 (43%), Positives = 35/58 (60%)
 Frame = +2

Query: 335 LDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +D+    E      QLME A  +VA A++++    T   A++ CGPGNNGGDG+ AAR
Sbjct: 12  MDRTAIEERGIPSVQLMEAAACAVARAVSELAGGKTDGRAVLFCGPGNNGGDGVAAAR 69


>UniRef50_A7HLS8 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Fervidobacterium nodosum Rt17-B1|Rep: Carbohydrate
           kinase, YjeF related protein - Fervidobacterium nodosum
           Rt17-B1
          Length = 504

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/66 (34%), Positives = 38/66 (57%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           +   E   L++    +++ + + LME AG+S   AI   +   +  + +++CGPGNNGGD
Sbjct: 4   VTSQEMRELEKCAIEKFEMTEEILMERAGISTVQAIWNEYGSLSEKNFVVICGPGNNGGD 63

Query: 491 GLVAAR 508
           G V AR
Sbjct: 64  GYVIAR 69


>UniRef50_A6LNX7 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Thermosipho melanesiensis BI429|Rep: Carbohydrate
           kinase, YjeF related protein - Thermosipho melanesiensis
           BI429
          Length = 501

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/68 (38%), Positives = 38/68 (55%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           R ++ +E   L++    ++  S   LME AG+S    + +     +  S L+ CGPGNNG
Sbjct: 2   RVVSSNEMKMLERKTIEDFGISNLVLMERAGVSTVEVLWRELGNLSQYSFLVFCGPGNNG 61

Query: 485 GDGLVAAR 508
           GDGLV AR
Sbjct: 62  GDGLVIAR 69


>UniRef50_Q2S580 Cluster: Predicted sugar kinase; n=1; Salinibacter
           ruber DSM 13855|Rep: Predicted sugar kinase -
           Salinibacter ruber (strain DSM 13855)
          Length = 542

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/59 (42%), Positives = 32/59 (54%)
 Frame = +2

Query: 332 ALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           A D+    EY      LME AG   A+ I   + P    + +++CG GNNGGDGLV AR
Sbjct: 21  AADRYTIEEYGLPSFTLMETAGRGCAARIQDAYGPLEDEAVVVLCGKGNNGGDGLVVAR 79


>UniRef50_A7HCT7 Cluster: Carbohydrate kinase, YjeF related protein;
           n=4; Cystobacterineae|Rep: Carbohydrate kinase, YjeF
           related protein - Anaeromyxobacter sp. Fw109-5
          Length = 511

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 26/69 (37%), Positives = 38/69 (55%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           R +  +E  A+D+     +      LM+ AG +VA A+  +  P      ++VCG GNNG
Sbjct: 2   RLVGSAEMRAIDRAAIDAFGVPSLALMDRAGRAVAEAVRSLCAPG--GRIVVVCGGGNNG 59

Query: 485 GDGLVAARI 511
           GDG VAAR+
Sbjct: 60  GDGYVAARV 68


>UniRef50_A5D4H8 Cluster: Predicted Carbohydrate kinase; n=4;
           Clostridia|Rep: Predicted Carbohydrate kinase -
           Pelotomaculum thermopropionicum SI
          Length = 527

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 29/68 (42%), Positives = 34/68 (50%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           R +   E  ALD+    EY  S   LME AG  VA  + +V          +  G GNNG
Sbjct: 2   RVVTAGEMKALDKAAIEEYGISGLVLMENAGRQVAEVVRQVLGEVRGRVITVFIGKGNNG 61

Query: 485 GDGLVAAR 508
           GDGLVAAR
Sbjct: 62  GDGLVAAR 69


>UniRef50_P74217 Cluster: Uncharacterized protein sll1433; n=2;
           Chroococcales|Rep: Uncharacterized protein sll1433 -
           Synechocystis sp. (strain PCC 6803)
          Length = 524

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 26/66 (39%), Positives = 39/66 (59%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           ++ ++   ++  LFT+    V  LME A L  A  +  ++P ST+    +V GPG+NGGD
Sbjct: 12  VSAAQMQEIENWLFTQ-GMPVAALMEKAALQTAQRLLTLYPLSTYPRIGVVVGPGHNGGD 70

Query: 491 GLVAAR 508
           GLV AR
Sbjct: 71  GLVVAR 76


>UniRef50_Q7NIE6 Cluster: Glr2237 protein; n=1; Gloeobacter
           violaceus|Rep: Glr2237 protein - Gloeobacter violaceus
          Length = 508

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/46 (50%), Positives = 31/46 (67%)
 Frame = +2

Query: 371 VDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           V+ LME AGL +A+AIA  +P   +    ++ GPG+NGGD LV AR
Sbjct: 29  VEALMEKAGLRLAAAIAADYPAGGYPRVGVLVGPGHNGGDALVVAR 74


>UniRef50_A6FF52 Cluster: Putative uncharacterized protein; n=1;
           Moritella sp. PE36|Rep: Putative uncharacterized protein
           - Moritella sp. PE36
          Length = 470

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +2

Query: 323 EAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           + +ALD+    ++  S D LME A  S+   I  +F  S + + LIVCG GNNG DG+  
Sbjct: 7   DVSALDKRCVDKFGLSEDLLMEHAAASMMQYIRGMF--SNNETILIVCGAGNNGADGIAL 64

Query: 503 ARI 511
           AR+
Sbjct: 65  ARL 67


>UniRef50_A2BLC0 Cluster: Conserved archaeal protein; n=1;
           Hyperthermus butylicus DSM 5456|Rep: Conserved archaeal
           protein - Hyperthermus butylicus (strain DSM 5456 / JCM
           9403)
          Length = 537

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/44 (59%), Positives = 29/44 (65%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           QLME AG SVA   AK+  P   S  ++  GPG NGGDGLVAAR
Sbjct: 34  QLMENAGRSVAEEAAKLAKPG--SRVVVFAGPGGNGGDGLVAAR 75


>UniRef50_A5UYR5 Cluster: Carbohydrate kinase, YjeF related protein;
           n=4; Chloroflexaceae|Rep: Carbohydrate kinase, YjeF
           related protein - Roseiflexus sp. RS-1
          Length = 556

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 24/44 (54%), Positives = 28/44 (63%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           LME AG  VA    +V        AL++ GPGNNGGDGLVAAR+
Sbjct: 27  LMEQAGAGVARVALEVSGDPVGRRALVLVGPGNNGGDGLVAARL 70


>UniRef50_Q648I4 Cluster: Predicted sugar kinase; n=3; Archaea|Rep:
           Predicted sugar kinase - uncultured archaeon GZfos37D1
          Length = 501

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 30/68 (44%), Positives = 38/68 (55%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           R++   E AALD++    Y     QLME AG +VA+ I K F     +S  +V G GNNG
Sbjct: 3   RHITSEEMAALDENC-KFYGLIPLQLMENAGANVANEIKKRFS-GEGTSVTVVAGKGNNG 60

Query: 485 GDGLVAAR 508
           GD   AAR
Sbjct: 61  GDAFAAAR 68


>UniRef50_Q8KD16 Cluster: YjeF family protein; n=10;
           Chlorobiaceae|Rep: YjeF family protein - Chlorobium
           tepidum
          Length = 527

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 28/69 (40%), Positives = 34/69 (49%), Gaps = 3/69 (4%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHS---SALIVCGPGNN 481
           L   E +  D+    E +    +LMELAG      IA+ F         SA +VCG GNN
Sbjct: 5   LTAREMSLADRAAIEELRTGETRLMELAGRETVRMIAERFESGRSLDGLSAFVVCGKGNN 64

Query: 482 GGDGLVAAR 508
           GGDG V AR
Sbjct: 65  GGDGFVVAR 73


>UniRef50_A6Q6K8 Cluster: Putative uncharacterized protein; n=1;
           Sulfurovum sp. NBC37-1|Rep: Putative uncharacterized
           protein - Sulfurovum sp. (strain NBC37-1)
          Length = 481

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 31/91 (34%), Positives = 44/91 (48%), Gaps = 7/91 (7%)
 Frame = +2

Query: 332 ALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP-------STHSSALIVCGPGNNGGD 490
           A+D+  + E   + D LME A L +A  I + FP         T  + LIV GPGNNG D
Sbjct: 10  AMDKKCYEELHLTEDILMEHAALGMARYIWQKFPKYQDGDNAKTIKTVLIVAGPGNNGAD 69

Query: 491 GLVAARICSCSDTMYRYIILNAHPNLCMKTF 583
           G+  AR+   S  +  Y+      ++  K F
Sbjct: 70  GIALARLLFGSYKIKLYMPFGQKTDMAKKQF 100


>UniRef50_Q3SF10 Cluster: Putative uncharacterized protein; n=1;
           Thiobacillus denitrificans ATCC 25259|Rep: Putative
           uncharacterized protein - Thiobacillus denitrificans
           (strain ATCC 25259)
          Length = 482

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/52 (46%), Positives = 32/52 (61%)
 Frame = +2

Query: 356 EYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           E +F+ D LME AG + A+ +A           L++ GPGNNGGD LVAAR+
Sbjct: 32  ETRFAADGLMERAG-AAAAELAASLAGEAGGPVLVLVGPGNNGGDALVAARL 82


>UniRef50_Q30U34 Cluster: Putative uncharacterized protein; n=1;
           Thiomicrospira denitrificans ATCC 33889|Rep: Putative
           uncharacterized protein - Thiomicrospira denitrificans
           (strain ATCC 33889 / DSM 1351)
          Length = 454

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 27/63 (42%), Positives = 34/63 (53%)
 Frame = +2

Query: 323 EAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           E A+LD+  + E+  S D LME A   +A  I   F  +   S  IVCG GNNG DGL  
Sbjct: 7   EVASLDERCYREFYLSEDILMEHAAHGMAEYIRSNFKKNVKIS--IVCGSGNNGADGLAL 64

Query: 503 ARI 511
            R+
Sbjct: 65  GRL 67


>UniRef50_A5IIL1 Cluster: Carbohydrate kinase, YjeF related protein;
           n=2; Thermotoga|Rep: Carbohydrate kinase, YjeF related
           protein - Thermotoga petrophila RKU-1
          Length = 498

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 26/68 (38%), Positives = 34/68 (50%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           R     E   +D+    EY      LME AG+SV  A+ +     +    L++CG GNNG
Sbjct: 2   RVATAQEMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNG 61

Query: 485 GDGLVAAR 508
           GDG V AR
Sbjct: 62  GDGFVVAR 69


>UniRef50_Q3A726 Cluster: Sugar kinase domain containing protein;
           n=3; cellular organisms|Rep: Sugar kinase domain
           containing protein - Pelobacter carbinolicus (strain DSM
           2380 / Gra Bd 1)
          Length = 524

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 24/65 (36%), Positives = 37/65 (56%)
 Frame = +2

Query: 314 NQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDG 493
           N  +  A+D+     Y+   + LME AG +  S + ++  P  + + +I+CG GNNGGDG
Sbjct: 5   NVVQMRAMDRAAIDRYRIPEEILMENAGQAAFSVLGRM-GPLANRTFVILCGLGNNGGDG 63

Query: 494 LVAAR 508
            V AR
Sbjct: 64  FVVAR 68


>UniRef50_Q0AQ13 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Maricaulis maris MCS10|Rep: Carbohydrate kinase,
           YjeF related protein - Maricaulis maris (strain MCS10)
          Length = 476

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 27/62 (43%), Positives = 37/62 (59%)
 Frame = +2

Query: 383 MELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYIILNAHP 562
           M+ AG +VA+AI   + P      L++ GPGNNGGDGLVAAR+   +    R ++L A  
Sbjct: 1   MDRAGRAVANAIRARWAPVP---VLVLAGPGNNGGDGLVAARVLREAGWPVRVMLLAARE 57

Query: 563 NL 568
            L
Sbjct: 58  GL 59


>UniRef50_A6Q1C5 Cluster: Putative uncharacterized protein; n=1;
           Nitratiruptor sp. SB155-2|Rep: Putative uncharacterized
           protein - Nitratiruptor sp. (strain SB155-2)
          Length = 464

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 25/58 (43%), Positives = 32/58 (55%)
 Frame = +2

Query: 335 LDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LDQ  +  Y    D LME A  +++ A+ K       +  LIV GPGNNGGDG+  AR
Sbjct: 11  LDQKCYQTYNLPEDILMEHAAAALSEAVKKRVDEG--AKILIVAGPGNNGGDGVACAR 66


>UniRef50_A5GUP7 Cluster: Predicted sugar kinase fused to a
           uncharacterized domain; n=2; Synechococcus|Rep:
           Predicted sugar kinase fused to a uncharacterized domain
           - Synechococcus sp. (strain RCC307)
          Length = 514

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 26/58 (44%), Positives = 35/58 (60%)
 Frame = +2

Query: 335 LDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           L++ LF +    V  LME AGL +A A+ +  P       L++ GPG+NGGDGLV AR
Sbjct: 21  LEEALFAQ-GLPVAALMEQAGLGLAQAVLQ-HPDLNRHGLLVLVGPGHNGGDGLVVAR 76


>UniRef50_Q4DSR2 Cluster: Putative uncharacterized protein; n=3;
           Trypanosoma|Rep: Putative uncharacterized protein -
           Trypanosoma cruzi
          Length = 595

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/60 (36%), Positives = 35/60 (58%)
 Frame = +2

Query: 338 DQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICS 517
           +++   E+K ++  LM+ AG +      + +P S H   LI+CG GNNGGDG   AR+ +
Sbjct: 35  EEEAAREHKITLYDLMQRAGKAAFGVFRREYPSSRHW--LILCGSGNNGGDGFEVARLAA 92


>UniRef50_A7I9D2 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Candidatus Methanoregula boonei 6A8|Rep:
           Carbohydrate kinase, YjeF related protein -
           Methanoregula boonei (strain 6A8)
          Length = 480

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 23/44 (52%), Positives = 30/44 (68%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           QLME AG ++A A+ +  P     + L+VCG GNNGGDG+ AAR
Sbjct: 44  QLMESAGRALADAVLEYTP----KNVLVVCGRGNNGGDGMAAAR 83


>UniRef50_A2ST57 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Methanocorpusculum labreanum Z|Rep: Carbohydrate
           kinase, YjeF related protein - Methanocorpusculum
           labreanum (strain ATCC 43576 / DSM 4855 / Z)
          Length = 458

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 25/51 (49%), Positives = 31/51 (60%)
 Frame = +2

Query: 356 EYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +Y  S  Q ME AG  +A+A+    P    +S LI+CG GNNGGDG V AR
Sbjct: 28  DYGISAAQRMESAGSVLAAAVRSECP----ASVLILCGTGNNGGDGFVCAR 74


>UniRef50_Q98N17 Cluster: Mlr0346 protein; n=10; Rhizobiales|Rep:
           Mlr0346 protein - Rhizobium loti (Mesorhizobium loti)
          Length = 512

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 23/48 (47%), Positives = 32/48 (66%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCS 523
           LM+ AG +VA+ +   +P +  S   ++CGPGNNGGDG V ARI + S
Sbjct: 29  LMQRAGEAVAAVVLARYPAA--SRVHVLCGPGNNGGDGYVVARILAGS 74


>UniRef50_Q1ILG7 Cluster: Putative uncharacterized protein; n=1;
           Acidobacteria bacterium Ellin345|Rep: Putative
           uncharacterized protein - Acidobacteria bacterium
           (strain Ellin345)
          Length = 522

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 2/59 (3%)
 Frame = +2

Query: 338 DQDLFTEYKFSVDQL--MELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           D D  T  ++ V  L  ME AG + A  + + +P +   S  +VCG GNNGGDG VAAR
Sbjct: 11  DIDRITTERYGVPSLTLMENAGRAAAEMVVENYPEAR--SIAVVCGKGNNGGDGFVAAR 67


>UniRef50_A0LCV3 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Magnetococcus sp. MC-1|Rep: Carbohydrate kinase,
           YjeF related protein - Magnetococcus sp. (strain MC-1)
          Length = 519

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 25/66 (37%), Positives = 31/66 (46%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           L   +   +DQD    +      LME AG +    +    P       LI+CG GNNGGD
Sbjct: 5   LTAEQMRRVDQDTIERFGLPGMVLMENAGRACVDLLYARLPDLARRRVLILCGGGNNGGD 64

Query: 491 GLVAAR 508
           GLV AR
Sbjct: 65  GLVIAR 70


>UniRef50_Q7VAU0 Cluster: Predicted sugar kinase fused to
           uncharacterized domain; n=1; Prochlorococcus
           marinus|Rep: Predicted sugar kinase fused to
           uncharacterized domain - Prochlorococcus marinus
          Length = 519

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 25/66 (37%), Positives = 39/66 (59%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           ++ S+   ++Q LF+ Y  + + LME  GLS+   +   F     S  +++ GPG+NGGD
Sbjct: 13  VSSSQMKEIEQKLFS-YGMTEEALMEKVGLSMKDFLISNFN-LLESGVVVLVGPGHNGGD 70

Query: 491 GLVAAR 508
           GLV AR
Sbjct: 71  GLVVAR 76


>UniRef50_Q2CHQ7 Cluster: YjeF family protein; n=4;
           Rhodobacteraceae|Rep: YjeF family protein - Oceanicola
           granulosus HTCC2516
          Length = 520

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPP-STHSSALIVCGPGNNGG 487
           + + EAAA+  D  T       +LME AG  V +A    +P  +    AL++ GPGNNGG
Sbjct: 14  MREIEAAAMAGDRVTGA-----ELMERAGSEVVAAARAAWPELAAGGRALVLAGPGNNGG 68

Query: 488 DGLVAARI 511
           DG V AR+
Sbjct: 69  DGFVIARL 76


>UniRef50_Q0AVS2 Cluster: Putative uncharacterized protein; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           Putative uncharacterized protein - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 517

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 24/70 (34%), Positives = 33/70 (47%)
 Frame = +2

Query: 299 VTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGN 478
           + + L   E   +D    +EY      LME AG+     I  +   S     +++ G GN
Sbjct: 1   MVKILTAREMKEIDSKATSEYGIPSLILMENAGIRTVEVIEDLLESSQSKKVVVLAGKGN 60

Query: 479 NGGDGLVAAR 508
           NGGDGLV AR
Sbjct: 61  NGGDGLVVAR 70


>UniRef50_Q026C1 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Solibacter usitatus Ellin6076|Rep: Carbohydrate
           kinase, YjeF related protein - Solibacter usitatus
           (strain Ellin6076)
          Length = 508

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 25/62 (40%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR-ICSCSDTMYRYIILNA 556
           LME AG  V   + + F P      +++CG GNNGGDGLV AR + +       Y++L A
Sbjct: 26  LMENAGHRVLELLTERFAPLAEQRIVVLCGKGNNGGDGLVIARQLRTAVCPRELYVVLLA 85

Query: 557 HP 562
            P
Sbjct: 86  AP 87


>UniRef50_Q5ZS19 Cluster: Sugar kinase; n=4; Legionella
           pneumophila|Rep: Sugar kinase - Legionella pneumophila
           subsp. pneumophila (strain Philadelphia 1 /ATCC 33152 /
           DSM 7513)
          Length = 493

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 24/60 (40%), Positives = 33/60 (55%)
 Frame = +2

Query: 332 ALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           A +Q   T Y+   + LM LAG    S + K++P   H +  + CG GNN GDG V AR+
Sbjct: 16  ACEQQAATLYQKDENALMALAGAEAFSFLQKLYPHVRHIA--VFCGAGNNAGDGYVLARL 73


>UniRef50_A6VWR0 Cluster: Carbohydrate kinase, YjeF related protein;
           n=9; Bacteria|Rep: Carbohydrate kinase, YjeF related
           protein - Marinomonas sp. MWYL1
          Length = 539

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 29/64 (45%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +2

Query: 320 SEAAALDQDLFT-EYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGL 496
           S A   + D  T  Y  +   LME AG  VA AI   +   +    L++CGPGNNGGDG 
Sbjct: 32  STAQMTEADRLTIAYGINAITLMENAGRPVADAIMNRW---SLRPILVLCGPGNNGGDGF 88

Query: 497 VAAR 508
           VAAR
Sbjct: 89  VAAR 92


>UniRef50_A4XIB8 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Caldicellulosiruptor saccharolyticus DSM 8903|Rep:
           Carbohydrate kinase, YjeF related protein -
           Caldicellulosiruptor saccharolyticus (strain ATCC 43494
           / DSM 8903)
          Length = 511

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 28/93 (30%), Positives = 37/93 (39%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           L   +   +D+   +E       LME AG  V   I K F         + CG GNNGGD
Sbjct: 4   LTSEQMKQIDKKATSEIGIPEVVLMENAGFCVYEEIKKDFGDLKQKKIAVFCGKGNNGGD 63

Query: 491 GLVAARICSCSDTMYRYIILNAHPNLCMKTFWN 589
           G V AR         +  I + + +   K F N
Sbjct: 64  GFVVARYLLEESNYVQVFIFDENVSASSKVFLN 96


>UniRef50_Q48A27 Cluster: YjeF family protein; n=1; Colwellia
           psychrerythraea 34H|Rep: YjeF family protein - Colwellia
           psychrerythraea (strain 34H / ATCC BAA-681)
           (Vibriopsychroerythus)
          Length = 524

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/81 (29%), Positives = 45/81 (55%)
 Frame = +2

Query: 269 MTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHS 448
           ++ S++Q   VT     ++    + ++      ++ +LM  AG +V + ++  +P + H 
Sbjct: 3   LSLSLSQKPPVTSVYTANQVLKNEANVARSQGIAMYELMHSAGAAVFTQLSLSWPNAKH- 61

Query: 449 SALIVCGPGNNGGDGLVAARI 511
             LI+CG GNNGGDG V A++
Sbjct: 62  -LLILCGKGNNGGDGFVVAKL 81


>UniRef50_Q1VNF0 Cluster: Putative uncharacterized protein; n=1;
           Psychroflexus torquis ATCC 700755|Rep: Putative
           uncharacterized protein - Psychroflexus torquis ATCC
           700755
          Length = 76

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 31/71 (43%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +2

Query: 299 VTRY-LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPG 475
           ++RY L  SE A  D+        S+ QLME AG     A+ K  P       LI+CGPG
Sbjct: 1   MSRYILTNSEMAEADKITIKNGLPSL-QLMENAG----KAVFKNLPLKKLHKILIICGPG 55

Query: 476 NNGGDGLVAAR 508
           NNGGDG V A+
Sbjct: 56  NNGGDGFVVAK 66


>UniRef50_Q1GTW5 Cluster: YjeF-related protein-like protein; n=1;
           Sphingopyxis alaskensis|Rep: YjeF-related protein-like
           protein - Sphingopyxis alaskensis (Sphingomonas
           alaskensis)
          Length = 449

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/44 (52%), Positives = 30/44 (68%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +LME AG +VA    ++   +  +  LI+CGPGNNGGDG VAAR
Sbjct: 31  ELMERAGAAVADTAWRM---AAGAPILILCGPGNNGGDGYVAAR 71


>UniRef50_Q0F3J2 Cluster: Predicted sugar kinase; n=1; Mariprofundus
           ferrooxydans PV-1|Rep: Predicted sugar kinase -
           Mariprofundus ferrooxydans PV-1
          Length = 526

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/52 (48%), Positives = 30/52 (57%)
 Frame = +2

Query: 353 TEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           TE   S  +LM+ AG +VA A+    P       +IV GPGNNGGDG  AAR
Sbjct: 19  TEAGISGFELMDRAGRAVADAVLDYMPD--FGRVVIVIGPGNNGGDGFAAAR 68


>UniRef50_Q8R858 Cluster: Predicted sugar kinase; n=3;
           Thermoanaerobacter|Rep: Predicted sugar kinase -
           Thermoanaerobacter tengcongensis
          Length = 512

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/43 (51%), Positives = 28/43 (65%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG  VA  + +V   +  SSA+++ G GNNGGDG V AR
Sbjct: 27  LMENAGKEVAWEVKRVMEENGLSSAVVIAGRGNNGGDGYVVAR 69


>UniRef50_Q1W0C7 Cluster: Putative YjeF-related sugar kinase; n=1;
           Psychroflexus torquis ATCC 700755|Rep: Putative
           YjeF-related sugar kinase - Psychroflexus torquis ATCC
           700755
          Length = 501

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 28/83 (33%), Positives = 36/83 (43%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           + L  S+ A LDQ        S   LME A   V   +  + P S      I+ GPGNNG
Sbjct: 2   KILGASQLAELDQLSIDRQNISSWDLMERASRLVFMRLKSILPKSL-CKVYILAGPGNNG 60

Query: 485 GDGLVAARICSCSDTMYRYIILN 553
           GDGL  A   +        I++N
Sbjct: 61  GDGLAIANFLTLEGVDVEVILVN 83


>UniRef50_Q1NJB8 Cluster: Putative uncharacterized protein; n=2;
           delta proteobacterium MLMS-1|Rep: Putative
           uncharacterized protein - delta proteobacterium MLMS-1
          Length = 560

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/43 (53%), Positives = 26/43 (60%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG   A  IA+ F        ++V GPGNNGGD LVAAR
Sbjct: 27  LMENAGRLAAELIARRFGSPAGREIVLVAGPGNNGGDALVAAR 69


>UniRef50_A4M5Z8 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Petrotoga mobilis SJ95|Rep: Carbohydrate kinase,
           YjeF related protein - Petrotoga mobilis SJ95
          Length = 490

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 30/69 (43%), Positives = 39/69 (56%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           + L  S+A  +D+ L  E   + + LME A  SVA  IA+ F P+   S L V G GNN 
Sbjct: 2   KILTSSQAKLIDK-LTIEKGIAPETLMEQAAFSVAD-IAETFEPN---SILCVVGKGNNA 56

Query: 485 GDGLVAARI 511
           GDG+ A RI
Sbjct: 57  GDGIAAGRI 65


>UniRef50_A3CW60 Cluster: Carbohydrate kinase, YjeF related protein;
           n=2; Methanomicrobiales|Rep: Carbohydrate kinase, YjeF
           related protein - Methanoculleus marisnigri (strain ATCC
           35101 / DSM 1498 / JR1)
          Length = 467

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 24/51 (47%), Positives = 32/51 (62%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTM 532
           +ME AG +VA A+    P    S  L++CG GNNGGDG+VAAR     D++
Sbjct: 37  MMESAGRAVADAVLARGP----SRVLVLCGRGNNGGDGMVAARYLQHLDSV 83


>UniRef50_Q5FUR1 Cluster: Putative sugar kinase; n=1; Gluconobacter
           oxydans|Rep: Putative sugar kinase - Gluconobacter
           oxydans (Gluconobacter suboxydans)
          Length = 498

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/44 (52%), Positives = 26/44 (59%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +LME AG +VA  I   F P       + CGPGNNGGDG V AR
Sbjct: 38  RLMENAGWAVARVIRNRFSPRR---VTVACGPGNNGGDGYVVAR 78


>UniRef50_Q3JE81 Cluster: Putative uncharacterized protein; n=2;
           Gammaproteobacteria|Rep: Putative uncharacterized
           protein - Nitrosococcus oceani (strain ATCC 19707 /
           NCIMB 11848)
          Length = 498

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/64 (37%), Positives = 35/64 (54%)
 Frame = +2

Query: 320 SEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLV 499
           ++   LD+    E+  S   LME AG +    + K +P +     +I+CG GNNGGDG V
Sbjct: 12  AQVRELDRCTIEEFGISGAMLMERAGKASLEQLRKHWPQAQR--LVIICGVGNNGGDGYV 69

Query: 500 AARI 511
            AR+
Sbjct: 70  LARL 73


>UniRef50_Q1NAH1 Cluster: Sugar kinase; n=1; Sphingomonas sp.
           SKA58|Rep: Sugar kinase - Sphingomonas sp. SKA58
          Length = 463

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           LME AG +VA  I +        + L++CGPGNNGGDG V AR+
Sbjct: 29  LMECAGKAVAQIIWRA---GHRRNLLVLCGPGNNGGDGFVVARL 69


>UniRef50_Q1JY28 Cluster: Putative uncharacterized protein; n=1;
           Desulfuromonas acetoxidans DSM 684|Rep: Putative
           uncharacterized protein - Desulfuromonas acetoxidans DSM
           684
          Length = 518

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 28/85 (32%), Positives = 37/85 (43%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           + L   +   LDQ    +Y      LME AG   A  IA+ +        L+V G GNNG
Sbjct: 2   KLLTAQQMRELDQTTINDYGVPGIVLMENAGHGAARFIAERYQHLFPGPVLVVAGKGNNG 61

Query: 485 GDGLVAARICSCSDTMYRYIILNAH 559
           GDG V AR         + ++L  H
Sbjct: 62  GDGYVIARHLENWGWTVKVVVLAEH 86


>UniRef50_A5VFD0 Cluster: Carbohydrate kinase, YjeF related protein;
           n=2; Sphingomonadaceae|Rep: Carbohydrate kinase, YjeF
           related protein - Sphingomonas wittichii RW1
          Length = 457

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/67 (40%), Positives = 37/67 (55%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           L  +E  A +  +F     +V+Q ME AG  VA A    +  +     L++CGPGNNGGD
Sbjct: 7   LTAAETRAAEAAVFAT-GVTVEQAMEAAGGVVAEA---AWRHAGRVPTLVLCGPGNNGGD 62

Query: 491 GLVAARI 511
           G V AR+
Sbjct: 63  GYVIARL 69


>UniRef50_Q6LM25 Cluster: Putative uncharacterized protein YJEF;
           n=7; Gammaproteobacteria|Rep: Putative uncharacterized
           protein YJEF - Photobacterium profundum (Photobacterium
           sp. (strain SS9))
          Length = 496

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/45 (46%), Positives = 28/45 (62%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           +LME AG +V   + K FP +   S  + CG GNNGGDG + AR+
Sbjct: 33  ELMERAGQAVFITLKKCFPAAC--SITVCCGGGNNGGDGYIVARL 75


>UniRef50_Q3AEB4 Cluster: Putative uncharacterized protein; n=1;
           Carboxydothermus hydrogenoformans Z-2901|Rep: Putative
           uncharacterized protein - Carboxydothermus
           hydrogenoformans (strain Z-2901 / DSM 6008)
          Length = 524

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 27/80 (33%), Positives = 35/80 (43%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           L   E A  DQ    EY      LME A L     I ++    +    +I+ G GNNGGD
Sbjct: 4   LTGREMAEFDQKAINEYGIPGIVLMENAALKTFYRIKEILGDVSGKKIIILVGKGNNGGD 63

Query: 491 GLVAARICSCSDTMYRYIIL 550
           GL  AR  + +    R  +L
Sbjct: 64  GLALARHLANAGAKIRVFLL 83


>UniRef50_Q8TX67 Cluster: Short chain dehydrogenase fused to sugar
           kinase; n=1; Methanopyrus kandleri|Rep: Short chain
           dehydrogenase fused to sugar kinase - Methanopyrus
           kandleri
          Length = 499

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 22/48 (45%), Positives = 27/48 (56%)
 Frame = +2

Query: 365 FSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           F  D +ME AG  VA  +   + P+     L+VCG G NGGDG V AR
Sbjct: 20  FEEDFMMENAGAGVARVVIGEYSPN---DVLVVCGTGGNGGDGFVTAR 64


>UniRef50_Q2AG96 Cluster: Putative uncharacterized protein; n=1;
           Halothermothrix orenii H 168|Rep: Putative
           uncharacterized protein - Halothermothrix orenii H 168
          Length = 513

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 22/43 (51%), Positives = 26/43 (60%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME+AG   A  +  + P   H   +I  G GNNGGDGLVAAR
Sbjct: 26  LMEVAGRETAERVRHLLPEPGH--VVIFAGKGNNGGDGLVAAR 66


>UniRef50_Q1FLI2 Cluster: Putative uncharacterized protein; n=1;
           Clostridium phytofermentans ISDg|Rep: Putative
           uncharacterized protein - Clostridium phytofermentans
           ISDg
          Length = 515

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 27/70 (38%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +2

Query: 305 RY-LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNN 481
           RY L+  +   LD+    +       LME A L VA  + +   P+     + VCG GNN
Sbjct: 2   RYALDAVQMKNLDKKTIEQIGIPAMVLMERAALYVAEQVREHAKPT--DKIIAVCGTGNN 59

Query: 482 GGDGLVAARI 511
           GGDG+ AARI
Sbjct: 60  GGDGIAAARI 69


>UniRef50_Q1AXV8 Cluster: YjeF-related protein-like protein; n=1;
           Rubrobacter xylanophilus DSM 9941|Rep: YjeF-related
           protein-like protein - Rubrobacter xylanophilus (strain
           DSM 9941 / NBRC 16129)
          Length = 507

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 23/43 (53%), Positives = 27/43 (62%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG+ +AS   + F P     A+ VCG GNNGGDG V AR
Sbjct: 26  LMERAGVGMASLALERFSPRR---AVAVCGGGNNGGDGFVVAR 65


>UniRef50_Q0BSJ4 Cluster: Sugar kinase; n=2; Acetobacteraceae|Rep:
           Sugar kinase - Granulobacter bethesdensis (strain ATCC
           BAA-1260 / CGDNIH1)
          Length = 524

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 22/43 (51%), Positives = 28/43 (65%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG +VA  + ++  P      L++ GPGNNGGDG VAAR
Sbjct: 43  LMEHAGAAVARLVRRLSSPCR---VLVMAGPGNNGGDGYVAAR 82


>UniRef50_A3UD03 Cluster: Putative uncharacterized protein; n=1;
           Oceanicaulis alexandrii HTCC2633|Rep: Putative
           uncharacterized protein - Oceanicaulis alexandrii
           HTCC2633
          Length = 497

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 22/41 (53%), Positives = 27/41 (65%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLV 499
           +LM+ AG  VA AI   + P    SA ++CGPGNNGGDG V
Sbjct: 17  RLMQSAGTGVARAIMSRWAPR---SAAVLCGPGNNGGDGWV 54


>UniRef50_Q97CH2 Cluster: Putative uncharacterized protein
           TVG0137051; n=3; Thermoplasma|Rep: Putative
           uncharacterized protein TVG0137051 - Thermoplasma
           volcanium
          Length = 480

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = +2

Query: 344 DLFTEYKF-SVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           DL  EY + S   LM+ AG SVA  I K F  ++     +VCG GNN GD +VAA +
Sbjct: 31  DLNYEYLYGSTYPLMKNAGSSVAKVIEKNF--ASGQKVCVVCGTGNNAGDAIVAAEL 85


>UniRef50_A3DLN4 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Staphylothermus marinus F1|Rep: Carbohydrate
           kinase, YjeF related protein - Staphylothermus marinus
           (strain ATCC 43588 / DSM 3639 / F1)
          Length = 506

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/44 (47%), Positives = 26/44 (59%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +LME AG SVA  IA    P      +++ G G NGGD LVA+R
Sbjct: 24  RLMEAAGKSVADTIASRISPKEADKTVVLMGRGGNGGDSLVASR 67


>UniRef50_Q74C72 Cluster: YjeF family protein; n=7;
           Desulfuromonadales|Rep: YjeF family protein - Geobacter
           sulfurreducens
          Length = 519

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 24/59 (40%), Positives = 31/59 (52%)
 Frame = +2

Query: 335 LDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           +D+    E+      LME AG   A AI ++F        L+V G GNNGGDG V AR+
Sbjct: 12  MDRRAIDEFGIPGLVLMENAGRGCADAIREMFGRDGCIPVLVVAGKGNNGGDGYVIARL 70


>UniRef50_Q3YSD9 Cluster: Sugar kinase; n=7; Anaplasmataceae|Rep:
           Sugar kinase - Ehrlichia canis (strain Jake)
          Length = 466

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +2

Query: 371 VDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           VD+L+  AG ++  +I+K+FP        ++ GPGNNG DG+ AAR+
Sbjct: 20  VDELICRAGKAITDSISKLFPKQF---VTVIAGPGNNGKDGVTAARM 63


>UniRef50_Q2JY00 Cluster: Carbohydrate kinase family protein; n=2;
           Synechococcus|Rep: Carbohydrate kinase family protein -
           Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria
           bacteriumYellowstone A-Prime)
          Length = 528

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 24/74 (32%), Positives = 40/74 (54%)
 Frame = +2

Query: 287 QCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVC 466
           Q +  T  ++ ++   L++++F      V  LME  GL+  + + + FP +      I+C
Sbjct: 24  QFDPATALVSAAQMQRLEEEIFAA-GMPVAALMEKVGLAAFAQLQQDFPQAQRIG--ILC 80

Query: 467 GPGNNGGDGLVAAR 508
           G G+NGGDGLV  R
Sbjct: 81  GTGHNGGDGLVVGR 94


>UniRef50_O67377 Cluster: Putative uncharacterized protein; n=1;
           Aquifex aeolicus|Rep: Putative uncharacterized protein -
           Aquifex aeolicus
          Length = 499

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 26/68 (38%), Positives = 33/68 (48%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           + L   E +++D     E       LME A   V   I K FP +   + L+V G GNNG
Sbjct: 2   KILKAHEMSSIDNKTIEEIGIPSLVLMENASKGVFENIRKYFPDA--KNILVVAGKGNNG 59

Query: 485 GDGLVAAR 508
           GDGL  AR
Sbjct: 60  GDGLALAR 67


>UniRef50_A1HST2 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Thermosinus carboxydivorans Nor1|Rep: Carbohydrate
           kinase, YjeF related protein - Thermosinus
           carboxydivorans Nor1
          Length = 247

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/43 (44%), Positives = 26/43 (60%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG ++A  +A +   + +    +  G GNNGGDG VAAR
Sbjct: 27  LMEDAGAALARQVASILTDAANKRVCVFAGKGNNGGDGFVAAR 69


>UniRef50_A0HCP3 Cluster: Carbohydrate kinase, YjeF related protein;
           n=6; Comamonadaceae|Rep: Carbohydrate kinase, YjeF
           related protein - Comamonas testosteroni KF-1
          Length = 527

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSAL-IVCGPGNNGGDGLVAA 505
           +LME AGL++A     + P   H+  + I CGPGNNGGDG  AA
Sbjct: 43  RLMERAGLAIAKLALAIAP---HAQRIWIACGPGNNGGDGFEAA 83


>UniRef50_A4FZT3 Cluster: Carbohydrate kinase, YjeF related protein;
           n=4; Methanococcus|Rep: Carbohydrate kinase, YjeF
           related protein - Methanococcus maripaludis
          Length = 503

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 25/66 (37%), Positives = 36/66 (54%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           ++  E   +D++   +Y  S + LME AG +V   I  +      S A ++CG GNNGGD
Sbjct: 31  ISSFEIKVIDENS-EQYGISKETLMENAGRAVFEEIVNL--NVDFSKAYVLCGTGNNGGD 87

Query: 491 GLVAAR 508
           G V AR
Sbjct: 88  GFVIAR 93


>UniRef50_Q8D630 Cluster: Predicted sugar kinase; n=26; Vibrio|Rep:
           Predicted sugar kinase - Vibrio vulnificus
          Length = 495

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 21/45 (46%), Positives = 27/45 (60%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           +LME AG +  + I   +P    S   +VCG GNNGGDG V AR+
Sbjct: 30  ELMERAGRATFAVILNYYPAV--SRLCVVCGKGNNGGDGYVVARL 72


>UniRef50_Q3ZZH2 Cluster: Carbohydrate kinase, yjeF-family; n=3;
           Dehalococcoides|Rep: Carbohydrate kinase, yjeF-family -
           Dehalococcoides sp. (strain CBDB1)
          Length = 512

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 23/56 (41%), Positives = 29/56 (51%)
 Frame = +2

Query: 341 QDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +D   +   S + LME AG +VA     +         LI+ G GNNGGDGLVA R
Sbjct: 13  EDACLKQGISTETLMENAGRAVAVFARHLLEEQNGCRVLILAGAGNNGGDGLVAGR 68


>UniRef50_A5ZVX2 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 500

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 24/64 (37%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
 Frame = +2

Query: 323 EAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALI-VCGPGNNGGDGLV 499
           E  ALD ++          LME A L VA  + +          ++ VCG GNNGGDG+ 
Sbjct: 9   EMKALDGNMIEGIGIPSCVLMERAALKVAEELERTLADKKQEERILCVCGNGNNGGDGVA 68

Query: 500 AARI 511
            ARI
Sbjct: 69  VARI 72


>UniRef50_A3ER71 Cluster: Putative sugar kinase; n=1; Leptospirillum
           sp. Group II UBA|Rep: Putative sugar kinase -
           Leptospirillum sp. Group II UBA
          Length = 518

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 23/43 (53%), Positives = 28/43 (65%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG++VA +I + FP +    AL   G GNNGGD LVA R
Sbjct: 27  LMERAGMAVARSIRRFFPAARKIVAL--AGKGNNGGDALVALR 67


>UniRef50_Q2NE83 Cluster: Predicted sugar kinase; n=1;
           Methanosphaera stadtmanae DSM 3091|Rep: Predicted sugar
           kinase - Methanosphaera stadtmanae (strain DSM 3091)
          Length = 487

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 30/67 (44%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYK-FSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGG 487
           L   E  A+D++  TEY       LME AG S+A  I   FP     S  I CG G NGG
Sbjct: 5   LTPIEMKAVDRN--TEYNHIPTIVLMENAGSSIAGYIMNNFPDKKKIS--IYCGTGGNGG 60

Query: 488 DGLVAAR 508
           DG V AR
Sbjct: 61  DGFVIAR 67


>UniRef50_Q82Y67 Cluster: Possible sugar kinase; n=5;
           Betaproteobacteria|Rep: Possible sugar kinase -
           Nitrosomonas europaea
          Length = 505

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 22/43 (51%), Positives = 24/43 (55%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AGL+ A               LI+ GPGNNGGD LVAAR
Sbjct: 28  LMEKAGLAAAKVAHTRLLTDDKQRILILAGPGNNGGDALVAAR 70


>UniRef50_Q73MY6 Cluster: YjeF-related protein; n=1; Treponema
           denticola|Rep: YjeF-related protein - Treponema
           denticola
          Length = 496

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 3/82 (3%)
 Frame = +2

Query: 335 LDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHS---SALIVCGPGNNGGDGLVAA 505
           LD+    ++      LME A    A  I  +FP        +  IVCG G+NGGDGL  A
Sbjct: 11  LDKRAEEDFNLKNGILMENAARGSAEKIKNLFPLKKRDEKKTLQIVCGSGDNGGDGLALA 70

Query: 506 RICSCSDTMYRYIILNAHPNLC 571
           RI +    ++  I+      LC
Sbjct: 71  RILADDFNIHVIILKEPKSELC 92


>UniRef50_Q5LR39 Cluster: YjeF family protein; n=6;
           Rhodobacterales|Rep: YjeF family protein - Silicibacter
           pomeroyi
          Length = 556

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 16/87 (18%)
 Frame = +2

Query: 299 VTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFP---------PSTHSS 451
           ++  L  ++  A++Q      + +  +LME AG  V  AI + +P         P T  S
Sbjct: 12  MSELLTAAQMRAIEQAAIASGEVTGLELMERAGRGVVEAIFEEWPELGEAGGPTPQTPWS 71

Query: 452 -------ALIVCGPGNNGGDGLVAARI 511
                  A+++CGPGNNGGDG V AR+
Sbjct: 72  TSGEMKKAVVLCGPGNNGGDGFVVARL 98


>UniRef50_Q5KZV4 Cluster: Hypothetical conserved protein; n=2;
           Geobacillus|Rep: Hypothetical conserved protein -
           Geobacillus kaustophilus
          Length = 506

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           +   E  A+D+++      S D LME AG ++   +    P +   + L   G GNNGGD
Sbjct: 5   VTSDEMYAIDREVTERIGISADSLMENAGQALFRVLKGRIPRADRVAVL--AGAGNNGGD 62

Query: 491 GLVAARIC-SC 520
           G V AR+  SC
Sbjct: 63  GFVVARMLKSC 73


>UniRef50_Q2NA19 Cluster: Sugar kinase; n=1; Erythrobacter litoralis
           HTCC2594|Rep: Sugar kinase - Erythrobacter litoralis
           (strain HTCC2594)
          Length = 468

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 27/74 (36%), Positives = 40/74 (54%)
 Frame = +2

Query: 284 NQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIV 463
           N  N + + L  +E  A ++DL  +   SV +LM+ AG   A  I ++   +      ++
Sbjct: 3   NSAN-LRQVLTVAEMQAAERDLM-DAGISVHELMQRAGQGAADWIWRM---TGGRPVTVL 57

Query: 464 CGPGNNGGDGLVAA 505
           CGPGNNGGDG V A
Sbjct: 58  CGPGNNGGDGYVIA 71


>UniRef50_A6GKI5 Cluster: Putative uncharacterized protein; n=1;
           Plesiocystis pacifica SIR-1|Rep: Putative
           uncharacterized protein - Plesiocystis pacifica SIR-1
          Length = 498

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 22/43 (51%), Positives = 26/43 (60%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME A L V SA  +    S+     ++CGPGNNGGDGL  AR
Sbjct: 32  LMERAALCV-SAEVEALAASSAVRVEVLCGPGNNGGDGLAVAR 73


>UniRef50_Q2G7E7 Cluster: YjeF-related protein-like protein; n=3;
           Sphingomonadales|Rep: YjeF-related protein-like protein
           - Novosphingobium aromaticivorans (strain DSM 12444)
          Length = 468

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = +2

Query: 299 VTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGN 478
           +T+ LN ++  A +Q L       V QLM+ AG      + ++   +      ++CGPGN
Sbjct: 9   LTQVLNVAQMHAAEQALIAAGT-DVHQLMQRAGRGAGEWVRRI---AAGRPVTVLCGPGN 64

Query: 479 NGGDGLVAA 505
           NGGDG V A
Sbjct: 65  NGGDGWVIA 73


>UniRef50_Q7NST2 Cluster: Putative uncharacterized protein; n=1;
           Chromobacterium violaceum|Rep: Putative uncharacterized
           protein - Chromobacterium violaceum
          Length = 488

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 21/42 (50%), Positives = 26/42 (61%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAA 505
           LM  A L+ A  + +  PP+  SS L+  GPGNNGGD L AA
Sbjct: 26  LMRRAALAAADWVTRHCPPA--SSLLVCAGPGNNGGDALYAA 65


>UniRef50_Q5QW92 Cluster: C-terminal predicted sugar kinase fused to
           N-terminal uncharaterized domain; n=2; Idiomarina|Rep:
           C-terminal predicted sugar kinase fused to N-terminal
           uncharaterized domain - Idiomarina loihiensis
          Length = 506

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 22/67 (32%), Positives = 34/67 (50%)
 Frame = +2

Query: 368 SVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYII 547
           ++ QLM  AG +V   +   FP     +  + CG GNNGGDG + AR+   +   Y+  +
Sbjct: 33  NMTQLMSAAGKAVFHQLQSYFPAPARIA--VCCGEGNNGGDGYIVARLAQKAG--YQVQV 88

Query: 548 LNAHPNL 568
               PN+
Sbjct: 89  FALKPNV 95


>UniRef50_A6D4V6 Cluster: Putative uncharacterized protein; n=1;
           Vibrio shilonii AK1|Rep: Putative uncharacterized
           protein - Vibrio shilonii AK1
          Length = 510

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 20/48 (41%), Positives = 27/48 (56%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCS 523
           LM+ AG SV   I   +  S     L+ CG GNNGGDG + A++  C+
Sbjct: 39  LMQQAGASVFELIQTYY--SETRKLLVCCGKGNNGGDGYIVAKLSLCA 84


>UniRef50_A0LK98 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Syntrophobacter fumaroxidans MPOB|Rep: Carbohydrate
           kinase, YjeF related protein - Syntrophobacter
           fumaroxidans (strain DSM 10017 / MPOB)
          Length = 521

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 27/83 (32%), Positives = 34/83 (40%)
 Frame = +2

Query: 320 SEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLV 499
           SE A LD+    E       LME A    A+   +V P        ++ G GNN GDG V
Sbjct: 7   SEMAGLDRATIEEIGIPGIVLMENAARGAAAFYLEVVPDLLTRRITVLAGSGNNAGDGFV 66

Query: 500 AARICSCSDTMYRYIILNAHPNL 568
            AR+        R + L    NL
Sbjct: 67  LARLFKNQGADVRVVCLRPPENL 89


>UniRef50_A3H9S7 Cluster: Carbohydrate kinase, YjeF related protein;
           n=5; Thermoproteaceae|Rep: Carbohydrate kinase, YjeF
           related protein - Caldivirga maquilingensis IC-167
          Length = 542

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 21/43 (48%), Positives = 27/43 (62%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG  VA  ++  +P +     L+V G GNNGGDG+VA R
Sbjct: 33  LMENAGRGVAQIVSSRWPNA--GKVLVVAGLGNNGGDGIVAGR 73


>UniRef50_P56176 Cluster: Uncharacterized protein HP_1363; n=4;
           Helicobacter|Rep: Uncharacterized protein HP_1363 -
           Helicobacter pylori (Campylobacter pylori)
          Length = 466

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 23/59 (38%), Positives = 33/59 (55%)
 Frame = +2

Query: 332 ALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           ALD+    E   S D LME A +++  A+ +    S  +  +I+CG G+NGGDG   AR
Sbjct: 10  ALDKRAIEELFLSEDILMENAAMALERAVLQ--NASLGAKVIILCGSGDNGGDGYALAR 66


>UniRef50_Q9A6W7 Cluster: YjeF family protein; n=4;
           Alphaproteobacteria|Rep: YjeF family protein -
           Caulobacter crescentus (Caulobacter vibrioides)
          Length = 483

 Score = 40.7 bits (91), Expect = 0.029
 Identities = 21/43 (48%), Positives = 27/43 (62%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG +VA A+   +        ++ CGPG+NGGDG VAAR
Sbjct: 28  LMERAGEAVAQAVRARYQ---RRPVVVWCGPGDNGGDGYVAAR 67


>UniRef50_Q7ULX4 Cluster: Putative uncharacterized protein; n=1;
           Pirellula sp.|Rep: Putative uncharacterized protein -
           Rhodopirellula baltica
          Length = 244

 Score = 40.7 bits (91), Expect = 0.029
 Identities = 21/43 (48%), Positives = 25/43 (58%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG   A  I ++ P     + LI+CG GNNGGDG   AR
Sbjct: 53  LMENAGRGAAELIEELAP---EGNVLILCGKGNNGGDGFTIAR 92


>UniRef50_Q0AB65 Cluster: Carbohydrate kinase, YjeF related protein;
           n=3; Gammaproteobacteria|Rep: Carbohydrate kinase, YjeF
           related protein - Alkalilimnicola ehrlichei (strain
           MLHE-1)
          Length = 492

 Score = 40.7 bits (91), Expect = 0.029
 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +2

Query: 293 NTVTRYL-NQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSAL-IVC 466
           NT+  YL   ++   LD+    ++      LME AG      + K +P   H   L ++C
Sbjct: 2   NTLPEYLYTPAQVQELDRRAIQDHGLPGLSLMERAGRRGWEVLLKHWP---HVRRLRVLC 58

Query: 467 GPGNNGGDGLVAARI 511
           G GNNGGDG V AR+
Sbjct: 59  GGGNNGGDGYVVARL 73


>UniRef50_A6DFZ1 Cluster: Putative YjeF-related sugar kinase; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Putative
           YjeF-related sugar kinase - Lentisphaera araneosa
           HTCC2155
          Length = 494

 Score = 40.7 bits (91), Expect = 0.029
 Identities = 21/47 (44%), Positives = 25/47 (53%), Gaps = 3/47 (6%)
 Frame = +2

Query: 377 QLMELAGLSVASAI---AKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +LME AG   +  I        P      +I+CGPGNNGGDG V AR
Sbjct: 26  ELMERAGKQCSEQIELFCSQLAPHHKKRLIILCGPGNNGGDGFVIAR 72


>UniRef50_Q7VVH8 Cluster: Putative uncharacterized protein; n=3;
           Bordetella|Rep: Putative uncharacterized protein -
           Bordetella pertussis
          Length = 228

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 21/44 (47%), Positives = 26/44 (59%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           LM  AGL+ A  +A   P    +  L + GPGNNGGD LVAA +
Sbjct: 23  LMPRAGLAAADFVAARLPAG--AQVLALAGPGNNGGDALVAATL 64


>UniRef50_Q72IV4 Cluster: Putative sugar kinase; n=2; Thermus
           thermophilus|Rep: Putative sugar kinase - Thermus
           thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)
          Length = 482

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 21/43 (48%), Positives = 27/43 (62%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG+  A    ++F  +    AL++ G GNNGGDGLV AR
Sbjct: 26  LMEWAGMKAARVYLELFGKAP---ALVLAGKGNNGGDGLVLAR 65


>UniRef50_Q7CYK7 Cluster: AGR_C_3249p; n=2; Agrobacterium
           tumefaciens str. C58|Rep: AGR_C_3249p - Agrobacterium
           tumefaciens (strain C58 / ATCC 33970)
          Length = 459

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 20/42 (47%), Positives = 29/42 (69%)
 Frame = +2

Query: 383 MELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           ME AG +VA++  + +P +     +++CG GNNGGDG VAAR
Sbjct: 1   MERAGHAVAASGLRHYPQALRF--VVLCGGGNNGGDGYVAAR 40


>UniRef50_A2C456 Cluster: Predicted sugar kinase fused to
           uncharacterized domain; n=2; Prochlorococcus
           marinus|Rep: Predicted sugar kinase fused to
           uncharacterized domain - Prochlorococcus marinus (strain
           NATL1A)
          Length = 563

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 21/58 (36%), Positives = 36/58 (62%)
 Frame = +2

Query: 335 LDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +++++F+     V+ LME  G+ ++S I         + A+++ GPG+NGGDGLV AR
Sbjct: 69  IEKEMFS-MGMPVEALMEKVGIGISSWILDRHG-LIENGAIVLVGPGHNGGDGLVVAR 124


>UniRef50_A1K788 Cluster: Putative uncharacterized protein; n=2;
           Rhodocyclaceae|Rep: Putative uncharacterized protein -
           Azoarcus sp. (strain BH72)
          Length = 509

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 20/43 (46%), Positives = 24/43 (55%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG + A    ++         L+ CGPGNNGGDG V AR
Sbjct: 29  LMERAGRAAAEDAVRLLIDRP-GPVLVACGPGNNGGDGFVMAR 70


>UniRef50_Q6L1G0 Cluster: Putative sugar kinase; n=1; Picrophilus
           torridus|Rep: Putative sugar kinase - Picrophilus
           torridus
          Length = 450

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYII 547
           LM+ AG++VA+     F    +   L++ GPGNNGGD + AA      + +Y  +I
Sbjct: 23  LMKNAGMAVANVFKNNF--GKNRKVLVIAGPGNNGGDAICAASYLMTDNDVYLLMI 76


>UniRef50_Q18HS3 Cluster: Predicted sugar kinase; n=5;
           Halobacteriaceae|Rep: Predicted sugar kinase -
           Haloquadratum walsbyi (strain DSM 16790)
          Length = 500

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 4/70 (5%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSS----ALIVCGPGN 478
           +  +  AA+D++       S  QLME  G +VA  + ++      S     A+IV G GN
Sbjct: 2   ITSARMAAVDRNA-EALGVSPQQLMESGGNAVAKTVRELTDVDVESETPPVAVIVAGRGN 60

Query: 479 NGGDGLVAAR 508
           NGGDG V AR
Sbjct: 61  NGGDGFVTAR 70


>UniRef50_A6BEC2 Cluster: Putative uncharacterized protein; n=1;
           Dorea longicatena DSM 13814|Rep: Putative
           uncharacterized protein - Dorea longicatena DSM 13814
          Length = 504

 Score = 39.9 bits (89), Expect = 0.051
 Identities = 24/67 (35%), Positives = 32/67 (47%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           +N ++  A DQ    E   +  +LME A  +    +         SS  +VCG GNNGGD
Sbjct: 9   VNAAQMKAADQYTIQELGIASLELMECAANACVQTMQS--ENLDLSSVCVVCGSGNNGGD 66

Query: 491 GLVAARI 511
           G   ARI
Sbjct: 67  GFAIARI 73


>UniRef50_O27324 Cluster: Conserved protein; n=1;
           Methanothermobacter thermautotrophicus str. Delta H|Rep:
           Conserved protein - Methanobacterium thermoautotrophicum
          Length = 519

 Score = 39.9 bits (89), Expect = 0.051
 Identities = 22/43 (51%), Positives = 23/43 (53%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG +VA  I             I CGPG NGGDG VAAR
Sbjct: 42  LMENAGRAVAEEIGNAVDSGR---VAIFCGPGGNGGDGFVAAR 81


>UniRef50_Q1U8B7 Cluster: YjeF-related protein-like; n=3;
           Lactobacillus|Rep: YjeF-related protein-like -
           Lactobacillus reuteri 100-23
          Length = 212

 Score = 39.5 bits (88), Expect = 0.067
 Identities = 20/44 (45%), Positives = 25/44 (56%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           LME A L V   I   FP +     ++V G GNNGGDG+  AR+
Sbjct: 29  LMERAALVVRDEILHAFPIAL-KDVVVVAGSGNNGGDGIAIARL 71


>UniRef50_Q1GHV9 Cluster: YjeF-related protein-like protein; n=3;
           Rhodobacteraceae|Rep: YjeF-related protein-like protein
           - Silicibacter sp. (strain TM1040)
          Length = 528

 Score = 39.5 bits (88), Expect = 0.067
 Identities = 14/20 (70%), Positives = 18/20 (90%)
 Frame = +2

Query: 452 ALIVCGPGNNGGDGLVAARI 511
           A+++CGPGNNGGDG V AR+
Sbjct: 73  AVVLCGPGNNGGDGFVVARL 92


>UniRef50_A5KQZ2 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus torques ATCC 27756|Rep: Putative
           uncharacterized protein - Ruminococcus torques ATCC
           27756
          Length = 209

 Score = 39.5 bits (88), Expect = 0.067
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +2

Query: 446 SSALIVCGPGNNGGDGLVAARI 511
           S  L+VCG GNNGGDG  AARI
Sbjct: 48  SDTLVVCGSGNNGGDGFAAARI 69


>UniRef50_A0B850 Cluster: Carbohydrate kinase, YjeF related protein;
           n=2; Euryarchaeota|Rep: Carbohydrate kinase, YjeF
           related protein - Methanosaeta thermophila (strain DSM
           6194 / PT) (Methanothrixthermophila (strain DSM 6194 /
           PT))
          Length = 462

 Score = 39.5 bits (88), Expect = 0.067
 Identities = 26/68 (38%), Positives = 35/68 (51%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           RY++  E  A+D +       S  QLME AG ++A+ I  +          I+ G GNNG
Sbjct: 2   RYISAEEMGAIDANC-AYLGISTLQLMENAGAALANEIRAI----GGRRIAIIAGRGNNG 56

Query: 485 GDGLVAAR 508
           GD  VAAR
Sbjct: 57  GDAFVAAR 64


>UniRef50_P31806 Cluster: Uncharacterized protein yjeF; n=44;
           Enterobacteriaceae|Rep: Uncharacterized protein yjeF -
           Escherichia coli (strain K12)
          Length = 515

 Score = 39.5 bits (88), Expect = 0.067
 Identities = 19/45 (42%), Positives = 26/45 (57%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           +LM  AG +        +P + H   L++CG GNNGGDG V AR+
Sbjct: 40  ELMLRAGEAAFQVCRSAYPDARHW--LVLCGHGNNGGDGYVVARL 82


>UniRef50_UPI000038E147 Cluster: hypothetical protein Faci_03001029;
           n=1; Ferroplasma acidarmanus fer1|Rep: hypothetical
           protein Faci_03001029 - Ferroplasma acidarmanus fer1
          Length = 457

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGL 496
           +LM+ AG S++  +    PP    S  I+CG GNN GDG+
Sbjct: 22  KLMKQAGKSISDFVEHTIPPG--KSIAIICGTGNNAGDGI 59


>UniRef50_Q97LR4 Cluster: Predicted sugar kinase, N-terminal
           region-uncharacterized conserved protein; n=2;
           Clostridium|Rep: Predicted sugar kinase, N-terminal
           region-uncharacterized conserved protein - Clostridium
           acetobutylicum
          Length = 502

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 23/58 (39%), Positives = 29/58 (50%)
 Frame = +2

Query: 335 LDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +DQ   T      + LME A L V   I + F        ++VCG GNNGGDG+  AR
Sbjct: 12  IDQFCTTSLGIPGNILMENAALKVVKNIGEEF-----KDIVLVCGVGNNGGDGMACAR 64


>UniRef50_Q6AK13 Cluster: Putative uncharacterized protein; n=1;
           Desulfotalea psychrophila|Rep: Putative uncharacterized
           protein - Desulfotalea psychrophila
          Length = 545

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 20/58 (34%), Positives = 25/58 (43%)
 Frame = +2

Query: 335 LDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +D     +Y      LME AG      + +      +S   I  GPGNNGGDG V  R
Sbjct: 12  IDHQAINDYGIPGAVLMENAGRETVGLMQQALGTCANSFIPIFIGPGNNGGDGFVVGR 69


>UniRef50_Q1IZ92 Cluster: YjeF-related protein-like protein; n=2;
           Deinococcus|Rep: YjeF-related protein-like protein -
           Deinococcus geothermalis (strain DSM 11300)
          Length = 495

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 22/46 (47%), Positives = 28/46 (60%)
 Frame = +2

Query: 371 VDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           +D  ME AG +VA A+   +P S     L++ G G NGGD LVAAR
Sbjct: 24  LDPAMEEAGRAVAEAVHSRWPGSR---VLLLAGSGANGGDALVAAR 66


>UniRef50_A6GUK0 Cluster: Putative uncharacterized protein; n=1;
           Limnobacter sp. MED105|Rep: Putative uncharacterized
           protein - Limnobacter sp. MED105
          Length = 558

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 2/67 (2%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGL-SVASAIAKVFPPSTHSSALIV-CGPGNNG 484
           L+ ++  AL+Q  F      +  LM+ AG+ S    + ++    THS+  +V  GPGNNG
Sbjct: 28  LSVTQIRALEQTAFAHIDSFL--LMQAAGVRSALKIVDQIIHSETHSTRCVVLAGPGNNG 85

Query: 485 GDGLVAA 505
           GD  + A
Sbjct: 86  GDACIVA 92


>UniRef50_A1WUU1 Cluster: Carbohydrate kinase, YjeF related protein;
           n=9; Gammaproteobacteria|Rep: Carbohydrate kinase, YjeF
           related protein - Halorhodospira halophila (strain DSM
           244 / SL1) (Ectothiorhodospirahalophila (strain DSM 244
           / SL1))
          Length = 509

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 24/73 (32%), Positives = 36/73 (49%)
 Frame = +2

Query: 299 VTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGN 478
           +T      + A LDQ          + LM+ AG  +   I + +P +     ++VCG GN
Sbjct: 15  MTELYTPDQVARLDQAAIRA-GLPGEVLMDRAGRRLWREIRRRWPEARR--LVVVCGGGN 71

Query: 479 NGGDGLVAARICS 517
           NGGDG V AR+ +
Sbjct: 72  NGGDGYVVARLAA 84


>UniRef50_A1I7Y5 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Desulfococcus oleovorans Hxd3|Rep: Putative
           uncharacterized protein - Candidatus Desulfococcus
           oleovorans Hxd3
          Length = 533

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 18/43 (41%), Positives = 22/43 (51%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG S    +    P +      ++ G GNNGGDG V AR
Sbjct: 27  LMENAGRSATGWLLDTIPDALERRIAVIAGRGNNGGDGFVMAR 69


>UniRef50_Q89ZJ4 Cluster: Putative sugar kinase; n=5;
           Bacteroidales|Rep: Putative sugar kinase - Bacteroides
           thetaiotaomicron
          Length = 503

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 22/48 (45%), Positives = 27/48 (56%)
 Frame = +2

Query: 368 SVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           S+D LME A  ++  AI   + P T     I  GPGNNGGD L  AR+
Sbjct: 24  SID-LMERAAQALTKAITNRWNPET--PVTIFAGPGNNGGDALAVARM 68


>UniRef50_A4A6L0 Cluster: Putative uncharacterized protein; n=1;
           Congregibacter litoralis KT71|Rep: Putative
           uncharacterized protein - Congregibacter litoralis KT71
          Length = 505

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +2

Query: 458 IVCGPGNNGGDGLVAARICSCSDTMYRYIILNAHP 562
           I+CGPGNNGGDGL+ A + +      + ++++  P
Sbjct: 61  ILCGPGNNGGDGLLLAMLATARGIPTQVLLIDGKP 95


>UniRef50_A0NJZ4 Cluster: Sugar kinase; n=2; Oenococcus oeni|Rep:
           Sugar kinase - Oenococcus oeni ATCC BAA-1163
          Length = 214

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +2

Query: 293 NTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGP 472
           N  T Y++  +A   D     +       LME A L+V   + +    +     L+V G 
Sbjct: 4   NMTTIYISSKQAHNFDDYTINKIGVPSSVLMERAALAVCQRLLESRNFNL-KKVLVVAGI 62

Query: 473 GNNGGDGLVAARI 511
           GNNGGDG+  AR+
Sbjct: 63  GNNGGDGIAVARM 75


>UniRef50_A0M1H7 Cluster: Carbohydrate kinase; n=8;
           Bacteroidetes|Rep: Carbohydrate kinase - Gramella
           forsetii (strain KT0803)
          Length = 511

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 23/68 (33%), Positives = 34/68 (50%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           + L+  + +  D++   +   S ++LME A   V + I      +      I CG GNNG
Sbjct: 2   KILSAEQLSEADKETIKKQNISSEELMERAATLVFNEINNRLRGAP-IPIKIFCGIGNNG 60

Query: 485 GDGLVAAR 508
           GDGLV AR
Sbjct: 61  GDGLVVAR 68


>UniRef50_Q5JER5 Cluster: YjeF-ralted probable carbohydrate kinase;
           n=4; Thermococcaceae|Rep: YjeF-ralted probable
           carbohydrate kinase - Pyrococcus kodakaraensis
           (Thermococcus kodakaraensis)
          Length = 480

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYII 547
           QLME AG  VA  I + F         +  G GNNGGDG VA R  S  + +  +++
Sbjct: 22  QLMENAGAGVARTIEERFGKGL--KVAVFSGTGNNGGDGFVATRHLSFENDVTLFLV 76


>UniRef50_Q4JCJ3 Cluster: Conserved Archaeal protein; n=4;
           Sulfolobaceae|Rep: Conserved Archaeal protein -
           Sulfolobus acidocaldarius
          Length = 503

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYIIL--N 553
           LME AG SV   I K          ++  G G  GGDGLV AR  +   +    ++L  N
Sbjct: 24  LMENAGRSVKDEIMKRLNLDYSKKVVVFAGTGGKGGDGLVVARHLASEGSEVHVLLLGEN 83

Query: 554 AHPN 565
            HP+
Sbjct: 84  KHPD 87


>UniRef50_A5UM68 Cluster: Sugar kinase, YjeF-related protein family;
           n=1; Methanobrevibacter smithii ATCC 35061|Rep: Sugar
           kinase, YjeF-related protein family - Methanobrevibacter
           smithii (strain PS / ATCC 35061 / DSM 861)
          Length = 510

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 22/45 (48%), Positives = 26/45 (57%), Gaps = 2/45 (4%)
 Frame = +2

Query: 380 LMELAGLSVASAIAK--VFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG S+A  + K  V+  S     +I  G G NGGDG VAAR
Sbjct: 23  LMESAGKSLAEEVGKIAVYTFSKPVKIIIFTGSGGNGGDGFVAAR 67


>UniRef50_Q7VF29 Cluster: Putative uncharacterized protein; n=1;
           Helicobacter hepaticus|Rep: Putative uncharacterized
           protein - Helicobacter hepaticus
          Length = 477

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 2/85 (2%)
 Frame = +2

Query: 335 LDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALI--VCGPGNNGGDGLVAAR 508
           LD+    +Y  + + LME A  ++ S I  +    TH  ++I  +CG G+NGGDG   AR
Sbjct: 11  LDKRACEKYHLTPEILMENAACALESLINSL----THKGSVITILCGSGDNGGDGYALAR 66

Query: 509 ICSCSDTMYRYIILNAHPNLCMKTF 583
             S   ++  + +      LC++ +
Sbjct: 67  RLSGDYSIRIFQVKEPKSPLCIQAY 91


>UniRef50_Q6NEG9 Cluster: Putative uncharacterized protein; n=1;
           Corynebacterium diphtheriae|Rep: Putative
           uncharacterized protein - Corynebacterium diphtheriae
          Length = 502

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 21/46 (45%), Positives = 26/46 (56%)
 Frame = +2

Query: 374 DQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           D LM+ A  +VA A A    PS  ++  +V G G NGGDGL A  I
Sbjct: 23  DALMKQAAQAVAEA-AVCMVPSASAAITVVAGTGGNGGDGLYAGAI 67


>UniRef50_Q609D4 Cluster: YjeF-related protein; n=4; Bacteria|Rep:
           YjeF-related protein - Methylococcus capsulatus
          Length = 436

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +2

Query: 458 IVCGPGNNGGDGLVAARI 511
           +VCGPGNNGGDG V AR+
Sbjct: 3   VVCGPGNNGGDGYVIARL 20


>UniRef50_Q2SBB6 Cluster: Uncharacterized conserved protein; n=1;
           Hahella chejuensis KCTC 2396|Rep: Uncharacterized
           conserved protein - Hahella chejuensis (strain KCTC
           2396)
          Length = 496

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           +LM+ AG S   A+ + +P +   +  + CG GNNGGDG V A +
Sbjct: 29  ELMQRAGRSAFRALVRRWPEAARLT--LFCGGGNNGGDGYVVAEL 71


>UniRef50_A4EWA3 Cluster: YjeF family protein; n=6;
           Rhodobacteraceae|Rep: YjeF family protein - Roseobacter
           sp. SK209-2-6
          Length = 567

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +2

Query: 455 LIVCGPGNNGGDGLVAARI 511
           +++CGPGNNGGDG V AR+
Sbjct: 88  VVLCGPGNNGGDGFVVARL 106


>UniRef50_Q9Y9C5 Cluster: Putative uncharacterized protein; n=1;
           Aeropyrum pernix|Rep: Putative uncharacterized protein -
           Aeropyrum pernix
          Length = 499

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 368 SVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           S++ LME AG +VA  +  +      +   ++ G G NGGDG+ AAR
Sbjct: 34  SIELLMENAGNAVAGVLECLLGGLQGAKVAVLAGKGGNGGDGIAAAR 80


>UniRef50_O29407 Cluster: Putative uncharacterized protein; n=1;
           Archaeoglobus fulgidus|Rep: Putative uncharacterized
           protein - Archaeoglobus fulgidus
          Length = 464

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 22/43 (51%), Positives = 23/43 (53%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG  VA  + K F         I  G GNNGGDG VAAR
Sbjct: 26  LMENAGKGVAEEVMKRF---YEGKVQIFAGSGNNGGDGFVAAR 65


>UniRef50_Q89KF8 Cluster: Bll4947 protein; n=16;
           Alphaproteobacteria|Rep: Bll4947 protein -
           Bradyrhizobium japonicum
          Length = 511

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 22/43 (51%), Positives = 25/43 (58%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAA 505
           +LM  AG +VA A   +         LIV GPGNNGGDG VAA
Sbjct: 37  KLMLSAGQAVAEAANALVE---EGPILIVAGPGNNGGDGFVAA 76


>UniRef50_Q31EL4 Cluster: YjeF family protein; n=1; Thiomicrospira
           crunogena XCL-2|Rep: YjeF family protein -
           Thiomicrospira crunogena (strain XCL-2)
          Length = 490

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 18/43 (41%), Positives = 25/43 (58%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LM+ A       + + +P S   + L+VCG GNNGGDGL  A+
Sbjct: 28  LMKRAAYFSYQTLRRCYPDS--QNVLVVCGTGNNGGDGLALAQ 68


>UniRef50_A7AZ62 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus gnavus ATCC 29149|Rep: Putative
           uncharacterized protein - Ruminococcus gnavus ATCC 29149
          Length = 540

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = +2

Query: 344 DLFTEYKFSVDQL--MELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           D +T  K  +  L  ME A L     + +      H   L+VCG GNNGGDG   AR+
Sbjct: 55  DEYTIQKIGIPSLVLMERAALKTVEVMKEKGISLDH--CLVVCGSGNNGGDGFAVARL 110


>UniRef50_Q12UW3 Cluster: YjeF-related protein; n=2;
           Methanosarcinaceae|Rep: YjeF-related protein -
           Methanococcoides burtonii (strain DSM 6242)
          Length = 481

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 21/44 (47%), Positives = 26/44 (59%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           QLME AG ++A  + +        + LIV G GNNGGD  VAAR
Sbjct: 25  QLMENAGAAIAHEVRERVQKG---NVLIVAGRGNNGGDAFVAAR 65


>UniRef50_Q41FT3 Cluster: Putative uncharacterized protein; n=1;
           Exiguobacterium sibiricum 255-15|Rep: Putative
           uncharacterized protein - Exiguobacterium sibiricum
           255-15
          Length = 481

 Score = 37.1 bits (82), Expect = 0.36
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +2

Query: 371 VDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           ++ LME AG  +A  I      +     L++CG GNNGGDG V  R
Sbjct: 24  LEVLMERAGSEIAKRIKNRH--TREERILVMCGTGNNGGDGYVIGR 67


>UniRef50_Q0C0G6 Cluster: Carbohydrate kinase family protein; n=1;
           Hyphomonas neptunium ATCC 15444|Rep: Carbohydrate kinase
           family protein - Hyphomonas neptunium (strain ATCC
           15444)
          Length = 480

 Score = 37.1 bits (82), Expect = 0.36
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAA 505
           LM+ AG +VA  +   +P        ++CGPG NGGDG +AA
Sbjct: 28  LMQRAGEAVAEFVHAHWPDG---QIQVLCGPGGNGGDGFIAA 66


>UniRef50_A4BHY6 Cluster: Fused predicted sugar kinase
           fused/uncharaterized domain; n=1; Reinekea sp.
           MED297|Rep: Fused predicted sugar kinase
           fused/uncharaterized domain - Reinekea sp. MED297
          Length = 481

 Score = 37.1 bits (82), Expect = 0.36
 Identities = 17/40 (42%), Positives = 21/40 (52%)
 Frame = +2

Query: 389 LAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           L   +  S + + F    H S L+V G GNNGGDG   AR
Sbjct: 40  LMNAAAQSFVRQTFERVRHGSVLVVVGKGNNGGDGYCIAR 79


>UniRef50_A3ZQ50 Cluster: Putative uncharacterized protein; n=1;
           Blastopirellula marina DSM 3645|Rep: Putative
           uncharacterized protein - Blastopirellula marina DSM
           3645
          Length = 230

 Score = 37.1 bits (82), Expect = 0.36
 Identities = 23/66 (34%), Positives = 29/66 (43%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           + + +  A+DQ    +Y      LME A    A     +    T     I CG GNNGGD
Sbjct: 10  ITRQQVRAVDQIAIEQYGVPGVVLMENA----ARGCVDILAARTAQCVRICCGKGNNGGD 65

Query: 491 GLVAAR 508
           GL  AR
Sbjct: 66  GLAMAR 71


>UniRef50_Q4QFL5 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 560

 Score = 37.1 bits (82), Expect = 0.36
 Identities = 20/43 (46%), Positives = 24/43 (55%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG +     A ++    H   LI+ G GNNGGDG V AR
Sbjct: 47  LMERAGRAAYDVFANLYTSQKHW--LILVGSGNNGGDGYVIAR 87


>UniRef50_Q0LLI8 Cluster: Putative uncharacterized protein; n=1;
           Herpetosiphon aurantiacus ATCC 23779|Rep: Putative
           uncharacterized protein - Herpetosiphon aurantiacus ATCC
           23779
          Length = 567

 Score = 36.7 bits (81), Expect = 0.47
 Identities = 19/43 (44%), Positives = 23/43 (53%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LM  A   +A     V    T+ S L++ G GNNGGD LV AR
Sbjct: 33  LMAEAARGMADVGLTVIAKQTNPSVLVLVGSGNNGGDALVIAR 75


>UniRef50_A6C2V3 Cluster: Putative uncharacterized protein; n=1;
           Planctomyces maris DSM 8797|Rep: Putative
           uncharacterized protein - Planctomyces maris DSM 8797
          Length = 232

 Score = 36.7 bits (81), Expect = 0.47
 Identities = 23/66 (34%), Positives = 30/66 (45%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           L++ E  ++DQ    E+      LME AG  V   +  +          I  G GNNGGD
Sbjct: 7   LSRDEVRSVDQRTIEEFGLPGVALMENAGRGVFELLTSL---KATGPVKICVGKGNNGGD 63

Query: 491 GLVAAR 508
           G V AR
Sbjct: 64  GFVIAR 69


>UniRef50_A2E0R1 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 231

 Score = 36.7 bits (81), Expect = 0.47
 Identities = 21/57 (36%), Positives = 27/57 (47%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYIIL 550
           LM  A   V   I   +P + +    I+CG GNNGGDG   A I S +    R + L
Sbjct: 29  LMYNAAKCVTEHIKNKYPETNNFG--ILCGKGNNGGDGFAIAHILSIAGKSVRVVAL 83


>UniRef50_Q46AS3 Cluster: Putative uncharacterized protein; n=2;
           Methanosarcina barkeri str. Fusaro|Rep: Putative
           uncharacterized protein - Methanosarcina barkeri (strain
           Fusaro / DSM 804)
          Length = 154

 Score = 36.7 bits (81), Expect = 0.47
 Identities = 23/66 (34%), Positives = 32/66 (48%)
 Frame = +2

Query: 191 IFLNVIVQVVRECSNIACSKTDNIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFS 370
           +FL + +     CSN   +KTD I T  S  N CNT T  +N   +  L +   T Y F 
Sbjct: 15  VFLVLSMTGAAACSNSCNTKTDTINTACS--NSCNTKTDAINDCYSFNLKKCPHTAYCFR 72

Query: 371 VDQLME 388
            D L++
Sbjct: 73  YDTLLK 78


>UniRef50_Q6MF43 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Protochlamydia amoebophila UWE25|Rep:
           Putative uncharacterized protein - Protochlamydia
           amoebophila (strain UWE25)
          Length = 499

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +2

Query: 365 FSVDQLMELAGLSVASAIAK-VFPPSTHSSALIVCGPGNNGGDGLVA 502
           FS    ME AG  +A AI + +      +  +++CG GNNGGD  VA
Sbjct: 21  FSALDFMEKAGYGIALAIKEFILKHPLINHIVLLCGKGNNGGDAYVA 67


>UniRef50_Q5WLC1 Cluster: Putative uncharacterized protein; n=1;
           Bacillus clausii KSM-K16|Rep: Putative uncharacterized
           protein - Bacillus clausii (strain KSM-K16)
          Length = 511

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 23/69 (33%), Positives = 31/69 (44%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           R +   E A++D     +       LME AG  +A  +   +         IV G GNNG
Sbjct: 2   RIVTGEEMASIDAITMNKVGLPGAVLMENAGRGIARKLLDHY--GRKRRFFIVIGSGNNG 59

Query: 485 GDGLVAARI 511
           GDG V AR+
Sbjct: 60  GDGFVVARV 68


>UniRef50_Q15NR5 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Pseudoalteromonas atlantica T6c|Rep: Carbohydrate
           kinase, YjeF related protein - Pseudoalteromonas
           atlantica (strain T6c / BAA-1087)
          Length = 504

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 27/79 (34%), Positives = 39/79 (49%)
 Frame = +2

Query: 275 SSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSA 454
           SS++Q   + + + Q E AA     +  Y      LM+ AG  V   +  +FP   H+  
Sbjct: 8   SSLSQKVFLAQQVRQQEKAAAAASGYQMYA-----LMQRAGQGVFRHLKVIFP-YVHN-L 60

Query: 455 LIVCGPGNNGGDGLVAARI 511
           L+V G GNN GDG V A +
Sbjct: 61  LVVVGAGNNAGDGYVVATL 79


>UniRef50_Q04U35 Cluster: Sugar kinase; n=2; Leptospira
           borgpetersenii serovar Hardjo-bovis|Rep: Sugar kinase -
           Leptospira borgpetersenii serovar Hardjo-bovis (strain
           JB197)
          Length = 533

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 21/64 (32%), Positives = 29/64 (45%)
 Frame = +2

Query: 314 NQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDG 493
           +  E+  LD++       S    M  A LS+     K     ++    I+CG GNNGGDG
Sbjct: 14  DDEESRDLDRETILHSGISGSHFMGFAALSIYQTYRKKL--LSYDLVQILCGNGNNGGDG 71

Query: 494 LVAA 505
           L  A
Sbjct: 72  LALA 75


>UniRef50_A2U7X6 Cluster: Carbohydrate kinase, YjeF related protein;
           n=2; Bacillus|Rep: Carbohydrate kinase, YjeF related
           protein - Bacillus coagulans 36D1
          Length = 500

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 19/43 (44%), Positives = 26/43 (60%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG  +  A+A +   S   +  ++ G GNNGGDG+V AR
Sbjct: 26  LMENAGSGLYRALAPLL--SKRDTIAVLSGKGNNGGDGIVLAR 66


>UniRef50_A1U4D0 Cluster: Carbohydrate kinase, YjeF related protein;
           n=2; Marinobacter|Rep: Carbohydrate kinase, YjeF related
           protein - Marinobacter aquaeolei (strain ATCC 700491 /
           DSM 11845 / VT8)(Marinobacter hydrocarbonoclasticus
           (strain DSM 11845))
          Length = 520

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +2

Query: 332 ALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDG-LVAA 505
           A+D+ L  +      +LM+ A  S    +   +P +     L++CG GNNGGDG LVAA
Sbjct: 21  AMDRYLIEQQGVDGFELMQTAARSAFRHLVAFWPGA--QPVLVLCGAGNNGGDGYLVAA 77


>UniRef50_A7DRE3 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Candidatus Nitrosopumilus maritimus SCM1|Rep:
           Carbohydrate kinase, YjeF related protein - Candidatus
           Nitrosopumilus maritimus SCM1
          Length = 215

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYIILNAH 559
           +ME AG +    + +        + LI  G GNNGGDGLV AR  +  +     ++L   
Sbjct: 25  MMENAGAAAVKRLVEKLGNVDSKNILIFVGMGNNGGDGLVMARHLAGYNAKVTVMLLGNP 84

Query: 560 PNL-CMKTFWN 589
            N+   ++ WN
Sbjct: 85  ENIKTEESNWN 95


>UniRef50_Q7MRY0 Cluster: Putative uncharacterized protein; n=1;
           Wolinella succinogenes|Rep: Putative uncharacterized
           protein - Wolinella succinogenes
          Length = 462

 Score = 35.9 bits (79), Expect = 0.82
 Identities = 24/63 (38%), Positives = 30/63 (47%)
 Frame = +2

Query: 323 EAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           E + LD      +  S + LME A  S+A  I   F     S   IV G GNNG DG+  
Sbjct: 7   EVSTLDSAAVELFGMSHELLMENAARSLAELIRARFRAG--SVVRIVSGSGNNGADGIAL 64

Query: 503 ARI 511
           AR+
Sbjct: 65  ARM 67


>UniRef50_Q21H97 Cluster: Putative uncharacterized protein; n=2;
           Gammaproteobacteria|Rep: Putative uncharacterized
           protein - Saccharophagus degradans (strain 2-40 / ATCC
           43961 / DSM 17024)
          Length = 500

 Score = 35.9 bits (79), Expect = 0.82
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICS 517
           LM+ AG +    + + +P     S +++CG GNNGGDG V A + +
Sbjct: 34  LMKRAGRAAFELLLEQWPQV--ESVVVLCGAGNNGGDGYVIAALAA 77


>UniRef50_A6M301 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Clostridium beijerinckii NCIMB 8052|Rep:
           Carbohydrate kinase, YjeF related protein - Clostridium
           beijerinckii NCIMB 8052
          Length = 502

 Score = 35.9 bits (79), Expect = 0.82
 Identities = 24/62 (38%), Positives = 29/62 (46%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYIILNAH 559
           LME A +S+   I+         S LI+CG GNNGGD L  AR         R  IL+  
Sbjct: 28  LMENAAISLFGEIS-----DKGESFLILCGKGNNGGDALALARHLILDGKKVRVYILSKD 82

Query: 560 PN 565
            N
Sbjct: 83  EN 84


>UniRef50_A0KGR6 Cluster: YjeF protein; n=1; Aeromonas hydrophila
           subsp. hydrophila ATCC 7966|Rep: YjeF protein -
           Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966
           / NCIB 9240)
          Length = 503

 Score = 35.9 bits (79), Expect = 0.82
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 1/61 (1%)
 Frame = +2

Query: 332 ALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSAL-IVCGPGNNGGDGLVAAR 508
           AL+++       ++  LME AG ++ +     +P   HS    I  GPGNNGGDG V AR
Sbjct: 29  ALEREWAEREGLALYTLMERAGAALRTYATHHWP---HSRCWWIFTGPGNNGGDGYVLAR 85

Query: 509 I 511
           +
Sbjct: 86  L 86


>UniRef50_A5Z6Q1 Cluster: Putative uncharacterized protein; n=1;
           Eubacterium ventriosum ATCC 27560|Rep: Putative
           uncharacterized protein - Eubacterium ventriosum ATCC
           27560
          Length = 493

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 20/44 (45%), Positives = 23/44 (52%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           LME A LSVA  + K          L+V G GNNG DG+   RI
Sbjct: 28  LMERAALSVAEIVCK--NQLKDKKILVVAGVGNNGADGVAICRI 69


>UniRef50_A1ZZG6 Cluster: YjeF family protein; n=1; Microscilla
           marina ATCC 23134|Rep: YjeF family protein - Microscilla
           marina ATCC 23134
          Length = 510

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 2/71 (2%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVAS-AIAKVFPPSTHSSALIV-CGPGN 478
           + L   +   LD     +   S   LME A ++  +  + K F  +     + V CG GN
Sbjct: 2   KILTAKQTKELDAYTIEQDAISSINLMERASVAFTNWFLRKGFSQNNRKRPVFVFCGLGN 61

Query: 479 NGGDGLVAARI 511
           NGGDGL  AR+
Sbjct: 62  NGGDGLAIARL 72


>UniRef50_Q58981 Cluster: Uncharacterized protein MJ1586; n=2;
           Methanococcales|Rep: Uncharacterized protein MJ1586 -
           Methanococcus jannaschii
          Length = 491

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 20/43 (46%), Positives = 23/43 (53%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG +V   I  +         +I CG GNNGGDG V AR
Sbjct: 52  LMENAGKAVYEEIKDI----DAEEFIIFCGTGNNGGDGFVVAR 90


>UniRef50_Q8F7K5 Cluster: Putative uncharacterized protein; n=2;
           Leptospira interrogans|Rep: Putative uncharacterized
           protein - Leptospira interrogans
          Length = 584

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 22/61 (36%), Positives = 27/61 (44%)
 Frame = +2

Query: 314 NQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDG 493
           N  E+  LD++       S    M  A LSV     K     +     I+CG GNNGGDG
Sbjct: 14  NDQESRDLDRNTIFSSGISGSHFMGFAALSVYQKFRKQI--LSFDRIEILCGNGNNGGDG 71

Query: 494 L 496
           L
Sbjct: 72  L 72


>UniRef50_Q64XD8 Cluster: Putative sugar kinase; n=2; Bacteroides
           fragilis|Rep: Putative sugar kinase - Bacteroides
           fragilis
          Length = 503

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +2

Query: 368 SVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           S+D LME A  ++  AI + +  +T     +  GPGNNGGD L  AR+
Sbjct: 24  SID-LMERAAQALTKAITERWDITT--PVTVFAGPGNNGGDALAVARM 68


>UniRef50_A0RRH5 Cluster: YjeF-related protein; n=2;
           Proteobacteria|Rep: YjeF-related protein - Campylobacter
           fetus subsp. fetus (strain 82-40)
          Length = 461

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 21/58 (36%), Positives = 29/58 (50%)
 Frame = +2

Query: 338 DQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARI 511
           D++    Y  +   L E A LSVA+ +         S  L+VCG GNN  D + AAR+
Sbjct: 12  DKNCILNYGLNELILQENAALSVANLVRVNL--KIGSKILVVCGGGNNASDAIAAARM 67


>UniRef50_Q8ESK8 Cluster: Hypothetical conserved protein; n=1;
           Oceanobacillus iheyensis|Rep: Hypothetical conserved
           protein - Oceanobacillus iheyensis
          Length = 509

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 20/43 (46%), Positives = 24/43 (55%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           LME AG  V+  I K    +     L++ G GNNGGDG V AR
Sbjct: 27  LMENAGREVSREIKKRI--TKKDVILVLVGGGNNGGDGFVVAR 67


>UniRef50_Q1YRZ2 Cluster: Putative uncharacterized protein; n=1;
           gamma proteobacterium HTCC2207|Rep: Putative
           uncharacterized protein - gamma proteobacterium HTCC2207
          Length = 517

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 18/59 (30%), Positives = 30/59 (50%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYIILN 553
           +LM+ AG +  + + + F   T S   + CG GNN GDG + A + +      R + L+
Sbjct: 46  KLMKRAGRAAFNELLEAF--GTASLITVFCGSGNNAGDGYIVATLAAEKSLAVRVVELS 102


>UniRef50_Q1N268 Cluster: Putative uncharacterized protein; n=1;
           Oceanobacter sp. RED65|Rep: Putative uncharacterized
           protein - Oceanobacter sp. RED65
          Length = 506

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 23/64 (35%), Positives = 33/64 (51%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYIILNA 556
           +LM+ AG   A+ +A +   S+ S  +I  G GNNGGDG V A++    +     I L A
Sbjct: 31  ELMQQAG--EAAFVALLNQWSSVSKLVIYAGAGNNGGDGYVIAKLAKDHEIDAEVIALKA 88

Query: 557 HPNL 568
              L
Sbjct: 89  PSEL 92


>UniRef50_A7GW49 Cluster: YjeF-related protein; n=2;
           Campylobacter|Rep: YjeF-related protein - Campylobacter
           curvus 525.92
          Length = 466

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 23/61 (37%), Positives = 29/61 (47%)
 Frame = +2

Query: 329 AALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           A LD     ++    + LME A  S+A+ I K F   T    L VCG GNN  D   A R
Sbjct: 9   AELDARASEKFGLGDEILMENAAASIANFIRKKFKKRT--KILGVCGAGNNAADVFAALR 66

Query: 509 I 511
           +
Sbjct: 67  M 67


>UniRef50_A3RYF0 Cluster: Nitric-oxide reductase subunit C; n=18;
           Burkholderiaceae|Rep: Nitric-oxide reductase subunit C -
           Ralstonia solanacearum UW551
          Length = 559

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 21/42 (50%), Positives = 25/42 (59%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAA 505
           LM  AG + A  + +   P  H   L+V GPGNNGGD LVAA
Sbjct: 75  LMARAGEAAADWL-QARTPRGH--LLLVAGPGNNGGDALVAA 113


>UniRef50_A3HYM1 Cluster: Putative sugar kinase; n=1; Algoriphagus
           sp. PR1|Rep: Putative sugar kinase - Algoriphagus sp.
           PR1
          Length = 489

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 22/69 (31%), Positives = 28/69 (40%)
 Frame = +2

Query: 305 RYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNG 484
           + +   +   LD+        S  +LMELA +                   I CG GNNG
Sbjct: 3   KIIEGEQVKVLDKKHIENSGQSSHELMELAAIGFTKWFLHQ-KSFRKEHVYIFCGAGNNG 61

Query: 485 GDGLVAARI 511
           GDGL  ARI
Sbjct: 62  GDGLAIARI 70


>UniRef50_A3DIW6 Cluster: Carbohydrate kinase, YjeF related protein;
           n=1; Clostridium thermocellum ATCC 27405|Rep:
           Carbohydrate kinase, YjeF related protein - Clostridium
           thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 515

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR-ICS 517
           LME A + V   I K +    + + +++ G GNNGGD    AR +C+
Sbjct: 27  LMENAAVRVTDEILKDYGSLVNKNIVLLAGKGNNGGDAFAIARHLCN 73


>UniRef50_Q8NSS3 Cluster: Predicted sugar kinase; n=3;
           Corynebacterium|Rep: Predicted sugar kinase -
           Corynebacterium glutamicum (Brevibacterium flavum)
          Length = 574

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 5/54 (9%)
 Frame = +2

Query: 356 EYKFSVDQLMELAGLSVAS-AIAKVFPP----STHSSALIVCGPGNNGGDGLVA 502
           E +   D+LM  A  +VA  A+A V  P    S+  S L++ GPG NGGD L A
Sbjct: 19  ELQADPDELMISAASAVADVALAMVDGPAPAVSSEESILLLVGPGGNGGDALYA 72


>UniRef50_Q7VH02 Cluster: Putative uncharacterized protein; n=2;
           Bacteria|Rep: Putative uncharacterized protein -
           Helicobacter hepaticus
          Length = 823

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = -1

Query: 621 INYINIESYALFQKVFIQRFGCAFRIMYRYIVSEQ-LHILAATKPSPPLFPGP 466
           I  I+  + A+F    I   GC F ++++Y  S Q L +   T P PP  P P
Sbjct: 266 IQNISKHNLAVFYLALICASGCLFMMLHKYFTSAQRLDLQCTTPPPPPPHPTP 318


>UniRef50_Q62JL9 Cluster: Carbohydrate kinase, putative; n=18;
           Burkholderia|Rep: Carbohydrate kinase, putative -
           Burkholderia mallei (Pseudomonas mallei)
          Length = 531

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 21/42 (50%), Positives = 22/42 (52%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAA 505
           LME AG S A  +A     S         GPGNNGGD LVAA
Sbjct: 49  LMERAGKSAAQWLAARLV-SDPRPVWFAVGPGNNGGDALVAA 89


>UniRef50_Q18A74 Cluster: Putative carbohydrate kinase; n=3;
           Clostridium difficile|Rep: Putative carbohydrate kinase
           - Clostridium difficile (strain 630)
          Length = 526

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 14/22 (63%), Positives = 17/22 (77%)
 Frame = +2

Query: 443 HSSALIVCGPGNNGGDGLVAAR 508
           ++S  +VCG GNNGGDGL  AR
Sbjct: 44  YNSYTVVCGVGNNGGDGLGIAR 65


>UniRef50_Q03UV9 Cluster: Putative uncharacterized protein; n=1;
           Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293|Rep: Putative uncharacterized protein - Leuconostoc
           mesenteroides subsp. mesenteroides (strain ATCC 8293
           /NCDO 523)
          Length = 221

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 21/71 (29%), Positives = 33/71 (46%)
 Frame = +2

Query: 299 VTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGN 478
           +TR +  +E   +D           D L+E A ++V   I       +H   L++ G GN
Sbjct: 1   MTRLVTATEMQQIDNYTIETIGMPQDVLIERAAMAVLDVIGAGRFDLSH--VLVLAGLGN 58

Query: 479 NGGDGLVAARI 511
           NG DG+  AR+
Sbjct: 59  NGADGVAIARL 69


>UniRef50_Q8EJ73 Cluster: YjeF protein; n=16; Shewanella|Rep: YjeF
           protein - Shewanella oneidensis
          Length = 499

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 3/56 (5%)
 Frame = +2

Query: 353 TEYKFSVDQLMELAGLSVASAIAKVFP--PSTHSSALIV-CGPGNNGGDGLVAARI 511
           +E K ++ QL+E AG +    +A      P   S  L+V  G GNNG D LV AR+
Sbjct: 27  SEGKTTLYQLVERAGRAAFDCLATQIARQPRLESMPLLVLAGSGNNGADALVCARL 82


>UniRef50_Q4JU58 Cluster: Putative uncharacterized protein; n=1;
           Corynebacterium jeikeium K411|Rep: Putative
           uncharacterized protein - Corynebacterium jeikeium
           (strain K411)
          Length = 582

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 6/54 (11%)
 Frame = +2

Query: 374 DQLMELAGLSVASAIAKVFPPS------THSSALIVCGPGNNGGDGLVAARICS 517
           D+LM+ A  +VA    K+   +         S L++ GPG NGGD L A  + S
Sbjct: 25  DELMQSAAHAVAVVTEKILAQAEAPAGAAEDSVLLLVGPGGNGGDALYAGAVLS 78


>UniRef50_Q3VXG5 Cluster: Twin-arginine translocation pathway
           signal; n=2; Frankia|Rep: Twin-arginine translocation
           pathway signal - Frankia sp. EAN1pec
          Length = 506

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCS---DTMYRYII 547
           +L++  GL  A+ +A V  P+T  S L  CG G +GG G  + RI   S    ++  Y  
Sbjct: 73  RLVDRRGLLKAAGMAAVAAPAT--SLLAACGGGGSGGSGARSVRIGMVSPRTGSLRLYSE 130

Query: 548 LNAHPNLCMKTFWNN 592
           ++AH    M+T + +
Sbjct: 131 VDAHVVETMRTIFKD 145


>UniRef50_Q0IC48 Cluster: Carbohydrate kinase family protein; n=9;
           Cyanobacteria|Rep: Carbohydrate kinase family protein -
           Synechococcus sp. (strain CC9311)
          Length = 517

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +2

Query: 371 VDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           V  LME  G ++A    +          L++ GPG+NGGDGLV AR
Sbjct: 32  VAALMEAVGQAMADWCLQR-RKRLEQGVLVLVGPGHNGGDGLVLAR 76


>UniRef50_A4C8M1 Cluster: Putative uncharacterized protein; n=1;
           Pseudoalteromonas tunicata D2|Rep: Putative
           uncharacterized protein - Pseudoalteromonas tunicata D2
          Length = 411

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +2

Query: 365 FSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAA 505
           F + ++M+ AG +V   I   +    H   LI+ G GNN GDG + A
Sbjct: 32  FDLSEVMQKAGAAVFQYIEHHY--GNHRRLLILLGKGNNAGDGYIVA 76


>UniRef50_UPI00015BAF79 Cluster: carbohydrate kinase, YjeF related
           protein; n=1; Ignicoccus hospitalis KIN4/I|Rep:
           carbohydrate kinase, YjeF related protein - Ignicoccus
           hospitalis KIN4/I
          Length = 461

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 21/48 (43%), Positives = 29/48 (60%)
 Frame = +2

Query: 365 FSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           F  + +ME AG    S +A++  P  +S  L++ G G  GGDGLVAAR
Sbjct: 25  FGEELMMENAG----SWVARLAYPEGNSF-LVLAGKGGKGGDGLVAAR 67


>UniRef50_A5CSB9 Cluster: Putative uncharacterized protein; n=1;
           Clavibacter michiganensis subsp. michiganensis NCPPB
           382|Rep: Putative uncharacterized protein - Clavibacter
           michiganensis subsp. michiganensis (strain NCPPB 382)
          Length = 230

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 18/43 (41%), Positives = 24/43 (55%)
 Frame = +2

Query: 377 QLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAA 505
           QLM +A   +A A   + P       L++ G GNNGGD L+AA
Sbjct: 29  QLMRVAAAGLARACRALAPDGP---VLVLVGAGNNGGDALLAA 68


>UniRef50_A2BXZ7 Cluster: Predicted sugar kinase fused to
           uncharacterized domain; n=5; Prochlorococcus
           marinus|Rep: Predicted sugar kinase fused to
           uncharacterized domain - Prochlorococcus marinus (strain
           MIT 9515)
          Length = 522

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = +2

Query: 374 DQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           + LME AG+ ++  + K      +   +++ GPG+NGGDG V A+
Sbjct: 36  EALMEKAGIQISRWLLKR-KFLLNKGVIVLIGPGHNGGDGAVIAK 79


>UniRef50_Q89ZF4 Cluster: Xylulose kinase; n=1; Bacteroides
           thetaiotaomicron|Rep: Xylulose kinase - Bacteroides
           thetaiotaomicron
          Length = 505

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 28/108 (25%), Positives = 42/108 (38%)
 Frame = +2

Query: 221 RECSNIACSKTDNIGTMTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGL 400
           R C  IA   +D  GT    +N+       +   EAA LD  LF E + S+D + E+   
Sbjct: 162 RLCGTIATDPSDASGTNAYDLNRWQWSEEII---EAAELDLSLFPEVRSSIDVIGEITNE 218

Query: 401 SVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYI 544
           +          P       ++CG G+    G+     C    T Y Y+
Sbjct: 219 AARETGLLAGTP-------VICGGGDGSCAGVGVG--CVAPGTAYNYL 257


>UniRef50_Q31NR6 Cluster: Putative uncharacterized protein; n=2;
           Synechococcus elongatus|Rep: Putative uncharacterized
           protein - Synechococcus sp. (strain PCC 7942) (Anacystis
           nidulans R2)
          Length = 511

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
 Frame = +2

Query: 332 ALDQDLFTEYKFSVDQLME-LAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAAR 508
           A++  LF      V  LME +AGL ++  +   +P  T    + V GPG+NGGD LV AR
Sbjct: 19  AIESRLFAA-GMPVAALMEKVAGL-LSQRLQMAYPDRTQRWGIWV-GPGHNGGDALVVAR 75


>UniRef50_A6SY82 Cluster: Uncharacterized conserved protein; n=2;
           Oxalobacteraceae|Rep: Uncharacterized conserved protein
           - Janthinobacterium sp. (strain Marseille)
           (Minibacterium massiliensis)
          Length = 502

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSS-ALIVCGPGNNGGDGLVAA 505
           LM+ AG +      ++   S      L++ GPGNNGGD L AA
Sbjct: 29  LMQRAGTAAGELAYQLLQSSDKERRVLVLAGPGNNGGDALEAA 71


>UniRef50_Q45H72 Cluster: Laminin alpha 1; n=9; Euteleostomi|Rep:
            Laminin alpha 1 - Danio rerio (Zebrafish) (Brachydanio
            rerio)
          Length = 3075

 Score = 32.7 bits (71), Expect = 7.7
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +2

Query: 425  VFPPSTHSSALIVCGPGNNGGDGLVAARICSCS 523
            + PP TH      C  G+ G DG+   ++C+CS
Sbjct: 1018 ICPPHTHGLKCEQCDEGHWGHDGVSGCKVCNCS 1050


>UniRef50_A6F3K0 Cluster: Putative carbohydrate kinase; n=1;
           Marinobacter algicola DG893|Rep: Putative carbohydrate
           kinase - Marinobacter algicola DG893
          Length = 523

 Score = 32.7 bits (71), Expect = 7.7
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +2

Query: 380 LMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDG-LVAA 505
           LM+ A       + + +P       L++CG GNNGGDG LVAA
Sbjct: 37  LMQAAAAGAFRRLVRNWPEP--GRVLVLCGAGNNGGDGYLVAA 77


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 610,669,671
Number of Sequences: 1657284
Number of extensions: 12195804
Number of successful extensions: 28489
Number of sequences better than 10.0: 202
Number of HSP's better than 10.0 without gapping: 27431
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28448
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 47711253245
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -