SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20069
         (636 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precur...   166   5e-40
UniRef50_A2Y4X8 Cluster: Putative uncharacterized protein; n=1; ...   140   3e-32
UniRef50_A2Y3V8 Cluster: Putative uncharacterized protein; n=4; ...   133   4e-30
UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock...   130   2e-29
UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome sho...   130   4e-29
UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=23...   130   4e-29
UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931; roo...   130   4e-29
UniRef50_P02826 Cluster: Heat shock 70 kDa protein cognate 1; n=...   127   3e-28
UniRef50_Q4P628 Cluster: Putative uncharacterized protein; n=1; ...   121   2e-26
UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep: ...   120   4e-26
UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago...   119   5e-26
UniRef50_UPI000058655A Cluster: PREDICTED: similar to heat shock...   112   8e-24
UniRef50_A2WTX8 Cluster: Putative uncharacterized protein; n=1; ...   109   7e-23
UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9; ...   108   1e-22
UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2; ...   106   4e-22
UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein...    99   4e-20
UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n...    99   8e-20
UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial precur...    98   2e-19
UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia stip...    97   2e-19
UniRef50_Q4XZF4 Cluster: Putative uncharacterized protein; n=1; ...    95   1e-18
UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular...    95   1e-18
UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas vaginali...    95   1e-18
UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3; ...    95   2e-18
UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular ...    94   2e-18
UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1; ...    93   5e-18
UniRef50_A0DHP4 Cluster: Chromosome undetermined scaffold_50, wh...    91   2e-17
UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|R...    91   2e-17
UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia stip...    91   3e-17
UniRef50_Q3SD91 Cluster: Cytosol-type hsp70; n=1; Paramecium tet...    90   5e-17
UniRef50_A7HBX9 Cluster: 2-alkenal reductase precursor; n=7; Cys...    89   8e-17
UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular...    89   8e-17
UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG070...    89   1e-16
UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole gen...    87   3e-16
UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:...    86   6e-16
UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas s...    86   6e-16
UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1; ...    85   1e-15
UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n...    84   2e-15
UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gamb...    84   3e-15
UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168, w...    83   4e-15
UniRef50_Q0VDF9 Cluster: Heat shock 70 kDa protein 14; n=25; Eut...    83   4e-15
UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3; Planctomyc...    83   4e-15
UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellula...    83   7e-15
UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular...    82   1e-14
UniRef50_UPI0000D56BFD Cluster: PREDICTED: similar to CG8937-PA,...    80   5e-14
UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2; Enta...    79   7e-14
UniRef50_UPI00015B551B Cluster: PREDICTED: similar to ENSANGP000...    79   1e-13
UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1; Aca...    79   1e-13
UniRef50_Q9VUC1 Cluster: CG6603-PA, isoform A; n=7; Endopterygot...    78   2e-13
UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular ...    78   2e-13
UniRef50_Q1CY00 Cluster: DnaK family protein; n=2; Cystobacterin...    77   3e-13
UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    77   3e-13
UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus...    77   5e-13
UniRef50_A2VD43 Cluster: Heat shock protein 14; n=3; Clupeocepha...    76   6e-13
UniRef50_A7RF55 Cluster: Predicted protein; n=1; Nematostella ve...    76   6e-13
UniRef50_A5AUN6 Cluster: Putative uncharacterized protein; n=1; ...    75   1e-12
UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2; Panspora...    75   1e-12
UniRef50_A6NJU0 Cluster: Uncharacterized protein HSPA14; n=2; Eu...    75   2e-12
UniRef50_O88687 Cluster: Heat shock protein 70; n=2; Euteleostom...    74   3e-12
UniRef50_Q20752 Cluster: Putative uncharacterized protein stc-1;...    74   3e-12
UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4; Planctomyc...    73   4e-12
UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    71   2e-11
UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus ...    71   2e-11
UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38; Bacteria|...    71   2e-11
UniRef50_Q4SW20 Cluster: Chromosome undetermined SCAF13693, whol...    71   2e-11
UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella natan...    71   2e-11
UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    71   2e-11
UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular or...    71   3e-11
UniRef50_A4QNX8 Cluster: Zgc:162281 protein; n=6; Eumetazoa|Rep:...    70   5e-11
UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2; Anaeromyxob...    70   5e-11
UniRef50_P48723 Cluster: Stress 70 protein chaperone microsome-a...    70   5e-11
UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular ...    70   5e-11
UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella nata...    69   7e-11
UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n...    69   7e-11
UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter ...    69   9e-11
UniRef50_A2ECF5 Cluster: DnaK protein; n=1; Trichomonas vaginali...    69   1e-10
UniRef50_UPI0000E474BD Cluster: PREDICTED: hypothetical protein;...    68   2e-10
UniRef50_Q6F9S6 Cluster: Chaperone protein; n=2; Acinetobacter|R...    68   2e-10
UniRef50_Q010Y3 Cluster: DNAK_GLOVI Chaperone protein dnaK; n=1;...    68   2e-10
UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock...    67   3e-10
UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 7...    67   4e-10
UniRef50_Q05036 Cluster: Uncharacterized protein C30C11.4; n=2; ...    67   4e-10
UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial ...    67   4e-10
UniRef50_Q1CWT5 Cluster: DnaK family protein; n=2; Cystobacterin...    66   5e-10
UniRef50_Q96269 Cluster: Heat-shock protein; n=14; Magnoliophyta...    66   5e-10
UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1; Syntroph...    66   9e-10
UniRef50_Q5C1F3 Cluster: SJCHGC04997 protein; n=1; Schistosoma j...    66   9e-10
UniRef50_O15797 Cluster: CG4; n=10; Plasmodium|Rep: CG4 - Plasmo...    66   9e-10
UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonosp...    66   9e-10
UniRef50_UPI0000499AA8 Cluster: hsp70 family protein; n=1; Entam...    65   2e-09
UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia bu...    65   2e-09
UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone...    65   2e-09
UniRef50_A3BBU4 Cluster: Putative uncharacterized protein; n=2; ...    65   2e-09
UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacif...    64   2e-09
UniRef50_Q2H062 Cluster: Putative uncharacterized protein; n=2; ...    64   2e-09
UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena t...    64   3e-09
UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodosp...    64   4e-09
UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA...    63   5e-09
UniRef50_Q00YD5 Cluster: Heat shock protein 91-Arabidopsis thali...    63   5e-09
UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27; P...    63   5e-09
UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26; Bacteria|...    63   6e-09
UniRef50_P77319 Cluster: Chaperone protein hscC; n=19; Gammaprot...    63   6e-09
UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=...    62   8e-09
UniRef50_Q4RM18 Cluster: Chromosome 10 SCAF15019, whole genome s...    62   8e-09
UniRef50_Q54GD7 Cluster: Heat shock protein Hsp70 family protein...    62   8e-09
UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    62   8e-09
UniRef50_Q06068 Cluster: 97 kDa heat shock protein; n=3; Strongy...    62   8e-09
UniRef50_O59838 Cluster: Heat shock protein homolog pss1; n=21; ...    62   8e-09
UniRef50_Q22CW2 Cluster: Heat shock protein 70 homolog; n=1; Tet...    62   1e-08
UniRef50_O14992 Cluster: HS24/P52; n=8; Eutheria|Rep: HS24/P52 -...    62   1e-08
UniRef50_Q92598 Cluster: Heat shock protein 105 kDa; n=92; Eumet...    62   1e-08
UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock...    61   2e-08
UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Re...    61   2e-08
UniRef50_P32590 Cluster: Heat shock protein homolog SSE2; n=20; ...    61   2e-08
UniRef50_Q7ZUM5 Cluster: Heat shock protein 4; n=20; Euteleostom...    61   3e-08
UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein), HSP7...    61   3e-08
UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter ...    61   3e-08
UniRef50_A5MZQ7 Cluster: DnaK9; n=1; Clostridium kluyveri DSM 55...    61   3e-08
UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshime...    61   3e-08
UniRef50_A2E407 Cluster: DnaK protein; n=1; Trichomonas vaginali...    61   3e-08
UniRef50_A6C7U7 Cluster: DnaK protein (Heat shock protein), HSP7...    60   3e-08
UniRef50_Q73CC4 Cluster: Dnak protein, truncation; n=1; Bacillus...    60   6e-08
UniRef50_A4J964 Cluster: Heat shock protein 70; n=2; Clostridial...    60   6e-08
UniRef50_A0NUH2 Cluster: Putative uncharacterized protein; n=1; ...    60   6e-08
UniRef50_A2DR00 Cluster: DnaK protein; n=7; Trichomonas vaginali...    59   1e-07
UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1; Methanospir...    58   1e-07
UniRef50_Q4QDQ2 Cluster: Heat shock protein, putative; n=5; Tryp...    58   2e-07
UniRef50_A2EMY0 Cluster: DnaK protein; n=4; Trichomonas vaginali...    58   2e-07
UniRef50_Q9SAB1 Cluster: F25C20.19 protein; n=3; core eudicotyle...    57   3e-07
UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29; Proteobac...    57   3e-07
UniRef50_A2E4A6 Cluster: DnaK protein; n=2; Trichomonas vaginali...    57   4e-07
UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: Dna...    56   5e-07
UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone...    56   5e-07
UniRef50_Q1D211 Cluster: DnaK family protein; n=1; Myxococcus xa...    56   5e-07
UniRef50_A6EQS3 Cluster: Heat shock protein Hsp70; n=1; unidenti...    56   5e-07
UniRef50_A6CBP2 Cluster: Dnak protein, truncation; n=1; Planctom...    56   5e-07
UniRef50_Q64YI6 Cluster: Chaperone protein DnaK; n=2; Bacteroide...    56   7e-07
UniRef50_Q1NR74 Cluster: Heat shock protein Hsp70; n=3; Proteoba...    56   7e-07
UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia intest...    56   7e-07
UniRef50_P87142 Cluster: Heat shock protein 70 homolog C57A7.12;...    56   9e-07
UniRef50_A6C7U8 Cluster: DnaK protein (Heat shock protein), C-te...    55   1e-06
UniRef50_A3FQM0 Cluster: Heat shock 105kD; heat shock 105kD alph...    55   1e-06
UniRef50_A2DWC1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    55   1e-06
UniRef50_A4ZY06 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2; Actinomy...    55   2e-06
UniRef50_A5N5I5 Cluster: DnaK1; n=1; Clostridium kluyveri DSM 55...    54   2e-06
UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein), C-te...    54   3e-06
UniRef50_A7BR82 Cluster: Heat shock protein Hsp70; n=1; Beggiato...    54   3e-06
UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1; Saccharo...    54   4e-06
UniRef50_Q9GYV8 Cluster: 70-kDa heat shock protein; n=5; Entamoe...    54   4e-06
UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera a...    54   4e-06
UniRef50_UPI0000499107 Cluster: 70 kDa heat shock protein; n=1; ...    53   7e-06
UniRef50_A4AEG2 Cluster: Putative uncharacterized protein; n=1; ...    53   7e-06
UniRef50_Q57VU9 Cluster: Heat shock 70 kDa protein, putative; n=...    53   7e-06
UniRef50_Q4CS27 Cluster: Putative uncharacterized protein; n=3; ...    53   7e-06
UniRef50_A2EPF1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    53   7e-06
UniRef50_A2DHP3 Cluster: Heat shock protein, putative; n=1; Tric...    53   7e-06
UniRef50_A5MZQ6 Cluster: DnaK8; n=2; Clostridium kluyveri DSM 55...    52   9e-06
UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep...    52   1e-05
UniRef50_A6GJQ9 Cluster: Heat shock protein Hsp70; n=1; Plesiocy...    52   2e-05
UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2; Gammapro...    51   2e-05
UniRef50_A2F0R7 Cluster: DnaK protein; n=2; Trichomonas vaginali...    51   2e-05
UniRef50_Q9S8V5 Cluster: ATP-binding HSP70 homolog; n=4; cellula...    51   3e-05
UniRef50_Q3VZ88 Cluster: Heat shock protein Hsp70; n=1; Frankia ...    50   4e-05
UniRef50_A7AN53 Cluster: DnaK family protein; n=1; Babesia bovis...    50   4e-05
UniRef50_A2FPJ8 Cluster: Heat shock protein SSB-related protein;...    50   4e-05
UniRef50_Q4P3F6 Cluster: Putative uncharacterized protein; n=1; ...    50   4e-05
UniRef50_Q1E6G2 Cluster: Heat shock protein 70 homolog; n=17; Pe...    50   4e-05
UniRef50_UPI00006CA81B Cluster: dnaK protein; n=1; Tetrahymena t...    50   5e-05
UniRef50_A1G644 Cluster: Heat shock protein 70; n=2; Salinispora...    50   5e-05
UniRef50_A2FVJ6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    50   5e-05
UniRef50_A2ECV1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    50   5e-05
UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginali...    50   6e-05
UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative g...    49   8e-05
UniRef50_A4FEW4 Cluster: Putative surface layer protein; n=1; Sa...    49   8e-05
UniRef50_Q4Q9A4 Cluster: Heat shock 70 protein-like protein; n=3...    49   8e-05
UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera a...    49   8e-05
UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera aphi...    49   1e-04
UniRef50_Q2QXK2 Cluster: DnaK protein, expressed; n=2; Oryza sat...    49   1e-04
UniRef50_Q4N5P7 Cluster: Heat shock protein 110, putative; n=2; ...    49   1e-04
UniRef50_Q8YNT4 Cluster: DnaK-type molecular chaperone; n=2; Nos...    48   1e-04
UniRef50_Q4ETY1 Cluster: Putative uncharacterized protein; n=2; ...    48   1e-04
UniRef50_Q08P77 Cluster: Chaperone protein DnaK, putative; n=1; ...    48   2e-04
UniRef50_A2DQ03 Cluster: DnaK protein; n=1; Trichomonas vaginali...    48   2e-04
UniRef50_Q8TGR5 Cluster: Uncharacterized protein YEL030C-A; n=2;...    48   2e-04
UniRef50_Q3WFH0 Cluster: Heat shock protein Hsp70; n=1; Frankia ...    47   3e-04
UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3; Psychrobacter...    47   3e-04
UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;...    47   3e-04
UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum fer...    47   4e-04
UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM 55...    47   4e-04
UniRef50_Q0RLI8 Cluster: Putative uncharacterized protein; n=2; ...    46   6e-04
UniRef50_A2DQX2 Cluster: DnaK protein; n=1; Trichomonas vaginali...    46   6e-04
UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1; Enta...    46   0.001
UniRef50_UPI0000498B17 Cluster: hsp70 family protein; n=1; Entam...    46   0.001
UniRef50_Q7QSV2 Cluster: GLP_127_4161_1624; n=1; Giardia lamblia...    46   0.001
UniRef50_P38788 Cluster: Ribosome-associated complex subunit SSZ...    46   0.001
UniRef50_A0W7A3 Cluster: Heat shock protein, HSP70 family; n=4; ...    45   0.001
UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lambl...    45   0.001
UniRef50_Q9TX41 Cluster: 200 kDa wall antigen; n=1; Cryptosporid...    45   0.002
UniRef50_Q7M080 Cluster: DnaK-type molecular chaperone; n=1; Cri...    44   0.002
UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila aurari...    44   0.002
UniRef50_A2F7Z8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    44   0.002
UniRef50_Q5KHV7 Cluster: Heat shock protein HSP60, putative; n=2...    44   0.002
UniRef50_UPI000049A5F3 Cluster: hsp70 family protein; n=1; Entam...    44   0.003
UniRef50_UPI0000510557 Cluster: COG0443: Molecular chaperone; n=...    44   0.004
UniRef50_A2E5D4 Cluster: DnaK protein; n=3; Trichomonas vaginali...    44   0.004
UniRef50_Q9Y4L1 Cluster: Hypoxia up-regulated protein 1 precurso...    44   0.004
UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock...    43   0.005
UniRef50_A2E1V3 Cluster: DnaK protein; n=1; Trichomonas vaginali...    43   0.005
UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188; Bacteria...    31   0.006
UniRef50_A2G573 Cluster: DnaK protein; n=2; Trichomonas vaginali...    43   0.007
UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma marg...    42   0.009
UniRef50_A0DJC4 Cluster: Chromosome undetermined scaffold_53, wh...    42   0.009
UniRef50_A1FNI8 Cluster: Glutamate dehydrogenase; n=1; Pseudomon...    42   0.012
UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1; Planctom...    42   0.016
UniRef50_Q9M7S4 Cluster: Heat shock protein 70; n=1; Triticum ae...    42   0.016
UniRef50_Q4RRT3 Cluster: Chromosome 16 SCAF15002, whole genome s...    41   0.022
UniRef50_Q9SKY8 Cluster: 70kD heat shock protein; n=6; Magnoliop...    41   0.022
UniRef50_A5N5I8 Cluster: DnaK4; n=1; Clostridium kluyveri DSM 55...    41   0.029
UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM 55...    41   0.029
UniRef50_Q9UQC1 Cluster: Heat shock protein 72; n=10; Fungi/Meta...    41   0.029
UniRef50_UPI000049A5EA Cluster: hsp70 family protein; n=1; Entam...    40   0.038
UniRef50_Q8RH06 Cluster: Putative uncharacterized protein FN0115...    40   0.038
UniRef50_A2EFJ4 Cluster: DnaK protein; n=1; Trichomonas vaginali...    40   0.050
UniRef50_Q6CM78 Cluster: Similarities with sp|Q12355 Saccharomyc...    40   0.050
UniRef50_A1XM67 Cluster: Heat shock protein Hsp70-6; n=1; Blasto...    40   0.050
UniRef50_Q98BE0 Cluster: DnaK-type molecular chaperone; DnaK; n=...    40   0.066
UniRef50_Q1D082 Cluster: DnaK family protein; n=2; Cystobacterin...    40   0.066
UniRef50_O46067 Cluster: CG2918-PA; n=3; Diptera|Rep: CG2918-PA ...    40   0.066
UniRef50_Q805J2 Cluster: Heat shock protein 70-like protein; n=1...    39   0.088
UniRef50_Q9VSI1 Cluster: CG7182-PA; n=2; Sophophora|Rep: CG7182-...    39   0.088
UniRef50_Q86JV8 Cluster: Similar to heat shock protein; n=2; Dic...    39   0.088
UniRef50_A2FYV4 Cluster: DnaK protein; n=1; Trichomonas vaginali...    39   0.088
UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13; Rickett...    39   0.12 
UniRef50_A2F6W8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    39   0.12 
UniRef50_A2DAR6 Cluster: DnaK protein; n=2; Trichomonas vaginali...    39   0.12 
UniRef50_Q8SWH2 Cluster: Similarity to HSP70-RELATED PROTEIN; n=...    39   0.12 
UniRef50_UPI000049A3E9 Cluster: 70 kDa heat shock protein; n=2; ...    38   0.15 
UniRef50_A6FX30 Cluster: Chaperone protein DnaK; n=1; Plesiocyst...    38   0.15 
UniRef50_A5VT75 Cluster: Putative NAD-specific glutamate dehydro...    38   0.15 
UniRef50_A2UL28 Cluster: Glutamate dehydrogenase; n=5; Enterobac...    38   0.15 
UniRef50_A2XF45 Cluster: Putative uncharacterized protein; n=1; ...    38   0.15 
UniRef50_Q22758 Cluster: Putative uncharacterized protein; n=2; ...    38   0.15 
UniRef50_A2F432 Cluster: DnaK protein; n=1; Trichomonas vaginali...    38   0.15 
UniRef50_UPI00004999A1 Cluster: 70 kDa heat shock protein; n=4; ...    38   0.20 
UniRef50_A4ZIR9 Cluster: Heat shock protein 70; n=12; Closterovi...    38   0.20 
UniRef50_A1R9R9 Cluster: Putative DnaK family protein; n=1; Arth...    38   0.20 
UniRef50_A0YV37 Cluster: Heat shock protein 70; n=2; Oscillatori...    38   0.20 
UniRef50_Q388G4 Cluster: Putative uncharacterized protein; n=1; ...    38   0.20 
UniRef50_Q22E65 Cluster: DnaK protein; n=1; Tetrahymena thermoph...    38   0.20 
UniRef50_A2DZ76 Cluster: DnaK protein; n=1; Trichomonas vaginali...    38   0.20 
UniRef50_A6UND5 Cluster: 2-alkenal reductase; n=1; Methanococcus...    38   0.20 
UniRef50_UPI0000D55C7E Cluster: PREDICTED: similar to CG2918-PA;...    38   0.27 
UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1; N...    38   0.27 
UniRef50_O23508 Cluster: Growth regulator like protein; n=6; Mag...    38   0.27 
UniRef50_A4RY30 Cluster: Heat Shock Protein 70, ER lumen; n=2; O...    38   0.27 
UniRef50_Q3XWY0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.35 
UniRef50_A3CIL0 Cluster: Putative uncharacterized protein; n=2; ...    37   0.35 
UniRef50_A7SM46 Cluster: Predicted protein; n=1; Nematostella ve...    37   0.47 
UniRef50_A2EVQ1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    37   0.47 
UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena ...    36   0.62 
UniRef50_A2FKE2 Cluster: DnaK protein; n=3; Trichomonas vaginali...    36   0.62 
UniRef50_A2R006 Cluster: Contig An12c0210, complete genome; n=1;...    36   0.62 
UniRef50_Q1GHW3 Cluster: Molecular chaperone DnaK; n=15; Bacteri...    36   0.82 
UniRef50_A6EMR6 Cluster: Heat shock protein Hsp70; n=1; unidenti...    36   0.82 
UniRef50_A0NRW0 Cluster: Heat shock protein Hsp70; n=1; Stappia ...    36   0.82 
UniRef50_A7DID8 Cluster: Glutamate dehydrogenase; n=14; Alphapro...    36   1.1  
UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago...    36   1.1  
UniRef50_Q4Q5R6 Cluster: Putative uncharacterized protein; n=3; ...    36   1.1  
UniRef50_UPI0000DB7485 Cluster: PREDICTED: similar to CG2918-PA;...    35   1.4  
UniRef50_Q4SWT1 Cluster: Chromosome undetermined SCAF13528, whol...    35   1.4  
UniRef50_O57013 Cluster: Hsp-70 protein; n=2; Grapevine leafroll...    35   1.4  
UniRef50_A7DFU0 Cluster: Molecular chaperone, HSP70 class; n=2; ...    35   1.4  
UniRef50_A7AWJ8 Cluster: Tetratricopeptide repeat domain contain...    35   1.9  
UniRef50_A2FS75 Cluster: DnaK protein; n=1; Trichomonas vaginali...    35   1.9  
UniRef50_A7TP95 Cluster: Putative uncharacterized protein; n=1; ...    35   1.9  
UniRef50_A4FAH5 Cluster: Putative uncharacterized protein; n=1; ...    34   2.5  
UniRef50_Q1JTE8 Cluster: Putative uncharacterized protein; n=1; ...    34   2.5  
UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14; R...    34   2.5  
UniRef50_UPI0000499E28 Cluster: hsp70 family protein; n=1; Entam...    33   4.4  
UniRef50_UPI0000660D8E Cluster: Homolog of Homo sapiens "heat sh...    33   4.4  
UniRef50_A0Q8B3 Cluster: Cytochrome bd-II terminal oxidase subun...    33   4.4  
UniRef50_Q5KGD4 Cluster: Putative uncharacterized protein; n=1; ...    33   4.4  
UniRef50_Q1VU26 Cluster: Heat shock protein Hsp70; n=2; Bacteroi...    33   5.8  
UniRef50_A5UZU4 Cluster: Cell division protein FtsA; n=5; Chloro...    33   5.8  
UniRef50_Q655N4 Cluster: Putative heat-shock protein; n=2; Oryza...    33   5.8  
UniRef50_Q5DEW6 Cluster: SJCHGC09345 protein; n=1; Schistosoma j...    33   5.8  
UniRef50_Q0CA66 Cluster: Predicted protein; n=1; Aspergillus ter...    33   5.8  
UniRef50_Q7T733 Cluster: P60; n=2; Little cherry virus 2|Rep: P6...    33   7.6  
UniRef50_Q5P3N0 Cluster: Molecular chaperone, Hsp70 class; n=34;...    33   7.6  
UniRef50_Q1YQP4 Cluster: Heat shock protein, Hsp70 family protei...    33   7.6  
UniRef50_A6TT94 Cluster: 40-residue YVTN family beta-propeller r...    33   7.6  
UniRef50_Q6L715 Cluster: Polyketide synthase; n=18; Fungi|Rep: P...    33   7.6  
UniRef50_Q1E2H7 Cluster: Putative uncharacterized protein; n=1; ...    33   7.6  

>UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78); n=736;
           root|Rep: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78) - Homo
           sapiens (Human)
          Length = 654

 Score =  166 bits (403), Expect = 5e-40
 Identities = 74/86 (86%), Positives = 83/86 (96%)
 Frame = +2

Query: 248 QEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           +E+K +D+GTV+GIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAFT +GERLIGDA
Sbjct: 20  EEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDA 79

Query: 428 AKNQLTTNPENTVFDAKRLIGREWSD 505
           AKNQLT+NPENTVFDAKRLIGR W+D
Sbjct: 80  AKNQLTSNPENTVFDAKRLIGRTWND 105



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           P+VQ D+KF PFKVVEK +KP++QV    G  K FAPEEISAMVL
Sbjct: 106 PSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVL 150


>UniRef50_A2Y4X8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 391

 Score =  140 bits (339), Expect = 3e-32
 Identities = 64/78 (82%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           GTVIGIDLGTTYSCVGVY+N RVEIIANDQGNRITPS+VAFT  GERLIG+AAKNQ   N
Sbjct: 44  GTVIGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAAN 103

Query: 452 PENTVFDAKRLIGREWSD 505
           PE T++DAKRLIGR++SD
Sbjct: 104 PERTIYDAKRLIGRQFSD 121



 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ D+K  PF VV++N KPHV+V+   GD +VF+PEE+SAMVL
Sbjct: 124 VQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAMVL 166


>UniRef50_A2Y3V8 Cluster: Putative uncharacterized protein; n=4;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 430

 Score =  133 bits (321), Expect = 4e-30
 Identities = 62/78 (79%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           GTVIGIDLGTTYSCVGVY+NG VEIIANDQGNRITPS+VAFT  GERLIG+AAKNQ   N
Sbjct: 39  GTVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTGGGERLIGEAAKNQAAAN 98

Query: 452 PENTVFDAKRLIGREWSD 505
           P  TV+DAKRLIG  ++D
Sbjct: 99  PGRTVYDAKRLIGLRFAD 116



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ D++  PF VV+K  KPHV+V+   GD ++ +PEE+SAMVL
Sbjct: 119 VQRDMRLLPFAVVDKGGKPHVRVEVRGGDVRLLSPEEVSAMVL 161


>UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock
           protein 2; n=1; Pan troglodytes|Rep: PREDICTED: similar
           to heat shock protein 2 - Pan troglodytes
          Length = 640

 Score =  130 bits (315), Expect = 2e-29
 Identities = 63/91 (69%), Positives = 72/91 (79%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 5   GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 63

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           P NT+FDAKRLIGR++ D      +   P R
Sbjct: 64  PTNTIFDAKRLIGRKFEDATVQSDMKHWPFR 94


>UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome
           shotgun sequence; n=3; Fungi/Metazoa group|Rep:
           Chromosome 3 SCAF9564, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 414

 Score =  130 bits (313), Expect = 4e-29
 Identities = 62/78 (79%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 6   GLAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALN 64

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVFDAKRLIGR+  D
Sbjct: 65  PNNTVFDAKRLIGRKLDD 82



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 25/44 (56%), Positives = 31/44 (70%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           PTVQ DVK +PFKV+    KP +QV+    +K F PEEIS+MVL
Sbjct: 83  PTVQADVKLWPFKVIGDGGKPKIQVEYKGEEKSFYPEEISSMVL 126


>UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=239;
           Eukaryota|Rep: Heat shock cognate 71 kDa protein - Homo
           sapiens (Human)
          Length = 646

 Score =  130 bits (313), Expect = 4e-29
 Identities = 61/78 (78%), Positives = 68/78 (87%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  N
Sbjct: 4   GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMN 62

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVFDAKRLIGR + D
Sbjct: 63  PTNTVFDAKRLIGRRFDD 80



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 83  VQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVL 124


>UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931;
           root|Rep: Heat shock 70 kDa protein 1 - Homo sapiens
           (Human)
          Length = 641

 Score =  130 bits (313), Expect = 4e-29
 Identities = 61/75 (81%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFGD 80



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 81  PVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 124


>UniRef50_P02826 Cluster: Heat shock 70 kDa protein cognate 1; n=2;
           melanogaster subgroup|Rep: Heat shock 70 kDa protein
           cognate 1 - Drosophila simulans (Fruit fly)
          Length = 214

 Score =  127 bits (306), Expect = 3e-28
 Identities = 58/75 (77%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP N
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-ESERLIGDAAKNQVAMNPNN 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR + D
Sbjct: 66  TIFDAKRLIGRRFDD 80


>UniRef50_Q4P628 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 225

 Score =  121 bits (291), Expect = 2e-26
 Identities = 59/75 (78%), Positives = 63/75 (84%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVG + N RVEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ   NP+ 
Sbjct: 19  IGIDLGTTYSCVGWWVNERVEIIANDQGNRTTPSYVAFT-ESERLIGDAAKNQAAMNPKQ 77

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR + D
Sbjct: 78  TVFDAKRLIGRRYDD 92


>UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep:
           GLP_623_6850_8883 - Giardia lamblia ATCC 50803
          Length = 677

 Score =  120 bits (288), Expect = 4e-26
 Identities = 54/77 (70%), Positives = 64/77 (83%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           T+IGIDLGTTYSCV V + G+VEII N+ G R+TPSYVAFT DGERL+GDAAKN    +P
Sbjct: 29  TIIGIDLGTTYSCVAVSRAGQVEIIPNELGARVTPSYVAFTADGERLVGDAAKNYAPISP 88

Query: 455 ENTVFDAKRLIGREWSD 505
           ENT+FD KRLIGR++ D
Sbjct: 89  ENTIFDVKRLIGRKFDD 105



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/49 (44%), Positives = 32/49 (65%), Gaps = 5/49 (10%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQ-----GDKVFAPEEISAMVL 636
           P VQ D+K  P+KV+ K+ +P VQ+  +       +K+ +PEEISAMVL
Sbjct: 106 PEVQKDMKLLPYKVINKDGRPFVQLSGTNLPKELQNKIMSPEEISAMVL 154


>UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 592

 Score =  119 bits (287), Expect = 5e-26
 Identities = 60/89 (67%), Positives = 72/89 (80%), Gaps = 4/89 (4%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLT 445
           G  +GIDLGTTYSCV V+  ++ RVEII NDQGN+ TPS+VAFT D +RL+GDAAKNQ  
Sbjct: 7   GCAVGIDLGTTYSCVAVWLDEHNRVEIIHNDQGNKTTPSFVAFTDD-QRLVGDAAKNQAP 65

Query: 446 TNPENTVFDAKRLIGREWSDQLY--NMML 526
           TNPENTVFDAKRLIGR++ D +   +MML
Sbjct: 66  TNPENTVFDAKRLIGRKFGDSVVQNDMML 94



 Score = 36.7 bits (81), Expect = 0.47
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVV-EKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ+D+  +PFKV+   N KP + V+    +K    EEIS+MVL
Sbjct: 88  VQNDMMLWPFKVICGVNDKPMISVKCKGQEKHLCAEEISSMVL 130


>UniRef50_UPI000058655A Cluster: PREDICTED: similar to heat shock
           protein protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 684

 Score =  112 bits (269), Expect = 8e-24
 Identities = 53/78 (67%), Positives = 66/78 (84%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGT+ SCVGV++NG VEII ND GNR TPS VAFT D E LIG+ A NQ++ NP+
Sbjct: 8   VIGIDLGTSCSCVGVFQNGTVEIIPNDYGNRTTPSCVAFT-DREILIGEEANNQMSKNPK 66

Query: 458 NTVFDAKRLIGREWSDQL 511
           NT+FDAKRLIGR+++D++
Sbjct: 67  NTIFDAKRLIGRQFNDEV 84



 Score = 36.7 bits (81), Expect = 0.47
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ  +K +PF V+  + KP +QV+        +PEE+S+MVL
Sbjct: 85  VQSGMKHWPFTVINTDGKPMLQVEYIGVTGTLSPEEVSSMVL 126


>UniRef50_A2WTX8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 359

 Score =  109 bits (261), Expect = 7e-23
 Identities = 51/78 (65%), Positives = 60/78 (76%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G VIGIDLGT  SCV V++NGR EI+ N+ G R TPSY AFT D ERL+GDAAK+Q + N
Sbjct: 59  GPVIGIDLGTACSCVAVWQNGRAEIVTNEHGGRATPSYAAFT-DAERLVGDAAKSQASRN 117

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVF  KRL+GR +SD
Sbjct: 118 PTNTVFATKRLMGRRFSD 135



 Score = 33.1 bits (72), Expect = 5.8
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ  +K +PFKVV  +  KP V        K+ A EE+++M+L
Sbjct: 137 SVQDGLKLWPFKVVPGRGDKPMVAASYKGKQKLLAAEEVASMLL 180


>UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9;
           Trypanosomatidae|Rep: Heat shock cognate HSP70 protein -
           Trypanosoma brucei brucei
          Length = 676

 Score =  108 bits (260), Expect = 1e-22
 Identities = 52/77 (67%), Positives = 61/77 (79%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV++N RVEIIANDQGNR TPSYVAF  + E L+GDAAK+        
Sbjct: 7   IGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFV-NNEVLVGDAAKSHAARGSNG 65

Query: 461 TVFDAKRLIGREWSDQL 511
            +FDAKRLIGR++SD +
Sbjct: 66  VIFDAKRLIGRKFSDSV 82


>UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2;
           Ostreococcus|Rep: Heat Shock Protein 70, cytosolic -
           Ostreococcus lucimarinus CCE9901
          Length = 711

 Score =  106 bits (255), Expect = 4e-22
 Identities = 47/83 (56%), Positives = 65/83 (78%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGTTYSCV V++NG   ++ N +G+R TPS+VAFT+ G RL+GDAAK Q   NP+
Sbjct: 171 VIGIDLGTTYSCVSVWRNGEAHVLTNAEGDRTTPSWVAFTEQG-RLVGDAAKRQAAINPK 229

Query: 458 NTVFDAKRLIGREWSDQLYNMML 526
           NT+F+ KR+IGR++S+  + + L
Sbjct: 230 NTLFNIKRIIGRQYSECAHELEL 252



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 20/41 (48%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = +1

Query: 517 HDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           H+++  PF V E +  KP V V  +   K FAPE+ISAMVL
Sbjct: 248 HELELMPFDVKEGEGGKPIVSVDVNGEKKDFAPEQISAMVL 288


>UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein;
           n=1; Dictyostelium discoideum AX4|Rep: Heat shock
           protein Hsp70 family protein - Dictyostelium discoideum
           AX4
          Length = 517

 Score =   99 bits (238), Expect = 4e-20
 Identities = 42/80 (52%), Positives = 62/80 (77%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           ++GID GT ++CVG++KN R+EI  N QGNR TPS V+F  D ++L+GD AK Q+  NP 
Sbjct: 6   IMGIDFGTHFACVGIFKNERIEICPNQQGNRTTPSVVSFVGD-DKLVGDEAKAQMDRNPL 64

Query: 458 NTVFDAKRLIGREWSDQLYN 517
           NT++D KRL+GR+ +D+L++
Sbjct: 65  NTIYDVKRLLGRKTTDELFD 84


>UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n=2;
           Trichomonas vaginalis|Rep: Heat shock cognate protein,
           putative - Trichomonas vaginalis G3
          Length = 622

 Score = 99.1 bits (236), Expect = 8e-20
 Identities = 44/76 (57%), Positives = 61/76 (80%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGIDLGTT+SCVGV+ NG+V+II N+ GNRITPS V +  +G++++GDAA   L + P+
Sbjct: 18  IIGIDLGTTFSCVGVFMNGKVDIIPNEVGNRITPS-VVYIGNGKKIVGDAAMPYLVSEPK 76

Query: 458 NTVFDAKRLIGREWSD 505
           NT++  KRLIGR +SD
Sbjct: 77  NTIYAIKRLIGRRFSD 92



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 16/44 (36%), Positives = 32/44 (72%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ+++    +KV++KN+ P+V++  +   + ++PEEIS+M+L
Sbjct: 93  PEVQNEIPHLGYKVIDKNNHPYVEINNNGVIEHYSPEEISSMIL 136


>UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial
           precursor; n=291; root|Rep: Stress-70 protein,
           mitochondrial precursor - Homo sapiens (Human)
          Length = 679

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +2

Query: 233 RLCRRQEEKDKDI-GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           RL  R++   + I G V+GIDLGTT SCV V +  + +++ N +G R TPS VAFT DGE
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 410 RLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           RL+G  AK Q  TNP NT +  KRLIGR + D
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDD 130


>UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 946

 Score = 97.5 bits (232), Expect = 2e-19
 Identities = 49/76 (64%), Positives = 59/76 (77%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGTT SCV V+ N +VE+IAN  G+RITPS V+F  D E +IG+ AKNQL  NPE
Sbjct: 5   VIGIDLGTTNSCVAVFNN-KVEVIANVLGSRITPSCVSF-DDNETIIGEGAKNQLGKNPE 62

Query: 458 NTVFDAKRLIGREWSD 505
           NTV+  KRLIGR++ D
Sbjct: 63  NTVYGTKRLIGRDFDD 78



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 25/44 (56%), Positives = 30/44 (68%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQHD+  F FKVV +N KP +QVQ  +  +   PEEISAMVL
Sbjct: 79  PEVQHDITHFLFKVVNRNGKPFIQVQYKKEIRTLPPEEISAMVL 122


>UniRef50_Q4XZF4 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 128

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 44/90 (48%), Positives = 60/90 (66%)
 Frame = +2

Query: 236 LCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL 415
           LC  +   ++  G +IGIDLGTT SCV + +  + ++I N +G R TPS VAFT D +RL
Sbjct: 29  LCTSKVNHNRASGDIIGIDLGTTNSCVAIMEGKQGKVIENAEGFRTTPSVVAFTNDNQRL 88

Query: 416 IGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           +G  AK Q  TNPENTV+  KR IGR++ +
Sbjct: 89  VGIVAKRQAITNPENTVYATKRFIGRKFDE 118


>UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular
           organisms|Rep: Chaperone protein dnaK1 - Synechocystis
           sp. (strain PCC 6803)
          Length = 692

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 43/79 (54%), Positives = 52/79 (65%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           +G VIGIDLGTT SC  V + G+  +I N +G R TPS V FT+  +RL+G  AK Q  T
Sbjct: 1   MGKVIGIDLGTTNSCASVLEGGKPIVITNTEGGRTTPSIVGFTKGSQRLVGQLAKRQSVT 60

Query: 449 NPENTVFDAKRLIGREWSD 505
           N ENTV+  KR IGR W D
Sbjct: 61  NAENTVYSIKRFIGRRWDD 79


>UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas
           vaginalis|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 617

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 47/93 (50%), Positives = 64/93 (68%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGTT+S VG+YKNG VEII N+   +ITPS V++  +G R++GD+A    T +PE
Sbjct: 14  VIGIDLGTTFSVVGIYKNGEVEIIPNEINKKITPSVVSY-YNGSRVVGDSAVRLGTISPE 72

Query: 458 NTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKR 556
            TVF  KRLIGR++SD +    +   P   ++R
Sbjct: 73  TTVFAVKRLIGRKFSDPIVQQEMHRVPFTIVER 105



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 18/44 (40%), Positives = 32/44 (72%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ ++   PF +VE++ +P++++ T + D + +PEEISA+VL
Sbjct: 89  PIVQQEMHRVPFTIVERDERPYIKISTEEEDTLISPEEISALVL 132


>UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 623

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 45/77 (58%), Positives = 56/77 (72%), Gaps = 1/77 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL-IGDAAKNQLTTNP 454
           V+GID+G TYSCV VY  GRVEII NDQG+R+TPS+VAFT  G RL +G+AAK Q   +P
Sbjct: 36  VLGIDIGATYSCVAVYCKGRVEIIPNDQGSRLTPSWVAFTDGGGRLVVGEAAKEQAVGSP 95

Query: 455 ENTVFDAKRLIGREWSD 505
              V D  RL+G++  D
Sbjct: 96  GRAVHDFMRLLGKKLGD 112



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 20/43 (46%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ ++   P+ VV+   KPHV V+ + GD +V +PEEI+A VL
Sbjct: 115 VQREMTRLPYAVVDMEGKPHVLVEAADGDVRVLSPEEIAAAVL 157


>UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular
           organisms|Rep: Chaperone protein dnaK - Bordetella
           bronchiseptica (Alcaligenes bronchisepticus)
          Length = 641

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 45/92 (48%), Positives = 60/92 (65%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGIDLGTT SCV V   G+V+II N +G R TPS VA+  DGE L+G  AK Q  TNP+
Sbjct: 4   IIGIDLGTTNSCVAVLDGGQVKIIENAEGARTTPSIVAYMDDGETLVGAPAKRQAVTNPK 63

Query: 458 NTVFDAKRLIGREWSDQLYNMMLSSSPSRSLK 553
           NT++  KRLIGR++ ++     +   P   +K
Sbjct: 64  NTLYAVKRLIGRKFDEKAVQKDIDLMPYSIVK 95


>UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: HEAT SHOCK RELATED 70kDa
           PROTEIN - Encephalitozoon cuniculi
          Length = 683

 Score = 93.1 bits (221), Expect = 5e-18
 Identities = 43/86 (50%), Positives = 61/86 (70%), Gaps = 1/86 (1%)
 Frame = +2

Query: 251 EEKDK-DIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           EEK K +    IGIDLGTT+SCV  Y +G+VE+I N  G R TPS V+F ++   ++G A
Sbjct: 3   EEKAKSNTSRAIGIDLGTTFSCVAGYISGKVEVITNQDGERTTPSVVSFDENNCTVVGTA 62

Query: 428 AKNQLTTNPENTVFDAKRLIGREWSD 505
           A+N + ++P + +FDAKR+IGRE+ D
Sbjct: 63  ARNMVGSDPMSVIFDAKRMIGREFDD 88


>UniRef50_A0DHP4 Cluster: Chromosome undetermined scaffold_50, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_50,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 598

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 42/76 (55%), Positives = 56/76 (73%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGIDLGT  SCVG+++NG VEII N++G R TPS VAFT  G  +IG  A NQ   NP 
Sbjct: 23  IIGIDLGTKNSCVGIFRNGNVEIIPNEEGKRKTPSVVAFTDKG-LIIGKEANNQAIINPS 81

Query: 458 NTVFDAKRLIGREWSD 505
            T+++ KRL+GR+++D
Sbjct: 82  RTLYNIKRLMGRKFAD 97



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 26/46 (56%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQG--DKVFAPEEISAMVL 636
           P+VQ+D KF P+++VE + KP + VQ  +G   K+FAPEEISAMVL
Sbjct: 98  PSVQNDRKFMPYEIVELDDKPQIMVQNIKGFSSKMFAPEEISAMVL 143


>UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|Rep:
           Chaperone protein DnaK - Roseiflexus sp. RS-1
          Length = 624

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 41/76 (53%), Positives = 53/76 (69%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           ++GIDLGTT S V V + G   +I N +GNR TPS VAFT++GERL+G  AK Q T NP+
Sbjct: 4   IVGIDLGTTNSVVAVMEGGDPVVIPNAEGNRTTPSVVAFTKNGERLVGQTAKRQATINPD 63

Query: 458 NTVFDAKRLIGREWSD 505
           NT +  KR IGR + +
Sbjct: 64  NTFYSIKRFIGRNFDE 79


>UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 593

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 46/89 (51%), Positives = 58/89 (65%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV++N RVEII N+ G R TPS VAF       IG+AA N+   NP N
Sbjct: 5   IGIDLGTTYSCVGVFRNQRVEIIPNELGKRTTPSCVAFNSFHTH-IGEAAVNERAENPTN 63

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRS 547
           T+F  KR+IG++  D +       + S+S
Sbjct: 64  TIFGIKRIIGKDSYDDVGKFPFEITKSKS 92


>UniRef50_Q3SD91 Cluster: Cytosol-type hsp70; n=1; Paramecium
           tetraurelia|Rep: Cytosol-type hsp70 - Paramecium
           tetraurelia
          Length = 604

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 44/77 (57%), Positives = 56/77 (72%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLG  YS VGV  N + E+IAN+ GN+ TPSYVAF  D E LIG+AA NQ   NP N
Sbjct: 9   IGIDLGLKYSRVGVMINDQFELIANEFGNKFTPSYVAFV-DNEILIGEAALNQQAKNPTN 67

Query: 461 TVFDAKRLIGREWSDQL 511
           T+++  RL+GR +SD++
Sbjct: 68  TIYNVMRLMGRRFSDKI 84


>UniRef50_A7HBX9 Cluster: 2-alkenal reductase precursor; n=7;
           Cystobacterineae|Rep: 2-alkenal reductase precursor -
           Anaeromyxobacter sp. Fw109-5
          Length = 542

 Score = 89.0 bits (211), Expect = 8e-17
 Identities = 38/78 (48%), Positives = 58/78 (74%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTT +CV   ++   +++  D+GN I P+ VA +  G+ L+G+ AK+QL TNP+
Sbjct: 9   VLGIDLGTTNACVAHVRSRIPKVVPTDRGNLILPTVVALSDRGDLLVGNVAKDQLVTNPK 68

Query: 458 NTVFDAKRLIGREWSDQL 511
           NT++ AKRLIGR+WS ++
Sbjct: 69  NTIYGAKRLIGRKWSSRV 86


>UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular
           organisms|Rep: Chaperone protein dnaK - Brucella
           melitensis
          Length = 637

 Score = 89.0 bits (211), Expect = 8e-17
 Identities = 42/78 (53%), Positives = 50/78 (64%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGID+GTT SCV V      ++I N +G R TPS +AFT   ERL G  AK Q  TNPE
Sbjct: 4   VIGIDMGTTNSCVAVMDGKNAKVIENAEGARTTPSIIAFTDGDERLAGQPAKRQAVTNPE 63

Query: 458 NTVFDAKRLIGREWSDQL 511
            T+F  KRLIGR + D +
Sbjct: 64  GTLFAVKRLIGRRYDDPM 81


>UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG07033;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG07033 - Caenorhabditis
           briggsae
          Length = 547

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 44/93 (47%), Positives = 61/93 (65%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTT+SCV  Y+NG+V ++ N+ G R TPS +A T+DG+ LIG  AK+ + T   +
Sbjct: 3   IGIDLGTTFSCVAYYQNGQVNVLENENGCRTTPSVLAMTEDGDCLIGQHAKD-VITKATS 61

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRT 559
           ++FD KR+IGR + D L    +   P R  K T
Sbjct: 62  SLFDVKRIIGRRFDDVLLQRDMPLWPFRVEKDT 94


>UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole genome
           shotgun sequence; n=3; core eudicotyledons|Rep:
           Chromosome chr18 scaffold_24, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 667

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 45/111 (40%), Positives = 64/111 (57%), Gaps = 3/111 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTT S V   + G+  I+ N +G R TPS VA+T++G+ L+G  AK Q   NPE
Sbjct: 60  VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKNGDMLVGQIAKRQAVVNPE 119

Query: 458 NTVFDAKRLIGR---EWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATK 601
           NT F  KR IGR   E  ++   +      ++ L++ A+   K+   K TK
Sbjct: 120 NTFFSVKRFIGRKMDEVGEEAKQVSYKEISAQVLRKLADDASKFLNDKVTK 170


>UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:
           2-alkenal reductase - Anaeromyxobacter sp. Fw109-5
          Length = 623

 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 42/78 (53%), Positives = 50/78 (64%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLT 445
           D G V+GIDLGTT S V   ++G   +I    G  +TPS VA  ++G RL+G  AK Q  
Sbjct: 3   DHGPVVGIDLGTTNSVVATVQDGVPRVIPGRTGQPLTPSVVAVAKNGRRLVGALAKRQAI 62

Query: 446 TNPENTVFDAKRLIGREW 499
           TNPE TVF AKRLIGR W
Sbjct: 63  TNPEGTVFAAKRLIGRRW 80


>UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas sp.
           MWYL1|Rep: 2-alkenal reductase - Marinomonas sp. MWYL1
          Length = 552

 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 47/110 (42%), Positives = 73/110 (66%), Gaps = 5/110 (4%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTT+S VGV+K+G V++I + +GN + PS V  ++D   L+G AA+++L TNP+ 
Sbjct: 3   IGIDLGTTHSVVGVWKDGSVQLIPDMEGNILVPSAVGISEDNYILVGQAARDRLATNPDQ 62

Query: 461 TVFDAKRLIGRE---W-SDQLYNMM-LSSSPSRSLKRTANLMFKYKLHKA 595
           TV + KR +G +   W +DQ YN + LS+   +SLK  A    +  +++A
Sbjct: 63  TVTEFKRFMGTDKIFWLNDQEYNAIELSAILLKSLKEQAEQYLEEPVYEA 112


>UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 607

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 46/109 (42%), Positives = 68/109 (62%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTT+SCV  Y+NG+V I+ N+ G R TPS +A  +DG+ LIG  AK+ +     N
Sbjct: 3   IGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKD-VIGKATN 61

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYL 607
           ++FD KR+IGR + D L    +   P + +++  N +   ++HK  K L
Sbjct: 62  SLFDVKRIIGRRYDDVLLQRDMPLWPFK-VEKDDNGIPYLEIHKNEKPL 109


>UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n=2;
           Cystobacterineae|Rep: Heat shock protein 70 family
           protein - Myxococcus xanthus (strain DK 1622)
          Length = 535

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 40/78 (51%), Positives = 56/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGT++SCV V ++G+  +I N+ G     S V+F +DG  L+G+AAK  + TNPE 
Sbjct: 7   IGIDLGTSFSCVAVVQDGQPTVIPNEWGETTHASCVSFLEDGSVLVGNAAKKNIITNPEQ 66

Query: 461 TVFDAKRLIGREW-SDQL 511
           TV+ AKRLIGR + SD++
Sbjct: 67  TVYSAKRLIGRYYFSDEV 84


>UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031574 - Anopheles gambiae
           str. PEST
          Length = 503

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 39/71 (54%), Positives = 52/71 (73%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGID GT++S VG+Y+NG+ EIIAN+ GN   PS VAFT+ G RL+G+ A  Q  T+P N
Sbjct: 6   IGIDFGTSFSSVGIYRNGKFEIIANECGNHRIPSVVAFTEKG-RLVGEEALAQADTDPAN 64

Query: 461 TVFDAKRLIGR 493
            V + KR++GR
Sbjct: 65  CVIEVKRILGR 75


>UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 636

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 43/100 (43%), Positives = 61/100 (61%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGIDLGTTYS V ++++ +VEII N+ G + TP+ VAF  +G  LIG+ AK Q   NP+
Sbjct: 23  IIGIDLGTTYSSVCIFRDDKVEIIPNEYGFKSTPTVVAF--NGTFLIGEEAKEQGIINPQ 80

Query: 458 NTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFK 577
           NT +D KRL GR + D   N +    P   ++    +  K
Sbjct: 81  NTFYDIKRLTGRTYLDPNVNRVKKGLPFTIMQENDKICIK 120


>UniRef50_Q0VDF9 Cluster: Heat shock 70 kDa protein 14; n=25;
           Euteleostomi|Rep: Heat shock 70 kDa protein 14 - Homo
           sapiens (Human)
          Length = 509

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 39/109 (35%), Positives = 66/109 (60%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IG+ LG T +CV VYK+GR  ++AND G+R+TP+ VA++++ E ++G AAK     N  N
Sbjct: 4   IGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSEN-EEIVGLAAKQSRIRNISN 62

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYL 607
           TV   K+++GR  SD      ++ S    +++   L ++    + TK++
Sbjct: 63  TVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFV 111


>UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3;
           Planctomycetaceae|Rep: Chaperone protein dnaK -
           Rhodopirellula baltica
          Length = 645

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 36/76 (47%), Positives = 52/76 (68%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGIDLGTT S V + +    ++I N +GNR+TPS VAFT   E ++G+ A+ Q  TNP+
Sbjct: 7   IIGIDLGTTNSVVAIMEGSEPKVIPNPEGNRLTPSVVAFTDKQETIVGEPARRQAVTNPK 66

Query: 458 NTVFDAKRLIGREWSD 505
            TV+ AKR +GR  ++
Sbjct: 67  RTVYSAKRFMGRRHNE 82


>UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellular
           organisms|Rep: Chaperone protein dnaK3 - Synechocystis
           sp. (strain PCC 6803)
          Length = 771

 Score = 82.6 bits (195), Expect = 7e-15
 Identities = 36/79 (45%), Positives = 52/79 (65%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           +G V+GIDLGTT S V V + G+  +IAN +G R TPS V F ++GE ++G   + Q   
Sbjct: 1   MGKVVGIDLGTTNSVVAVMEGGKPIVIANAEGMRTTPSVVGFNKEGELVVGQMGRRQAVL 60

Query: 449 NPENTVFDAKRLIGREWSD 505
           NP+NT +  KR +GR ++D
Sbjct: 61  NPQNTFYGVKRFMGRRYTD 79


>UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular
           organisms|Rep: Chaperone protein dnaK - Chlamydophila
           caviae
          Length = 664

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 40/83 (48%), Positives = 53/83 (63%)
 Frame = +2

Query: 257 KDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKN 436
           + K    +IGIDLGTT SCV V + G+ ++I + +G R TPS VAF +  E L+G  AK 
Sbjct: 3   EQKKSSKIIGIDLGTTNSCVSVMEGGQAKVITSSEGTRTTPSIVAF-KGNETLVGIPAKR 61

Query: 437 QLTTNPENTVFDAKRLIGREWSD 505
           Q  TNPE T+   KR IGR+ S+
Sbjct: 62  QAVTNPEKTLASTKRFIGRKHSE 84


>UniRef50_UPI0000D56BFD Cluster: PREDICTED: similar to CG8937-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8937-PA, isoform A - Tribolium castaneum
          Length = 767

 Score = 79.8 bits (188), Expect = 5e-14
 Identities = 36/71 (50%), Positives = 50/71 (70%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTT SC+ V +NG++E+I N +GNR T SYV + +D   L+G  AK   + NP 
Sbjct: 5   VVGIDLGTTNSCIAVERNGKIEVIPNREGNRTTLSYVYYGED-SILVGKTAKYMASANPS 63

Query: 458 NTVFDAKRLIG 490
           N +++ KRLIG
Sbjct: 64  NGIYEIKRLIG 74


>UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 603

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 46/78 (58%), Positives = 54/78 (69%), Gaps = 2/78 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNG--RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           VIGIDLGTT+SC+ V+K    RVEII N QG   TPS VAFT D +RLIG+ A N   T 
Sbjct: 4   VIGIDLGTTFSCMAVWKESSKRVEIITNRQGKETTPSVVAFT-DKQRLIGEEAINCTGT- 61

Query: 452 PENTVFDAKRLIGREWSD 505
               VFD KRLIGR+++D
Sbjct: 62  ---IVFDVKRLIGRKYND 76


>UniRef50_UPI00015B551B Cluster: PREDICTED: similar to
           ENSANGP00000015293; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000015293 - Nasonia
           vitripennis
          Length = 822

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 42/91 (46%), Positives = 57/91 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +VIGID G     + V + G +E IAND   R TPS VAF+    R++G AAKNQL TN 
Sbjct: 5   SVIGIDFGNDNCYIAVARAGGIETIANDYSLRGTPSCVAFSGKN-RILGVAAKNQLVTNM 63

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSPSRS 547
           +NT++  KRL+GR+++D      L S P R+
Sbjct: 64  KNTIYGFKRLLGRKYNDPFAQKELQSLPYRT 94


>UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1;
           Acanthamoeba polyphaga mimivirus|Rep: Heat shock protein
           70 homolog - Mimivirus
          Length = 941

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 37/77 (48%), Positives = 52/77 (67%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGT +SCV +++N R EII +  GNR  PS V+F +   +L+G  A      NP+
Sbjct: 19  VIGIDLGTRFSCVSIWRNKRFEIIPDQFGNRTIPSVVSFYKSA-KLVGHNALCMKDANPK 77

Query: 458 NTVFDAKRLIGREWSDQ 508
           NT++D KR+IGR  +D+
Sbjct: 78  NTIYDIKRIIGRRMNDK 94


>UniRef50_Q9VUC1 Cluster: CG6603-PA, isoform A; n=7;
           Endopterygota|Rep: CG6603-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 804

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 44/91 (48%), Positives = 59/91 (64%), Gaps = 1/91 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE-RLIGDAAKNQLTTN 451
           +VIGID G     V   ++G +E +AND   R TPS+VAF  DG+ R+IG AAKNQ  TN
Sbjct: 2   SVIGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAF--DGKKRIIGVAAKNQQVTN 59

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
            +NTV   KRL+GR+++D      L+S P+R
Sbjct: 60  MKNTVGGFKRLLGRKFNDPHVQHELTSIPAR 90


>UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular
           organisms|Rep: Chaperone protein dnaK1 - Streptomyces
           avermitilis
          Length = 622

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 37/77 (48%), Positives = 48/77 (62%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTT S V V + G   +I N +G R TPS VAF ++GE L+G+ AK Q  TN + 
Sbjct: 5   VGIDLGTTNSVVSVLEGGEPTVITNAEGARTTPSVVAFAKNGEVLVGEVAKRQAVTNVDR 64

Query: 461 TVFDAKRLIGREWSDQL 511
           TV   KR +G +W   L
Sbjct: 65  TVRSVKRHMGTDWKINL 81


>UniRef50_Q1CY00 Cluster: DnaK family protein; n=2;
           Cystobacterineae|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 1146

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 34/84 (40%), Positives = 51/84 (60%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G VIGIDLGTT SCV +  NGR  ++ + +G    PS ++     + L+   AKNQL   
Sbjct: 603 GPVIGIDLGTTNSCVALLSNGRPLVLRSREGYNTIPSVISLNAQNKLLVSHRAKNQLVLR 662

Query: 452 PENTVFDAKRLIGREWSDQLYNMM 523
           P++T++ AKRL+GR +   + N +
Sbjct: 663 PQHTIYGAKRLVGRPYDSAVVNQV 686


>UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 759

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 38/87 (43%), Positives = 51/87 (58%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           ++GIDLGTT SC  V K+GR  +I + +G+   PS VA       ++G  AK QL TNP+
Sbjct: 193 IVGIDLGTTNSCAAVVKDGRPYVIPSREGHNTVPSIVALNARHRVVVGHLAKAQLLTNPK 252

Query: 458 NTVFDAKRLIGREWSDQLYNMMLSSSP 538
            TV  AKRLIGR W   +   + +  P
Sbjct: 253 ATVSGAKRLIGRAWDTPVVQEIRAKFP 279


>UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus
           weihenstephanensis KBAB4|Rep: Heat shock protein Hsp70 -
           Bacillus weihenstephanensis KBAB4
          Length = 578

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 37/75 (49%), Positives = 50/75 (66%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           ++GIDLGTT S +   KNG+ EII N +GNR TPS V     GE +IG+ AK+ + + P+
Sbjct: 3   IVGIDLGTTNSAIAYLKNGKPEIIENKKGNRTTPSVVQKDLKGEIIIGEDAKSGIKSLPD 62

Query: 458 NTVFDAKRLIGREWS 502
            TV + KRL+G E S
Sbjct: 63  RTVLEVKRLMGTEES 77


>UniRef50_A2VD43 Cluster: Heat shock protein 14; n=3;
           Clupeocephala|Rep: Heat shock protein 14 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 504

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 33/75 (44%), Positives = 52/75 (69%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IG+  G T +CV V+K+GR +++AND G+R+TP+ VA+ +D E+++G AAK     N  N
Sbjct: 4   IGVHFGYTCACVAVFKDGRADVVANDAGDRVTPAVVAY-RDTEQIVGIAAKQGRIRNAAN 62

Query: 461 TVFDAKRLIGREWSD 505
           TV   K+++GR + D
Sbjct: 63  TVVKVKQILGRRYDD 77


>UniRef50_A7RF55 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 391

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 37/77 (48%), Positives = 51/77 (66%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IG+ LG T SCV V  +G   IIAND G+R+TP+ VAF+ D E+ +G  AK  L  N  N
Sbjct: 7   IGVHLGATTSCVAVSADGNTTIIANDAGDRVTPAMVAFS-DTEKNVGLPAKQGLIRNARN 65

Query: 461 TVFDAKRLIGREWSDQL 511
           T+  AKR++G+ +SD +
Sbjct: 66  TILRAKRVLGKSYSDSV 82


>UniRef50_A5AUN6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 153

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 48/92 (52%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +2

Query: 338 VEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLIGRE-WS---D 505
           V+ IANDQGNR  PSYV FT   ERLIGDAAKNQ+  NP N VFDAKRL   + WS    
Sbjct: 5   VDFIANDQGNRTMPSYVDFTNT-ERLIGDAAKNQVAMNPVNIVFDAKRLTNPQLWSLTKK 63

Query: 506 QLYNMMLSSSPSRSLKRTANLMFKYKLHKATK 601
           +  N+ L      S +R   L+ K  L +ATK
Sbjct: 64  KRKNLPLKRFHLWSSQRCVRLL-KSTLRQATK 94


>UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2;
           Pansporablastina|Rep: Mitochondrial-like Hsp70 -
           Trachipleistophora hominis
          Length = 543

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 32/76 (42%), Positives = 53/76 (69%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           ++GIDLGTT SC+ + ++    II N +G R TPS +  + +   ++G  A+ +L T+PE
Sbjct: 6   IVGIDLGTTNSCISIMQDNVATIIENQEGQRTTPSVINISGENV-IVGKPAQRKLLTDPE 64

Query: 458 NTVFDAKRLIGREWSD 505
           +T+F+ KRLIGR+++D
Sbjct: 65  HTIFNVKRLIGRKYAD 80


>UniRef50_A6NJU0 Cluster: Uncharacterized protein HSPA14; n=2;
           Eutheria|Rep: Uncharacterized protein HSPA14 - Homo
           sapiens (Human)
          Length = 143

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 33/71 (46%), Positives = 50/71 (70%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IG+ LG T +CV VYK+GR  ++AND G+R+TP+ VA++++ E ++G AAK     N  N
Sbjct: 4   IGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSEN-EEIVGLAAKQSRIRNISN 62

Query: 461 TVFDAKRLIGR 493
           TV   K+++GR
Sbjct: 63  TVMKVKQILGR 73


>UniRef50_O88687 Cluster: Heat shock protein 70; n=2;
           Euteleostomi|Rep: Heat shock protein 70 - Mus musculus
           (Mouse)
          Length = 43

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 33/39 (84%), Positives = 36/39 (92%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVA 391
           T IGIDLGTTYSCVGV ++G+VEIIANDQGNR TPSYVA
Sbjct: 5   TAIGIDLGTTYSCVGVLQHGKVEIIANDQGNRTTPSYVA 43


>UniRef50_Q20752 Cluster: Putative uncharacterized protein stc-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein stc-1 - Caenorhabditis elegans
          Length = 450

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 36/76 (47%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYK--NGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           + GIDLGTTYS +G+Y    G   I+ +D G +  PS VAF  +G  LIG  A  Q   N
Sbjct: 35  IAGIDLGTTYSSIGIYHAVTGETIILPDDLGKKSVPSVVAFLPNGTVLIGTRATEQQEHN 94

Query: 452 PENTVFDAKRLIGREW 499
           P+ T++DAKR IGR +
Sbjct: 95  PKRTIYDAKRFIGRNF 110


>UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4;
           Planctomycetaceae|Rep: Chaperone protein HscC -
           Rhodopirellula baltica
          Length = 587

 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 33/72 (45%), Positives = 49/72 (68%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTT+S V V+++G+ E+I+N  G ++TPS V   QDG+ ++G AA+    T PE 
Sbjct: 18  IGIDLGTTHSLVSVFRDGKPELISNAHGEKLTPSIVGVLQDGQIVVGSAARELRVTAPER 77

Query: 461 TVFDAKRLIGRE 496
             +  KR +G+E
Sbjct: 78  CAWVFKRYMGQE 89


>UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 509

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGV-YKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +IGIDLGTT SC  V Y +G+V++I    G+   PS  A    G  LIG  AK Q   NP
Sbjct: 9   IIGIDLGTTNSCGAVAYGDGQVKLIPYKGGDYTIPSIFAIDDKGNELIGHEAKRQWQLNP 68

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSS 532
            NT++  KRLIGR   D++ + M  S
Sbjct: 69  RNTLYATKRLIGRAPRDEVVDSMQRS 94


>UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus
           metalliredigens QYMF|Rep: 2-alkenal reductase -
           Alkaliphilus metalliredigens QYMF
          Length = 569

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 32/71 (45%), Positives = 49/71 (69%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGIDLGT+ S VG+++ G+  +I N    +ITPS V   ++G+ +IG  AK+Q+   PE
Sbjct: 4   IIGIDLGTSTSEVGIFETGKPIVIGNHLNEKITPSVVGLGEEGQLIIGRDAKDQMLFKPE 63

Query: 458 NTVFDAKRLIG 490
           +TV + KRL+G
Sbjct: 64  DTVMEVKRLMG 74


>UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38;
           Bacteria|Rep: Chaperone protein dnaK - Ureaplasma parvum
           (Ureaplasma urealyticum biotype 1)
          Length = 603

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 36/71 (50%), Positives = 48/71 (67%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           ++GIDLGTT SCV V +N +  ++ N +G R  PS V+F  D E L+GDAAK +  TNP 
Sbjct: 6   ILGIDLGTTNSCVAVIENKKPIVLENPEGKRTVPSVVSFNGD-EVLVGDAAKRKQITNP- 63

Query: 458 NTVFDAKRLIG 490
           NT+   KRL+G
Sbjct: 64  NTISSIKRLMG 74


>UniRef50_Q4SW20 Cluster: Chromosome undetermined SCAF13693, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF13693,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 857

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 36/74 (48%), Positives = 49/74 (66%), Gaps = 2/74 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYK--NGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           VIG+DLGTT+  VGV+   +G VE++A+ +G R  PS V+FT     L+G  A  Q   N
Sbjct: 31  VIGLDLGTTFCSVGVFYPGSGEVEVLADAEGRRSIPSCVSFTAAAV-LVGHEAAEQADRN 89

Query: 452 PENTVFDAKRLIGR 493
           P NT++DAKR IG+
Sbjct: 90  PRNTIYDAKRFIGK 103


>UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella
           natans|Rep: Chaperone DnaK - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 653

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 32/86 (37%), Positives = 47/86 (54%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTT S +     G+  I+ N  G R+TPS +   +    ++GD AK Q   NP+N
Sbjct: 67  VGIDLGTTNSAIATMVAGQPSILPNSSGARLTPSVIGIDKQNNFVVGDIAKRQAVVNPQN 126

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSP 538
           T +  K LIGR++     N+   + P
Sbjct: 127 TYYSVKSLIGRKYQTTAPNLSSLAYP 152


>UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 708

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 31/79 (39%), Positives = 52/79 (65%), Gaps = 1/79 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGR-VEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +GIDLGTTY C+  +   + ++    D  +   PS+V+F  + ER++G  A  Q+ TNP 
Sbjct: 6   LGIDLGTTYCCIFAFDEKKNIKFSIRDGDSEQIPSFVSFANE-ERIVGRKAMAQMITNPT 64

Query: 458 NTVFDAKRLIGREWSDQLY 514
           NT++D+KR+IGR + +Q++
Sbjct: 65  NTIYDSKRMIGRNFDNQIF 83


>UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular
           organisms|Rep: Heat shock protein 70 - Rhodoferax
           ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118)
          Length = 633

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 45/116 (38%), Positives = 64/116 (55%), Gaps = 9/116 (7%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQG----NRITPSYVAFTQDGERLIGDAAKNQL 442
           T+IGIDLGT+ S   V + GR  II + +G     +  PSYVA T DG+ L+G+ A+ Q 
Sbjct: 2   TIIGIDLGTSNSAAAVLRGGRPVIIPSAEGLSIGGKAFPSYVALTADGQMLVGEPARRQA 61

Query: 443 TTNPENTVFDAKRLIGREWSDQL----YN-MMLSSSPSRSLKRTANLMFKYKLHKA 595
           T NPE TV   KR +G+  +  L    Y+   LS+   + +KR A       +H+A
Sbjct: 62  TANPEGTVTAFKRRMGKRETIVLRARDYSPEQLSAFLLQKIKRDAEAFLGEPVHQA 117


>UniRef50_A4QNX8 Cluster: Zgc:162281 protein; n=6; Eumetazoa|Rep:
           Zgc:162281 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 438

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 34/79 (43%), Positives = 51/79 (64%), Gaps = 2/79 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYK--NGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           VIG+DLGTT+  VGV++   G +EII +D+G +  PS V+FT  G    G   +     N
Sbjct: 33  VIGLDLGTTFCSVGVFQPGTGEIEIIEDDKGRKSIPSVVSFTLTGV-FAGHEGQELSDVN 91

Query: 452 PENTVFDAKRLIGREWSDQ 508
           P+NT++DAKR IG+ + ++
Sbjct: 92  PQNTIYDAKRFIGKIFDEE 110


>UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2;
           Anaeromyxobacter dehalogenans 2CP-C|Rep: Conserved
           region 2266 - Anaeromyxobacter dehalogenans (strain
           2CP-C)
          Length = 782

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 34/72 (47%), Positives = 45/72 (62%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGT+ SC  V ++GR  +I + +G    PS VA       ++G  A+ QL TNP 
Sbjct: 228 VIGIDLGTSNSCAAVVRDGRPYVIPSREGYNTVPSIVALNARNRIVVGHLARAQLLTNPR 287

Query: 458 NTVFDAKRLIGR 493
            TV+ AKRL+GR
Sbjct: 288 ATVWGAKRLVGR 299


>UniRef50_P48723 Cluster: Stress 70 protein chaperone
           microsome-associated 60 kDa protein precursor; n=19;
           Tetrapoda|Rep: Stress 70 protein chaperone
           microsome-associated 60 kDa protein precursor - Homo
           sapiens (Human)
          Length = 471

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 37/101 (36%), Positives = 60/101 (59%), Gaps = 2/101 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           VIGIDLGTTY  VGV+    G+V++I ++ G+   PS V+FT D +  +G  +     +N
Sbjct: 33  VIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFT-DNDVYVGYESVELADSN 91

Query: 452 PENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMF 574
           P+NT++DAKR IG+ ++ +     +   P + L +   + F
Sbjct: 92  PQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEF 132


>UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular
           organisms|Rep: Chaperone protein dnaK - Lactobacillus
           johnsonii
          Length = 624

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 38/73 (52%), Positives = 47/73 (64%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGTT S V V +    +II N +GNR TPS VAF ++GE  +G+ AK Q  TNP 
Sbjct: 4   VIGIDLGTTNSAVAVLEGKEPKIITNPEGNRTTPSVVAF-KNGEIQVGEVAKRQAITNP- 61

Query: 458 NTVFDAKRLIGRE 496
           NT+   K  +G E
Sbjct: 62  NTIVSIKSHMGEE 74


>UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella
           natans|Rep: Chaperone HSP70 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 610

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 31/73 (42%), Positives = 52/73 (71%)
 Frame = +2

Query: 335 RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDQLY 514
           +V+II+N+ GNR T S VAFT D ++L+GDAAKNQ   +P   V+D+KR++G++++D+  
Sbjct: 6   KVQIISNEAGNRTTASVVAFTDD-DKLVGDAAKNQAIFHPSQVVYDSKRMLGKKYNDETI 64

Query: 515 NMMLSSSPSRSLK 553
              + + P + L+
Sbjct: 65  QDDMKTWPFKVLQ 77


>UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n=2;
            Eukaryota|Rep: NAD-specific glutamate dehydrogenase -
            Achlya klebsiana
          Length = 1063

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 38/75 (50%), Positives = 49/75 (65%)
 Frame = -3

Query: 505  VTPFTTNQTLGIKDSVFRVGSKLVFGSITN*TFTILSEGHV*RCDAVSLVIGNDFYTSIF 326
            V  FTT+QTL I+ SV RV   LV   ITN TF + SE +V     V+L++GN+F T + 
Sbjct: 962  VVEFTTDQTLSIEHSVGRVHGNLVLSGITNKTFAV-SESNVRWGGTVTLIVGNNFNTIVL 1020

Query: 325  VDTDT*VSGTQIDTD 281
             DTDT +S T+IDTD
Sbjct: 1021 PDTDTRISRTEIDTD 1035


>UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter sp.
           BAL39|Rep: Heat shock protein 70 - Pedobacter sp. BAL39
          Length = 617

 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 33/77 (42%), Positives = 46/77 (59%), Gaps = 1/77 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRI-TPSYVAFTQDGERLIGDAAKNQLTTNP 454
           ++GIDLGTT S V      ++  + ND G  +  PS V F   G+ L+G+ AK  L T+P
Sbjct: 19  IVGIDLGTTNSLVAFINPDKLPQVINDTGKGLLVPSVVHFNAHGDTLVGNEAKEFLITDP 78

Query: 455 ENTVFDAKRLIGREWSD 505
            NT+F  KRL+GR + D
Sbjct: 79  ANTIFSVKRLLGRSYKD 95


>UniRef50_A2ECF5 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 730

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGR-VEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +GIDLGTTY C+  Y   + V     DQ +    SYV++ +D + + G  A+NQ+  NPE
Sbjct: 6   LGIDLGTTYCCIYYYDEKKHVAEAIKDQDSSQIASYVSYNKD-DVVYGSVAQNQVMNNPE 64

Query: 458 NTVFDAKRLIGREWSD 505
           NTV+D+KR+IG+++S+
Sbjct: 65  NTVYDSKRMIGKKFSN 80


>UniRef50_UPI0000E474BD Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 488

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/72 (41%), Positives = 47/72 (65%)
 Frame = +2

Query: 323 YKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWS 502
           + +G+ E++AND G+R TP+ VAFT D E+++G +AK     NP NTV   K ++GR++ 
Sbjct: 15  FSDGKTEVVANDAGDRTTPTAVAFT-DNEKIVGLSAKQGRMRNPVNTVMQVKHIVGRKFE 73

Query: 503 DQLYNMMLSSSP 538
           DQ+   +   SP
Sbjct: 74  DQVIQDLKRQSP 85


>UniRef50_Q6F9S6 Cluster: Chaperone protein; n=2; Acinetobacter|Rep:
           Chaperone protein - Acinetobacter sp. (strain ADP1)
          Length = 566

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 43/115 (37%), Positives = 70/115 (60%), Gaps = 5/115 (4%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLT 445
           +I  +IGIDLGT+ S VGV++NG+  +I N  GN++TPS +A  +D + LIG AA  +L 
Sbjct: 3   EIKPLIGIDLGTSNSLVGVFENGQPRLIENAYGNKLTPSAIAMDEDEQILIGQAAL-ELR 61

Query: 446 TNPENTVFDAKRLIGR----EWSDQLYNMM-LSSSPSRSLKRTANLMFKYKLHKA 595
            +  + +   KRL+G     +  D+ ++ + LSS   RSLK+ A    + ++ +A
Sbjct: 62  ASGRDVLTSFKRLMGTSKPLKLGDRSFSAVELSSLILRSLKQDAEHALQCEIDEA 116


>UniRef50_Q010Y3 Cluster: DNAK_GLOVI Chaperone protein dnaK; n=1;
           Ostreococcus tauri|Rep: DNAK_GLOVI Chaperone protein
           dnaK - Ostreococcus tauri
          Length = 412

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 33/74 (44%), Positives = 46/74 (62%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           + GIDLGTT S V + ++G+ EI+A  QG+R  PS V F  DG   +G  A+    T+  
Sbjct: 46  ICGIDLGTTNSAVAIVRDGKAEIVAC-QGHRTIPSVVCFASDGSFSVGREARRMQRTDAR 104

Query: 458 NTVFDAKRLIGREW 499
           NTV  AKR IG+++
Sbjct: 105 NTVHSAKRFIGKKY 118


>UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to heat shock protein - Nasonia vitripennis
          Length = 523

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 39/89 (43%), Positives = 56/89 (62%), Gaps = 12/89 (13%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVY------------KNGRVEIIANDQGNRITPSYVAFTQDGERLIGD 424
           IGIDLGTT + +  +             +G V IIAN +G+R TPS VAF +  ERLIG 
Sbjct: 7   IGIDLGTTNTVIAAWIPETNKDLNSTKSSGTVNIIANSKGHRTTPSCVAFNEK-ERLIGT 65

Query: 425 AAKNQLTTNPENTVFDAKRLIGREWSDQL 511
           +A +Q   N +NT++ +KRLIGRE+ +++
Sbjct: 66  SALSQGQRNSKNTIYSSKRLIGREFDNEV 94



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 13/42 (30%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           V+ + + +PF VV+K  +P  +V      K ++P++I++M+L
Sbjct: 94  VKAESEHWPFAVVDKEGRPFYEVNHKSEIKYYSPQDIASMIL 135


>UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 70;
           n=11; Entamoeba histolytica|Rep: Mitochondrial-type heat
           shock protein 70 - Entamoeba histolytica
          Length = 598

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 35/77 (45%), Positives = 47/77 (61%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           T IGIDLGTT SC+ V+      I+ N +G R TPS V+FT  G  L+G+AAK     +P
Sbjct: 10  TCIGIDLGTTNSCMCVFDKTTPRILENAEGKRTTPSCVSFTPTG-ILVGEAAKRMEALHP 68

Query: 455 ENTVFDAKRLIGREWSD 505
             TV   KR+IG ++ +
Sbjct: 69  TTTVSGVKRMIGCQYKN 85


>UniRef50_Q05036 Cluster: Uncharacterized protein C30C11.4; n=2;
           Caenorhabditis|Rep: Uncharacterized protein C30C11.4 -
           Caenorhabditis elegans
          Length = 776

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 34/93 (36%), Positives = 55/93 (59%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G D+G     +GV + G +E+I ND     TP+ V+F    +R +G AA+  +TTN 
Sbjct: 2   SVLGFDIGNLNCYIGVARQGGIEVITNDYSLHATPACVSFGPK-DRSMGVAARQAVTTNI 60

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLK 553
           +NTV + K LIGR++SD +    +   P + +K
Sbjct: 61  KNTVINFKHLIGRKFSDPVAQRFIPFIPCKVVK 93


>UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial
           precursor; n=18; Ascomycota|Rep: Heat shock protein
           SSQ1, mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 657

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 45/108 (41%), Positives = 60/108 (55%), Gaps = 12/108 (11%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGR----VEIIANDQGNRITPSYVAFT-----QDGER---LIG 421
           VIGIDLGTT S V   ++        II ND+G R TPS VAF      Q+ ++   L+G
Sbjct: 30  VIGIDLGTTNSAVAYIRDSNDKKSATIIENDEGQRTTPSIVAFDVKSSPQNKDQMKTLVG 89

Query: 422 DAAKNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTAN 565
            AAK Q   N ENT F  KRLIGR ++D+     ++  P + +K  +N
Sbjct: 90  MAAKRQNAINSENTFFATKRLIGRAFNDKEVQRDMAVMPYKIVKCESN 137


>UniRef50_Q1CWT5 Cluster: DnaK family protein; n=2;
           Cystobacterineae|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 608

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 32/78 (41%), Positives = 50/78 (64%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGTT S V   ++GR  +I    G R+TPS +   + GER++G AA++    +P+
Sbjct: 5   VIGIDLGTTNSAVATVEDGRPRMIPPRAGGRLTPSTLGVNKAGERVVGVAAQSLGEEHPD 64

Query: 458 NTVFDAKRLIGREWSDQL 511
           + V+  KR +GR ++ +L
Sbjct: 65  SVVWATKRFLGRRYTPEL 82


>UniRef50_Q96269 Cluster: Heat-shock protein; n=14;
           Magnoliophyta|Rep: Heat-shock protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 831

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 34/88 (38%), Positives = 48/88 (54%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +VIG D G     V V +   ++++ ND+ NR TP+ V F  D ER IG A       NP
Sbjct: 2   SVIGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFG-DNERFIGTAGAASTMMNP 60

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSP 538
           +N++   KRLIGR++SD      + S P
Sbjct: 61  KNSISQIKRLIGRQFSDPELQRDIKSFP 88


>UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           Molecular chaperone DnaK - Syntrophomonas wolfei subsp.
           wolfei (strain Goettingen)
          Length = 498

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 30/79 (37%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           ++GIDLGTT S V  + + G+ EII N++G R+TPS + F  + E L+G+ A+NQ     
Sbjct: 2   IVGIDLGTTNSLVAFINREGKAEIIINERGGRLTPSVIYFKNEQEVLVGEVARNQALLKA 61

Query: 455 ENTVFDAKRLIGREWSDQL 511
             T+   KR +G ++  ++
Sbjct: 62  GQTISSIKRHMGSDFQAEI 80


>UniRef50_Q5C1F3 Cluster: SJCHGC04997 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC04997 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 252

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 35/78 (44%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGER-LIGDAAKNQLTTN 451
           +V+G D+GT  S +GV + G +E+I N+   R TP+ VAF+  GE  L+G AAK Q   N
Sbjct: 3   SVVGFDIGTLTSYIGVARGGGIEVITNEYSERATPTCVAFS--GELVLVGTAAKLQQVMN 60

Query: 452 PENTVFDAKRLIGREWSD 505
             NT  D  RL+G+  SD
Sbjct: 61  TRNTFTDFTRLLGKRLSD 78


>UniRef50_O15797 Cluster: CG4; n=10; Plasmodium|Rep: CG4 -
           Plasmodium falciparum
          Length = 855

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 32/77 (41%), Positives = 49/77 (63%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GID+G   S V     G + ++ ND   R+TP+ V FT+  ERLIGD+A ++L +N 
Sbjct: 2   SVLGIDIGNDNSVVATINKGAINVVRNDISERLTPTLVGFTEK-ERLIGDSALSKLKSNY 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NT  + K LIG+  +D
Sbjct: 61  KNTCRNIKNLIGKIGTD 77


>UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonospora
           locustae|Rep: Mitochondrial-type HSP70 - Antonospora
           locustae (Nosema locustae)
          Length = 622

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 43/124 (34%), Positives = 63/124 (50%)
 Frame = +2

Query: 179 LHGQDAVEFVRASFGGRGRLCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIAND 358
           ++G  A   +R      G   +   E +K   T+IGIDLGTT SCV V K+   +II N 
Sbjct: 9   IYGSRAARLIRPFRKKFGHHKKMGAEVEKS--TIIGIDLGTTNSCVSVIKDRYPKIIRNR 66

Query: 359 QGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSP 538
            G R TPS V F   G++++       +  +P  TVF  KRLIGR++ D      +   P
Sbjct: 67  TGKRTTPSTVTF---GDKIV--VGSELVDGDPGATVFGTKRLIGRKFEDPEIQKYIQKLP 121

Query: 539 SRSL 550
            +++
Sbjct: 122 YKTV 125


>UniRef50_UPI0000499AA8 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 757

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 34/91 (37%), Positives = 52/91 (57%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GID+G     V V +   ++I+ N+  NR TP++V+F  D ER IG+A  +    N +N
Sbjct: 5   VGIDIGNRNITVAVVRKKGIDIVVNEVSNRQTPTFVSFN-DKERAIGEAGFSLYLRNVKN 63

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLK 553
           TV D KRLIGR++        L   P +++K
Sbjct: 64  TVVDVKRLIGRQYDCPDVQTELKELPYQTVK 94


>UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia
           burgdorferi group|Rep: Heat shock protein 70 - Borrelia
           burgdorferi (Lyme disease spirochete)
          Length = 491

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 35/70 (50%), Positives = 48/70 (68%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTT + V  Y +   +II N++G RITPS V+F+ D + L+G AAKNQ+  NP+ 
Sbjct: 7   IGIDLGTT-NTVASYFDVSSKIILNERGERITPSIVSFS-DKDVLVGSAAKNQILVNPQK 64

Query: 461 TVFDAKRLIG 490
           T ++ K  IG
Sbjct: 65  TFYNFKTNIG 74


>UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 586

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/74 (40%), Positives = 48/74 (64%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           T++GIDLGTT S + + +NG+ ++I  D  + I PS V     G+ ++G  AKNQ  ++P
Sbjct: 3   TIVGIDLGTTNSEISILENGKPKVIPVDD-DLIMPSCVGIDITGKLIVGKTAKNQAVSSP 61

Query: 455 ENTVFDAKRLIGRE 496
           E+T+F  KR +G +
Sbjct: 62  ESTIFSIKRKMGED 75


>UniRef50_A3BBU4 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 340

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/35 (85%), Positives = 32/35 (91%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITP 379
           TVIGI+LGTTYS VGVY+NG VEIIANDQGN ITP
Sbjct: 42  TVIGINLGTTYSWVGVYRNGIVEIIANDQGNHITP 76


>UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacifica
           SIR-1|Rep: Chaperone DnaK - Plesiocystis pacifica SIR-1
          Length = 539

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 32/75 (42%), Positives = 46/75 (61%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTT S   V ++GR  ++     +RI PS VA   +G+  +G+ AK   + +P 
Sbjct: 7   VLGIDLGTTNSACAVVRDGRASVVRRGD-DRIVPSVVAALSNGQFAVGNEAKQLRSVDPT 65

Query: 458 NTVFDAKRLIGREWS 502
             V+ AKRLIGR +S
Sbjct: 66  QVVYSAKRLIGRRFS 80


>UniRef50_Q2H062 Cluster: Putative uncharacterized protein; n=2;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Chaetomium globosum (Soil fungus)
          Length = 763

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 33/77 (42%), Positives = 47/77 (61%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G+D G+  + V V +N  V++I N+  NR TPS V F     R +G++AK Q  +N 
Sbjct: 2   SVVGVDFGSLNTVVAVARNRGVDVITNEVSNRATPSLVGFGPK-SRYLGESAKTQEISNL 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KRLIGR   D
Sbjct: 61  KNTVGSLKRLIGRSLKD 77


>UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena
           thermophila SB210|Rep: dnaK protein - Tetrahymena
           thermophila SB210
          Length = 1213

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 31/76 (40%), Positives = 47/76 (61%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGID G TYS V + + G++ II N+ GN  TPS V+F +D +  +G+ A +Q   NP 
Sbjct: 27  IIGIDFGNTYSSVAIVQEGQLIIIPNEYGNTETPSVVSFAED-KIFVGEQAIHQYQNNPS 85

Query: 458 NTVFDAKRLIGREWSD 505
            +V   K+LI ++  D
Sbjct: 86  RSVQKIKKLIAQDQKD 101


>UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodospira
           halophila SL1|Rep: Heat shock protein 70 -
           Halorhodospira halophila (strain DSM 244 / SL1)
           (Ectothiorhodospirahalophila (strain DSM 244 / SL1))
          Length = 577

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 33/73 (45%), Positives = 47/73 (64%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGIDLGTT S V V +NG+V++I  +    + PS V   ++G  L+G AA+NQL  +PE
Sbjct: 5   IIGIDLGTTNSEVAVVRNGQVQLIEVEDAY-LMPSAVGLDEEGGLLVGYAARNQLALHPE 63

Query: 458 NTVFDAKRLIGRE 496
            TV   KR +G +
Sbjct: 64  RTVRSIKRRMGED 76


>UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG31366-PA - Tribolium castaneum
          Length = 614

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 29/76 (38%), Positives = 44/76 (57%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGIDLGTT S    Y   +V ++ N +G+RITPS V F      ++G  A+     + +
Sbjct: 5   IIGIDLGTTNSSAAYYFKEKVRVVENKEGDRITPSCVYFRDQNTVIVGKYARKMAEQSNQ 64

Query: 458 NTVFDAKRLIGREWSD 505
           + VF  KR IG+++ D
Sbjct: 65  SEVFGIKRFIGKQFDD 80



 Score = 33.5 bits (73), Expect = 4.4
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +++D++  PF +    +KP V +    G     PEE+SA+VL
Sbjct: 81  PDLRNDLRHVPFTIESIENKPIVTINHKSGVCKKTPEEVSALVL 124


>UniRef50_Q00YD5 Cluster: Heat shock protein 91-Arabidopsis
           thaliana; n=1; Ostreococcus tauri|Rep: Heat shock
           protein 91-Arabidopsis thaliana - Ostreococcus tauri
          Length = 779

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 29/77 (37%), Positives = 46/77 (59%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GID G   + V + +   ++++ ND+  R TPS V F +  +R IG AA +++   P
Sbjct: 30  SVVGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEK-QRFIGSAAADKINMKP 88

Query: 455 ENTVFDAKRLIGREWSD 505
            NTV   KRL+GR + D
Sbjct: 89  RNTVTQVKRLVGRAFDD 105


>UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27;
           Proteobacteria|Rep: Chaperone protein hscA homolog -
           Burkholderia mallei (Pseudomonas mallei)
          Length = 622

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 30/71 (42%), Positives = 40/71 (56%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTT S V   +N   E + +D G  + PS V +   G R IG AAK +   +P N
Sbjct: 22  VGIDLGTTNSLVAAVRNSIPEALPDDAGRVLLPSVVRYLDKGGRRIGHAAKEEAAIDPRN 81

Query: 461 TVFDAKRLIGR 493
           T+   KR +GR
Sbjct: 82  TIVSVKRFMGR 92


>UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26;
           Bacteria|Rep: Chaperone protein hscC - Bacillus
           anthracis
          Length = 566

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 35/85 (41%), Positives = 46/85 (54%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGIDLGTT S V  +      +I N  G  +TPS V+  + GE L+G  AK +L T+P+
Sbjct: 3   IIGIDLGTTNSLVATWSEDGATLIPNVLGEFLTPSVVSVDETGEILVGRIAKERLITHPQ 62

Query: 458 NTVFDAKRLIGREWSDQLYNMMLSS 532
            T    KR IG E   +L     SS
Sbjct: 63  LTAATFKRFIGTEKKYELGTYTFSS 87


>UniRef50_P77319 Cluster: Chaperone protein hscC; n=19;
           Gammaproteobacteria|Rep: Chaperone protein hscC -
           Escherichia coli (strain K12)
          Length = 556

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 38/99 (38%), Positives = 55/99 (55%), Gaps = 5/99 (5%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTT S + V+K+G  ++I N  G  +TPS ++  ++   L+G  A ++ T++P+ 
Sbjct: 8   IGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISMDENNHILVGKPAVSRRTSHPDK 67

Query: 461 TVFDAKRLIG--REW---SDQLYNMMLSSSPSRSLKRTA 562
           T    KR +G    W   SD      LSS   RSLK  A
Sbjct: 68  TAALFKRAMGSNTNWRLGSDTFNAPELSSLVLRSLKEDA 106


>UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=1;
           Yersinia mollaretii ATCC 43969|Rep: COG0443: Molecular
           chaperone - Yersinia mollaretii ATCC 43969
          Length = 571

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 28/78 (35%), Positives = 51/78 (65%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGIDLGT+ S V ++++G+  ++ N +G+ +TPS V     G+ ++G AAK +L ++P+
Sbjct: 12  LIGIDLGTSNSAVSLWQDGQAILLPNAEGDHLTPSVVGVDDHGQFIVGQAAKLRLQSHPQ 71

Query: 458 NTVFDAKRLIGREWSDQL 511
            T    KR +G +++  L
Sbjct: 72  LTAASFKRQMGADYTFHL 89


>UniRef50_Q4RM18 Cluster: Chromosome 10 SCAF15019, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10
           SCAF15019, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 892

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 36/97 (37%), Positives = 55/97 (56%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GID+G     + V ++G +E IAN+  +R TP+ V+      R+IG+AAK+Q+ TN 
Sbjct: 2   SVVGIDVGFQSCYIAVARSGGIETIANEYSDRCTPACVSLATK-NRIIGNAAKSQIITNF 60

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTAN 565
           +NTV   K+  GR + D          P  SL + AN
Sbjct: 61  KNTVHGFKKFHGRTFDDPFVQAEKPKLP-YSLHKMAN 96


>UniRef50_Q54GD7 Cluster: Heat shock protein Hsp70 family protein;
           n=2; Dictyostelium discoideum|Rep: Heat shock protein
           Hsp70 family protein - Dictyostelium discoideum AX4
          Length = 772

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 30/74 (40%), Positives = 46/74 (62%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+G D GT    + V + G V++IAN+  NR+TPS V+F +  ER +G++A      N  
Sbjct: 4   VVGFDFGTKNCTIAVAQKGGVDVIANEVSNRLTPSMVSFGEK-ERYLGESALTNQLRNIR 62

Query: 458 NTVFDAKRLIGREW 499
           NT+ + KR IG+E+
Sbjct: 63  NTITNIKRFIGQEF 76


>UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 707

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 33/80 (41%), Positives = 50/80 (62%), Gaps = 2/80 (2%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEI-IANDQGNRITPSYVAFTQDGERLI-GDAAKNQLT 445
           G  +GIDLGTT+S V VYK  +    +    G+   PS +AF   G+ L+ G  AK+ + 
Sbjct: 4   GPFVGIDLGTTFSTVAVYKPAQKSFDVLKIDGDTQVPSVIAF---GDELVYGQRAKSLMA 60

Query: 446 TNPENTVFDAKRLIGREWSD 505
             P+NTV+D+KR+IG+ +S+
Sbjct: 61  NIPQNTVYDSKRMIGKMYSE 80


>UniRef50_Q06068 Cluster: 97 kDa heat shock protein; n=3;
           Strongylocentrotus|Rep: 97 kDa heat shock protein -
           Strongylocentrotus purpuratus (Purple sea urchin)
          Length = 889

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 31/77 (40%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G D+G   S + V + G +E +AN+  +R+TPS V+F +   R  G AA++Q  TN 
Sbjct: 2   SVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEK-SRTQGHAARSQAITNY 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NT+   KR I R +SD
Sbjct: 61  KNTLSQFKRFIARRFSD 77



 Score = 36.3 bits (80), Expect = 0.62
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P+VQ D K  P+K+ +  N    +QVQ     + F PE+I AM+L
Sbjct: 78  PSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAMIL 122


>UniRef50_O59838 Cluster: Heat shock protein homolog pss1; n=21;
           Fungi|Rep: Heat shock protein homolog pss1 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 720

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GID G + + + V +N  +++I N+  NR TPS V++  +  R +G+AAK+   +N  
Sbjct: 7   VVGIDFGNSKTVIAVARNRAIDVIVNEVSNRSTPSLVSY-GERSRFLGEAAKSAEASNFR 65

Query: 458 NTVFDAKRLIGREWSD 505
           NTV   KRL GR + D
Sbjct: 66  NTVGSLKRLAGRTYDD 81


>UniRef50_Q22CW2 Cluster: Heat shock protein 70 homolog; n=1;
           Tetrahymena thermophila SB210|Rep: Heat shock protein 70
           homolog - Tetrahymena thermophila SB210
          Length = 146

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLT 445
           ++IGIDLGTT SCV + +    +II N +G R TPS VA   DG RL+G  AK Q++
Sbjct: 25  SIIGIDLGTTNSCVAIMEGSAPKIIENAEGFRTTPSVVAILPDGSRLVGAPAKRQVS 81


>UniRef50_O14992 Cluster: HS24/P52; n=8; Eutheria|Rep: HS24/P52 -
           Homo sapiens (Human)
          Length = 474

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+GIDLG     V V + G +E IAN+  +R TP+ ++F     R IG AAK+Q+ +N 
Sbjct: 2   SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNA 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 61  KNTVQGFKRFHGRAFSD 77


>UniRef50_Q92598 Cluster: Heat shock protein 105 kDa; n=92;
           Eumetazoa|Rep: Heat shock protein 105 kDa - Homo sapiens
           (Human)
          Length = 858

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 32/77 (41%), Positives = 48/77 (62%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G+D+G+    + V + G +E IAN+  +R TPS ++F     R IG AAKNQ  T+ 
Sbjct: 2   SVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSK-NRTIGVAAKNQQITHA 60

Query: 455 ENTVFDAKRLIGREWSD 505
            NTV + KR  GR ++D
Sbjct: 61  NNTVSNFKRFHGRAFND 77


>UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock
           protein protein; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 502

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 33/74 (44%), Positives = 46/74 (62%)
 Frame = +2

Query: 386 VAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTAN 565
           VAFT D E LIGDAAKN ++ NP+NT+FDAKRLIGR+++D++    +   P   +     
Sbjct: 13  VAFT-DREILIGDAAKNHMSENPKNTIFDAKRLIGRQFNDEVVRSGMKHWPFTVINTDGK 71

Query: 566 LMFKYKLHKATKYL 607
            M + +    TK L
Sbjct: 72  PMLQVEHIGETKTL 85



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 17/42 (40%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           V+  +K +PF V+  + KP +QV+     K  +PEE+S+MVL
Sbjct: 54  VRSGMKHWPFTVINTDGKPMLQVEHIGETKTLSPEEVSSMVL 95


>UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Rep:
           Heat shock protein 70 - Acidobacteria bacterium (strain
           Ellin345)
          Length = 634

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 30/76 (39%), Positives = 42/76 (55%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTT S V   +  R  +I  + G  + PS VA     + ++G+AA+  L   PE
Sbjct: 6   VVGIDLGTTNSLVAYMEGDRPVVIPGEDGANLVPSIVALDPAAQIIVGNAARKYLIETPE 65

Query: 458 NTVFDAKRLIGREWSD 505
             V+  KRL+GR   D
Sbjct: 66  RAVYSIKRLMGRGIED 81



 Score = 33.1 bits (72), Expect = 5.8
 Identities = 14/42 (33%), Positives = 26/42 (61%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +Q ++K FPF+V +  +   V ++   G++ + P EISA +L
Sbjct: 82  IQDELKLFPFRVADDLAAGEV-IRIHLGERTYTPPEISAFIL 122


>UniRef50_P32590 Cluster: Heat shock protein homolog SSE2; n=20;
           Saccharomycetales|Rep: Heat shock protein homolog SSE2 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 693

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 29/84 (34%), Positives = 51/84 (60%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           + T  G+DLG   S + V +N  ++++ N+  NR TPS V F     R +G++ K + T+
Sbjct: 1   MSTPFGLDLGNNNSVLAVARNRGIDVVVNEVSNRSTPSLVGF-GPRNRYLGESGKTKQTS 59

Query: 449 NPENTVFDAKRLIGREWSDQLYNM 520
           N +NTV + KR+IG ++ D  +++
Sbjct: 60  NVKNTVENLKRIIGLKFKDPEFDI 83


>UniRef50_Q7ZUM5 Cluster: Heat shock protein 4; n=20;
           Euteleostomi|Rep: Heat shock protein 4 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 840

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 33/77 (42%), Positives = 47/77 (61%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G D+G     V V + G +E +AN+  +R TP+ V+F     R IG AAK+Q+ TN 
Sbjct: 2   SVVGFDVGFLNCYVAVARAGGIETVANEYSDRCTPACVSFGPRN-RSIGAAAKSQMVTNC 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTV   KR  GR +SD
Sbjct: 61  KNTVHGFKRFHGRAFSD 77


>UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=2; Bacteria|Rep: DnaK protein (Heat
           shock protein), HSP70/DnaK family - Clostridium
           acetobutylicum
          Length = 551

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 33/74 (44%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           + GIDLGTTYSC+  V + GR  ++ N +  RITPS V F  D   ++GD AK      P
Sbjct: 4   IFGIDLGTTYSCISYVDEYGRPVVVPNAENERITPSVVFFDGDNV-IVGDVAKENSKMYP 62

Query: 455 ENTVFDAKRLIGRE 496
           E+ V   KR +G E
Sbjct: 63  EDVVSFVKRSMGDE 76


>UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter
           usitatus Ellin6076|Rep: Heat shock protein 70 -
           Solibacter usitatus (strain Ellin6076)
          Length = 619

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 31/71 (43%), Positives = 44/71 (61%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTT S V  + NGRV ++  +  +++ PS V  +  GE ++G+AA NQ    PE
Sbjct: 5   VVGIDLGTTNSEVAAFLNGRVRVLGPN-ASKMLPSCVGISPSGELMVGEAALNQQRIYPE 63

Query: 458 NTVFDAKRLIG 490
            TV   KR +G
Sbjct: 64  RTVRSIKRKMG 74


>UniRef50_A5MZQ7 Cluster: DnaK9; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK9 - Clostridium kluyveri DSM 555
          Length = 540

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 32/76 (42%), Positives = 47/76 (61%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           +  V+GIDLGTT S V   K GR E+I  D G  I PS ++  +DGE ++G  AK ++  
Sbjct: 1   MSVVVGIDLGTTNSVVSYLKRGRAEVIPID-GKNIFPSVLSI-RDGEIIVGSQAKARMML 58

Query: 449 NPENTVFDAKRLIGRE 496
           +PE +V   KR +G++
Sbjct: 59  SPETSVCSTKRDMGKD 74


>UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshimeri
           serovar 6b str. SLCC5334|Rep: Complete genome - Listeria
           welshimeri serovar 6b (strain ATCC 35897 / DSM 20650
           /SLCC5334)
          Length = 561

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 30/74 (40%), Positives = 45/74 (60%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           T +GIDLGT+ S V  +K  +  +I N  G+ +TPS V   ++ E LIG  A+ +LT++P
Sbjct: 2   TTLGIDLGTSNSLVAYWKEDKAVLIPNVFGDVLTPSVVGIDENDELLIGKIARERLTSHP 61

Query: 455 ENTVFDAKRLIGRE 496
           + T    KR +G E
Sbjct: 62  DKTAAVFKRFMGTE 75


>UniRef50_A2E407 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 693

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 37/106 (34%), Positives = 60/106 (56%), Gaps = 5/106 (4%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGR--VEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +GIDLGTTY CV +Y   R  V  I +   ++I PSYV++  D   L G  A NQ+  N 
Sbjct: 6   VGIDLGTTYCCVHIYDEKRHIVSPILDGSTSQI-PSYVSYCGDNI-LYGAVAMNQILNNT 63

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSS---SPSRSLKRTANLMFKYK 583
           + TV+D+KR+IG+++ ++ + +   +      R    + N+  +YK
Sbjct: 64  KYTVYDSKRMIGKKFDNKDFQIDRKNWMFETVRGANNSININIEYK 109


>UniRef50_A6C7U7 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=1; Planctomyces maris DSM 8797|Rep:
           DnaK protein (Heat shock protein), HSP70/DnaK family -
           Planctomyces maris DSM 8797
          Length = 557

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 29/77 (37%), Positives = 48/77 (62%), Gaps = 2/77 (2%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           T+ GIDLGTTYSC+  + ++G+  ++ N++G+  TPS V F      ++G AAK+ + T+
Sbjct: 5   TIFGIDLGTTYSCISYIDEHGQPVVVQNNEGDLTTPSVVFFEDMENVVVGKAAKDAIRTD 64

Query: 452 PENTVFDAKRLIGR-EW 499
            +  V   KR +G  +W
Sbjct: 65  ADRVVSKVKREMGNSDW 81


>UniRef50_Q73CC4 Cluster: Dnak protein, truncation; n=1; Bacillus
           cereus ATCC 10987|Rep: Dnak protein, truncation -
           Bacillus cereus (strain ATCC 10987)
          Length = 505

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 33/72 (45%), Positives = 45/72 (62%), Gaps = 1/72 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +IGIDLGTT S V  +  +G   I+ N +G R+TPS V F +DG  +IG  AK+   ++P
Sbjct: 2   IIGIDLGTTNSAVAYIDDSGNPTILPNREGERVTPS-VIFFEDGSPVIGSTAKSISVSDP 60

Query: 455 ENTVFDAKRLIG 490
            NTV   KR +G
Sbjct: 61  TNTVQFVKRQMG 72


>UniRef50_A4J964 Cluster: Heat shock protein 70; n=2;
           Clostridiales|Rep: Heat shock protein 70 -
           Desulfotomaculum reducens MI-1
          Length = 619

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 30/85 (35%), Positives = 45/85 (52%)
 Frame = +2

Query: 242 RRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIG 421
           R+ +   +    ++GIDLGTT S V    N + EII + Q   I PS V    +G+ ++G
Sbjct: 4   RKNDATRQSFRPIVGIDLGTTNSAVAYIHNSKPEIIPSPQSKHIIPSVVLLDPEGKVVVG 63

Query: 422 DAAKNQLTTNPENTVFDAKRLIGRE 496
           + A+  L   P+ TV   KR IG +
Sbjct: 64  EDARAALIAMPDRTVAAVKRKIGSQ 88


>UniRef50_A0NUH2 Cluster: Putative uncharacterized protein; n=1;
           Stappia aggregata IAM 12614|Rep: Putative
           uncharacterized protein - Stappia aggregata IAM 12614
          Length = 98

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
 Frame = -1

Query: 453 GLVVSWFLAASPIKRSPS*VKATYEGVMRFPWSLAM-ISTRPFL*TPTHE*VVPKSIPIT 277
           G V +W LA  P +RSPS  KAT +GV+R P + ++ + + P + T THE VVP+SIP+T
Sbjct: 4   GFVTAWRLAGWPTRRSPSSEKATIDGVVRAPSAFSITLESLPSM-TATHEFVVPRSIPMT 62

Query: 276 VPMSLSFSS 250
             +S S SS
Sbjct: 63  FAISASLSS 71


>UniRef50_A2DR00 Cluster: DnaK protein; n=7; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 615

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 32/82 (39%), Positives = 44/82 (53%), Gaps = 4/82 (4%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVE----IIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           T++GIDLGT+   V    + R E    +  N QG    PSYV   + G    G A K+Q+
Sbjct: 8   TMLGIDLGTSSIVVHHIADTRTEKNSIVPLNFQGKETLPSYVMIQEGGSVACGAAVKDQI 67

Query: 443 TTNPENTVFDAKRLIGREWSDQ 508
             NP   +F AKRLIG ++ D+
Sbjct: 68  ANNPSRVIFGAKRLIGHKYHDR 89


>UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1;
           Methanospirillum hungatei JF-1|Rep: Heat shock protein
           70 - Methanospirillum hungatei (strain JF-1 / DSM 864)
          Length = 571

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 44/78 (56%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGID GTT S +         +I NDQG++ITPS V F  + E  IG+ AK+    +P+
Sbjct: 5   IIGIDFGTTNSKMAYMLLDEPVVIENDQGSKITPSVVYFKNEKEFSIGEQAKHNQIIHPD 64

Query: 458 NTVFDAKRLIGREWSDQL 511
             V   KR +G ++  Q+
Sbjct: 65  KVVSSIKREMGTDYKKQV 82


>UniRef50_Q4QDQ2 Cluster: Heat shock protein, putative; n=5;
           Trypanosomatidae|Rep: Heat shock protein, putative -
           Leishmania major
          Length = 823

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/77 (38%), Positives = 42/77 (54%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V GID G   S V + + G V+I+ N+   R T + V+F  D ER IG+   ++   N 
Sbjct: 2   SVFGIDFGNVNSTVAITRYGGVDIVTNEVSKRETTTIVSFVDD-ERFIGEQGLDRYVRNA 60

Query: 455 ENTVFDAKRLIGREWSD 505
           +NTVF  KR IG    D
Sbjct: 61  QNTVFLLKRFIGMRMDD 77


>UniRef50_A2EMY0 Cluster: DnaK protein; n=4; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 626

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 34/80 (42%), Positives = 46/80 (57%), Gaps = 3/80 (3%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           T IGIDLGTTY     YK+G+VEII    G    PSYV +    +   G  A+  L  NP
Sbjct: 4   TFIGIDLGTTYCSAAAYKDGKVEII-EFNGKNAFPSYVFYAHPNQ--YGFTARENL-KNP 59

Query: 455 E---NTVFDAKRLIGREWSD 505
           E   + V+D+KR++G+ + D
Sbjct: 60  EYRKSVVYDSKRMLGKTYKD 79


>UniRef50_Q9SAB1 Cluster: F25C20.19 protein; n=3; core
           eudicotyledons|Rep: F25C20.19 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 763

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 26/77 (33%), Positives = 47/77 (61%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G D+G     + V K   ++++ ND+ NR  P+ V+F +  +R +G AA    T +P
Sbjct: 2   SVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEK-QRFMGAAAAASATMHP 60

Query: 455 ENTVFDAKRLIGREWSD 505
           ++T+   KRLIGR++ +
Sbjct: 61  KSTISQLKRLIGRKFRE 77


>UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29;
           Proteobacteria|Rep: Chaperone protein hscA - Salmonella
           typhimurium
          Length = 616

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 27/74 (36%), Positives = 43/74 (58%)
 Frame = +2

Query: 284 GIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENT 463
           GIDLGTT S V   ++G+ E + + +G  + PS V + Q G   +G AA++    +  NT
Sbjct: 23  GIDLGTTNSLVATVRSGQAETLPDHEGRHLLPSVVHYQQQG-HTVGYAARDNAAQDTANT 81

Query: 464 VFDAKRLIGREWSD 505
           +   KR++GR  +D
Sbjct: 82  ISSVKRMMGRSLAD 95


>UniRef50_A2E4A6 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 844

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 29/79 (36%), Positives = 44/79 (55%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           + +VI +DLG     + + +NG V+I  N    R+TP+ VA   D  R  G+ AK Q   
Sbjct: 1   MASVIAVDLGNQNCVIALPQNGGVDIANNQSSQRLTPTMVAIDND-RRYAGEFAKTQQMQ 59

Query: 449 NPENTVFDAKRLIGREWSD 505
           N + T+ + KRLIG ++ D
Sbjct: 60  NVKGTITNLKRLIGLKYDD 78


>UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: DnaK
           protein - Clostridium perfringens
          Length = 575

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 2/78 (2%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIAN-DQGNR-ITPSYVAFTQDGERLIGDAAKNQL 442
           +G +IGIDLGTT S +   K+G+  II N ++G+    PS V+   D E  +G  AKNQ+
Sbjct: 1   MGRIIGIDLGTTTSEIAYVKDGKPCIIRNIEEGDEHAIPSVVSIEGD-EIKVGKKAKNQI 59

Query: 443 TTNPENTVFDAKRLIGRE 496
              PE TV + KR++G E
Sbjct: 60  LLKPELTVAEVKRVMGTE 77


>UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 545

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 2/80 (2%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKN--GRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           TV+GIDLGTT+S +       G+ EII + + +RITPS V   +  + ++G+ AK     
Sbjct: 19  TVVGIDLGTTFSAIAHINEDTGKAEIIPSPEQDRITPSVVLIEKVNDIIVGEIAKQNAVA 78

Query: 449 NPENTVFDAKRLIGREWSDQ 508
            P   V   KR +G+   D+
Sbjct: 79  EPNKVVEFVKRQMGKPKEDK 98


>UniRef50_Q1D211 Cluster: DnaK family protein; n=1; Myxococcus
           xanthus DK 1622|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 504

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 26/80 (32%), Positives = 46/80 (57%), Gaps = 1/80 (1%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVY-KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           G+++GID GTT +    + K G++ ++     +   PS V F    + ++G AA+ Q+  
Sbjct: 4   GSILGIDFGTTNTAAAFFDKAGKLRVVPVTDKSVTLPSVVWFHAADKAIVGHAARRQIID 63

Query: 449 NPENTVFDAKRLIGREWSDQ 508
           +P +TVF AKR +GR +  +
Sbjct: 64  DPRHTVFGAKRFLGRRFQSE 83


>UniRef50_A6EQS3 Cluster: Heat shock protein Hsp70; n=1;
           unidentified eubacterium SCB49|Rep: Heat shock protein
           Hsp70 - unidentified eubacterium SCB49
          Length = 730

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGT+ S +  +K+  V+II N +   +T S +   ++ E L+G  A   L T+P N
Sbjct: 5   IGIDLGTSNSVIA-FKDTSVKIIRNKENEELTRSCIGLRKE-EILVGRTAYQLLKTDPIN 62

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSS 535
           T+   KRL+G    D++   M+ SS
Sbjct: 63  TILSVKRLMGGAIKDKMVQDMIESS 87


>UniRef50_A6CBP2 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 671

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +GIDLGTTYSC+  + ++G    I N +G   TPS VA     E ++G  A      NP 
Sbjct: 7   VGIDLGTTYSCIAHLNEHGEPVTIPNQEGELSTPS-VAMFDGAEVIVGTEALRHAIVNPR 65

Query: 458 NTVFDAKRLIGR 493
           N V  AKR +G+
Sbjct: 66  NVVQHAKRFLGK 77


>UniRef50_Q64YI6 Cluster: Chaperone protein DnaK; n=2; Bacteroides
           fragilis|Rep: Chaperone protein DnaK - Bacteroides
           fragilis
          Length = 529

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 31/73 (42%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           +V GIDLGTTYSC+  V K  +  ++ N +G+  TPS V F      ++G  AK  L T 
Sbjct: 6   SVYGIDLGTTYSCIAQVDKFDQAIVLRNFEGDATTPSAVYFEDMDHVVVGKEAKGMLATE 65

Query: 452 PENTVFDAKRLIG 490
           P  T    KR IG
Sbjct: 66  PTKTAVFIKRHIG 78


>UniRef50_Q1NR74 Cluster: Heat shock protein Hsp70; n=3;
           Proteobacteria|Rep: Heat shock protein Hsp70 - delta
           proteobacterium MLMS-1
          Length = 832

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 32/100 (32%), Positives = 47/100 (47%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTT S +  Y      I  + Q N +TPS +   + G + IG  A N     P+N
Sbjct: 5   VGIDLGTTNSAICSYDGSETRIWKSPQQNDVTPSAIYIDRRGNKQIGFNAYNMAPQCPDN 64

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKY 580
           +    KRL+G     QL  + L+ +P         ++F Y
Sbjct: 65  SAMLFKRLMGTSTPVQLSAVNLTMTPEECSAEILKVLFGY 104


>UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia
           intestinalis|Rep: GLP_54_20127_18205 - Giardia lamblia
           ATCC 50803
          Length = 640

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 3/78 (3%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGER---LIGDAAKNQLTTN 451
           +G DLGTT SCV    +G   ++    G+R  PS V +     R   L+G  A+ Q  TN
Sbjct: 9   LGFDLGTTNSCVSTMVSGVPTVLPMLDGSRTVPSVVGYLPLEARDTPLVGAEAERQALTN 68

Query: 452 PENTVFDAKRLIGREWSD 505
            +NT+  +KRLIGR ++D
Sbjct: 69  VKNTINASKRLIGRRFTD 86


>UniRef50_P87142 Cluster: Heat shock protein 70 homolog C57A7.12;
           n=1; Schizosaccharomyces pombe|Rep: Heat shock protein
           70 homolog C57A7.12 - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 566

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 29/89 (32%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           TVIGI  G   S +   ++G+ +++AN++GNR  PS +++  D E   G  A+ QL  N 
Sbjct: 25  TVIGISFGNQNSSIAFNRDGKTDVLANEEGNRQIPSILSYHGDQE-YHGVQARGQLVRNA 83

Query: 455 ENTVFDAKRLIGREWSD-QLYNMMLSSSP 538
           +N+V + + L+G+   +  L++   S++P
Sbjct: 84  DNSVTNFRDLLGKSHDELTLHHCHYSANP 112


>UniRef50_A6C7U8 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Planctomyces maris DSM 8797|Rep: DnaK protein (Heat
           shock protein), C-terminal region has VWA type A domain
           - Planctomyces maris DSM 8797
          Length = 715

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 42/101 (41%), Positives = 57/101 (56%), Gaps = 7/101 (6%)
 Frame = +2

Query: 281 IGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           IGIDLGTT S V  V  + RVE++ N+ G  ITPS V F ++G  ++GD AK        
Sbjct: 5   IGIDLGTTNSVVATVGCSERVEVLPNEHGKSITPSVVLF-ENGSVVVGDEAKESQKIGDP 63

Query: 458 NTVFDAKRLIG-REW----SDQLYNMM-LSSSPSRSLKRTA 562
           N     KRL+G RE+    + + Y+ + LS+   RSLK  A
Sbjct: 64  NVASFFKRLMGDREYRFETAQKEYSAIELSACVLRSLKADA 104


>UniRef50_A3FQM0 Cluster: Heat shock 105kD; heat shock 105kD alpha;
           heat shock 105kD beta; heat shock 105kDa protein 1; n=2;
           Cryptosporidium|Rep: Heat shock 105kD; heat shock 105kD
           alpha; heat shock 105kD beta; heat shock 105kDa protein
           1 - Cryptosporidium parvum Iowa II
          Length = 806

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 30/72 (41%), Positives = 41/72 (56%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +VIG+D+GT  + V     G V I+ N+   R TP  V +T D ERLIG+ A  ++ +N 
Sbjct: 2   SVIGLDIGTINAVVATINRGAVTIVRNELSERTTPILVGYT-DTERLIGEPALTKMKSNY 60

Query: 455 ENTVFDAKRLIG 490
            NT    K LIG
Sbjct: 61  RNTCRYMKPLIG 72


>UniRef50_A2DWC1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 649

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 2/77 (2%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYK--NGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +GIDLGTT+S   +Y       E+I  D G +  PS VAF      ++G+ AK QL   P
Sbjct: 8   LGIDLGTTFSSAAIYNPDTKTTEVIEID-GKKELPSMVAFNVS-PHVVGEPAKGQLLIEP 65

Query: 455 ENTVFDAKRLIGREWSD 505
               +D+KR+IG+ + D
Sbjct: 66  TAVAYDSKRMIGQSYDD 82


>UniRef50_A4ZY06 Cluster: Putative uncharacterized protein; n=1;
           Rhodococcus sp. DK17|Rep: Putative uncharacterized
           protein - Rhodococcus sp. DK17
          Length = 316

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/47 (51%), Positives = 32/47 (68%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           +GT +GIDLGTT S +  ++     +IAN +G R TPS VAFT+ GE
Sbjct: 1   MGTAVGIDLGTTNSAIACWQGSEPVVIANAEGARTTPSVVAFTESGE 47


>UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2;
           Actinomycetales|Rep: Heat shock protein HSP70 -
           Saccharopolyspora erythraea (strain NRRL 23338)
          Length = 555

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/74 (40%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           V GIDLGTTYS +  V + GR  +  N      TPS V F  +   ++G  AKN   T P
Sbjct: 8   VFGIDLGTTYSAIAYVDETGRPAVCRNTDSLETTPSVVFFENESNVVVGSVAKNSAITYP 67

Query: 455 ENTVFDAKRLIGRE 496
           +  V   KR +G E
Sbjct: 68  DQVVSLIKREMGSE 81


>UniRef50_A5N5I5 Cluster: DnaK1; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK1 - Clostridium kluyveri DSM 555
          Length = 521

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 31/76 (40%), Positives = 45/76 (59%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           +  V+GIDLGTT S +   K G+VE I  D G    PS V+ + +G+ + G  AK +L  
Sbjct: 1   MSAVVGIDLGTTNSVISCVKRGKVETILLD-GKNTFPSVVSIS-NGKIITGYPAKAKLIM 58

Query: 449 NPENTVFDAKRLIGRE 496
           +P NTV   KR +G++
Sbjct: 59  DPSNTVGSTKRDMGKD 74


>UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Clostridium acetobutylicum|Rep: DnaK protein (Heat shock
           protein), C-terminal region has VWA type A domain -
           Clostridium acetobutylicum
          Length = 698

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 7/112 (6%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVY-KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +GIDLGTT+S V +  +NG  +++ N +GN +TPS + F+ + E ++GD AK        
Sbjct: 5   LGIDLGTTFSVVSIIDENGAPKVLKNKEGNTLTPSVIYFSGE-EIIVGDDAKEMQAMGDN 63

Query: 458 NTVFDAKRLIG-----REWSDQLYNMM-LSSSPSRSLKRTANLMFKYKLHKA 595
           N     KR +G      E+ ++ YN   LS    + LK+ A    K ++  A
Sbjct: 64  NIACFFKRNMGDENFVLEFQNKYYNAEDLSVIVLKKLKKDAEDFLKAEVKDA 115


>UniRef50_A7BR82 Cluster: Heat shock protein Hsp70; n=1; Beggiatoa
           sp. PS|Rep: Heat shock protein Hsp70 - Beggiatoa sp. PS
          Length = 516

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 2/75 (2%)
 Frame = +2

Query: 281 IGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           IGIDLGTTYS +  +  +G+ EI+ N  G R+T S V F Q G  L+G  A +    +P+
Sbjct: 6   IGIDLGTTYSALATLNSSGKPEIVPNLDGERVTASAVYF-QGGSILVGQLAADAAAGDPD 64

Query: 458 NTVFDAKRLIG-REW 499
             +   KR +G  EW
Sbjct: 65  RVIQHVKRRMGDSEW 79


>UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: 70 kD heat
           shock protein - Saccharopolyspora erythraea (strain NRRL
           23338)
          Length = 538

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/75 (42%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           T  GIDLGTT+SCV  V ++GR  I  N      TPS V F   G  L+G +AKN     
Sbjct: 6   TTFGIDLGTTHSCVAYVDESGRPVIARNAVSEDTTPSVVYFEGPGRVLVGSSAKNSALLA 65

Query: 452 PENTVFDAKRLIGRE 496
           P       KR +GR+
Sbjct: 66  PHLVAQLVKRDMGRQ 80


>UniRef50_Q9GYV8 Cluster: 70-kDa heat shock protein; n=5; Entamoeba
           histolytica|Rep: 70-kDa heat shock protein - Entamoeba
           histolytica
          Length = 558

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/83 (38%), Positives = 48/83 (57%), Gaps = 5/83 (6%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFT---QDGERLIGDAAKNQLT 445
           IGIDLGTTYS +  Y    G   I+ ++ G     S+V+ +   + G  +IG++AKN+  
Sbjct: 10  IGIDLGTTYSSIAYYDITRGESVIVQDELGKEQVASWVSLSRLDKSGYTIIGNSAKNE-- 67

Query: 446 TNPENTVFDAKRLIGREWSDQLY 514
            N E  ++D+KR+IGR   D  Y
Sbjct: 68  ANNECVIYDSKRIIGRGECDVNY 90


>UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera
           aphidicola (Baizongia pistaciae)|Rep: Chaperone protein
           hscA - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 511

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 27/83 (32%), Positives = 43/83 (51%)
 Frame = +2

Query: 257 KDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKN 436
           + K+    IGID GTTYS V       + II +     + PS + +T   + ++G  A+ 
Sbjct: 14  EQKNTKLSIGIDFGTTYSLVASALEDNIYIILDQNNRALLPSIINYTSK-KPIVGWEAQK 72

Query: 437 QLTTNPENTVFDAKRLIGREWSD 505
           Q   +P+NT+   KRLIG  + +
Sbjct: 73  QAINDPKNTIISIKRLIGHSYDE 95


>UniRef50_UPI0000499107 Cluster: 70 kDa heat shock protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 70 kDa heat shock
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 559

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 30/79 (37%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKN-GRVEIIANDQ-GNRITPSYVAFTQ--DGERLIGDAAKNQLTT 448
           +GID GTT+S +  Y    + +   ND+ GN+  PS+V+F Q  +   +IG+ AKN++  
Sbjct: 9   VGIDFGTTFSSIAYYNPLNKTDCTINDEGGNKQIPSWVSFAQMENSGVIIGNGAKNEIF- 67

Query: 449 NPENTVFDAKRLIGREWSD 505
             E  ++D+KR+IG + SD
Sbjct: 68  -GECVLYDSKRIIGSDISD 85



 Score = 33.5 bits (73), Expect = 4.4
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 3/42 (7%)
 Frame = +1

Query: 520 DVKFFPFKVV-EKNSKPHVQVQT--SQGDKVFAPEEISAMVL 636
           D K +PF V+   N K  ++V     Q D++F PEEIS MVL
Sbjct: 90  DKKHWPFTVIGNNNGKACMEVYNPFKQKDEIFEPEEISGMVL 131


>UniRef50_A4AEG2 Cluster: Putative uncharacterized protein; n=1;
           marine actinobacterium PHSC20C1|Rep: Putative
           uncharacterized protein - marine actinobacterium
           PHSC20C1
          Length = 98

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 34/74 (45%), Positives = 41/74 (55%)
 Frame = -1

Query: 462 VFSGLVVSWFLAASPIKRSPS*VKATYEGVMRFPWSLAMISTRPFL*TPTHE*VVPKSIP 283
           V S LV +W  A SP + SPS V AT +GV+R P + AM    P   T T E VVP+SIP
Sbjct: 6   VRSTLVTAWRFAVSPTRTSPSLVNATTDGVVRIPSAFAMTVGSPPSRTATTEFVVPRSIP 65

Query: 282 ITVPMSLSFSSCRR 241
            T     S+S   R
Sbjct: 66  -TARAMCSYSLALR 78


>UniRef50_Q57VU9 Cluster: Heat shock 70 kDa protein, putative; n=4;
           Trypanosoma|Rep: Heat shock 70 kDa protein, putative -
           Trypanosoma brucei
          Length = 870

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 34/92 (36%), Positives = 49/92 (53%), Gaps = 3/92 (3%)
 Frame = +2

Query: 227 RGRLCRRQEEKDKDIGTVIGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFTQ 400
           R R    +EE       VIGIDLGTT SC+     K  R +II +  G+ + P+ + F +
Sbjct: 53  RARYVVVKEETRASGDRVIGIDLGTTNSCISYIDKKTNRPKIIPSPTGSWVFPTAITFDK 112

Query: 401 DGE-RLIGDAAKNQLTTNPENTVFDAKRLIGR 493
             + RL G+ A+  + T+   T+   KRLIGR
Sbjct: 113 SHKVRLYGEEARACVRTSASATLCSGKRLIGR 144


>UniRef50_Q4CS27 Cluster: Putative uncharacterized protein; n=3;
           Trypanosoma|Rep: Putative uncharacterized protein -
           Trypanosoma cruzi
          Length = 722

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query: 278 VIGIDLGTTY-SCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           V+GID G+ Y    G +    V+I+ N+Q +R T +Y+ F ++GER IGD AK      P
Sbjct: 21  VLGIDFGSEYIEVAGPHNGNNVDIVLNEQSHRKTDNYIGF-KNGERYIGDQAKALAARFP 79

Query: 455 ENTVFDAKRLIG 490
            N V    +LIG
Sbjct: 80  LNMVTMINQLIG 91


>UniRef50_A2EPF1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 657

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVY-KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           ++GIDLGTT+S +  Y KN ++  +    GN+  PS V +     +L+G+ A  +    P
Sbjct: 9   ILGIDLGTTFSSIAYYDKNRQMVHLIEIDGNKSIPSVVYYGDP--KLVGNQAYERAKIEP 66

Query: 455 ENTVFDAKRLIGREWSD 505
              ++D+KRLIG ++ D
Sbjct: 67  NLVIYDSKRLIGCKYQD 83


>UniRef50_A2DHP3 Cluster: Heat shock protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Heat shock protein,
           putative - Trichomonas vaginalis G3
          Length = 266

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNG-----RVEIIANDQ-GNRITPSYVAFTQDGERLIGDAAKN 436
           T IGIDLGT  S +    +G       E++ NDQ G   TP+ V+FT D   LIG+ A+ 
Sbjct: 2   TAIGIDLGTNNSRIAYNTSGPNEIPSFELLLNDQTGKSTTPTLVSFTDDSI-LIGEEARK 60

Query: 437 QLTTNPENTVFDAKRLIGREW 499
                PEN ++  K ++GR +
Sbjct: 61  VYADKPENAIYGIKPMLGRRY 81


>UniRef50_A5MZQ6 Cluster: DnaK8; n=2; Clostridium kluyveri DSM
           555|Rep: DnaK8 - Clostridium kluyveri DSM 555
          Length = 530

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 28/73 (38%), Positives = 39/73 (53%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGT+ S   VY  G+  II  D G    PS V+F      ++G  AK +   + E
Sbjct: 11  VLGIDLGTSTSIASVYTKGKSRIIKID-GKEYIPSVVSFLDSETIIVGSQAKGRAIIDSE 69

Query: 458 NTVFDAKRLIGRE 496
           NT+   KR +G +
Sbjct: 70  NTIESIKRHMGED 82


>UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep:
           Heat shock protein 70 - Frankia sp. (strain CcI3)
          Length = 556

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 35/97 (36%), Positives = 49/97 (50%), Gaps = 6/97 (6%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGER----LIGDAAKNQL 442
           V GIDLGTTYSC+  V + GR E+I N +    TPS V F    E     ++G  AK Q 
Sbjct: 6   VFGIDLGTTYSCIAQVDEYGRPEVIRNIESQPTTPSVVLFDTGAEGPTSFVVGTQAKRQA 65

Query: 443 TTNPENTVFDAKRLIG-REWSDQLYNMMLSSSPSRSL 550
              P++     KR +G  +W    ++   S++   SL
Sbjct: 66  RIRPDDVARLVKRHMGASDWRFVAHDEEYSAAAVSSL 102


>UniRef50_A6GJQ9 Cluster: Heat shock protein Hsp70; n=1;
           Plesiocystis pacifica SIR-1|Rep: Heat shock protein
           Hsp70 - Plesiocystis pacifica SIR-1
          Length = 826

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/70 (35%), Positives = 37/70 (52%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +G DLGTT S   V+   +  ++ N QG+ +TPS V         +G  A+  L  +P N
Sbjct: 7   VGFDLGTTNSAAAVFDGEQTRVVRNSQGSTLTPSVVRIDGRERVTVGAKARRFLERDPHN 66

Query: 461 TVFDAKRLIG 490
           T  + KRL+G
Sbjct: 67  THNEFKRLMG 76


>UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2;
           Gammaproteobacteria|Rep: Molecular chaperone HscA -
           Vesicomyosocius okutanii subsp. Calyptogena okutanii
           (strain HA)
          Length = 614

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 29/99 (29%), Positives = 49/99 (49%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGTT S V    NG+ ++I ++    + PS +   +  +  +G  A     T+P 
Sbjct: 21  VIGIDLGTTNSLVASVINGQSKVIMDENNEAVLPSIIHCGKHNKLTVGCDAYPYAKTDPT 80

Query: 458 NTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMF 574
           NT+   KR +G  + +        + P + +K   N++F
Sbjct: 81  NTIISIKRFMGMSYEEV---STFKNCPYQLIKDGNNVLF 116


>UniRef50_A2F0R7 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 995

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 27/74 (36%), Positives = 40/74 (54%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +IGID G     +    NG V++IAN   +R TP+ V +T +  R +GD AK Q     +
Sbjct: 4   IIGIDFGNKNCIISAEVNGSVDVIANQNASRATPAIVTYT-NKRRFVGDLAKMQQMEFYK 62

Query: 458 NTVFDAKRLIGREW 499
            T+   K LIG ++
Sbjct: 63  ATITKIKSLIGMKF 76


>UniRef50_Q9S8V5 Cluster: ATP-binding HSP70 homolog; n=4; cellular
           organisms|Rep: ATP-binding HSP70 homolog - Zea mays
           (Maize)
          Length = 33

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/32 (68%), Positives = 28/32 (87%)
 Frame = +2

Query: 254 EKDKDIGTVIGIDLGTTYSCVGVYKNGRVEII 349
           E+ K +GTVIGIDLGTTYSCVG++++  VEII
Sbjct: 2   EETKKLGTVIGIDLGTTYSCVGLWQHDXVEII 33


>UniRef50_Q3VZ88 Cluster: Heat shock protein Hsp70; n=1; Frankia sp.
           EAN1pec|Rep: Heat shock protein Hsp70 - Frankia sp.
           EAN1pec
          Length = 579

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GID+GTT++   ++++GR E       +   PS +    DG  L+G+AA+ +  T P  
Sbjct: 5   LGIDVGTTFTAGAIWRDGRAEAFGLGTHSTAVPSVLFLRDDGVMLVGEAAEQRAVTEPSR 64

Query: 461 TVFDAKRLIG 490
              + KR  G
Sbjct: 65  VAREFKRRFG 74


>UniRef50_A7AN53 Cluster: DnaK family protein; n=1; Babesia
           bovis|Rep: DnaK family protein - Babesia bovis
          Length = 755

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/72 (34%), Positives = 38/72 (52%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GID+G   + V     G ++++ N+   R TP   +FTQ   RL GD A  Q+ +N  
Sbjct: 3   VLGIDIGDANATVATIAKGSIDVVLNEVSQRYTPVCASFTQK-RRLFGDQATPQMISNYR 61

Query: 458 NTVFDAKRLIGR 493
           N+      L+GR
Sbjct: 62  NSCRSMMSLLGR 73


>UniRef50_A2FPJ8 Cluster: Heat shock protein SSB-related protein;
           n=1; Trichomonas vaginalis G3|Rep: Heat shock protein
           SSB-related protein - Trichomonas vaginalis G3
          Length = 136

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYK-NGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +GIDLGTTYS + +Y  + +   +     ++  PS V F    E   G  AK QL  +P+
Sbjct: 6   VGIDLGTTYSSIAIYNPDKKTTEVLQIGADQSIPSCVFFGSTRE--YGSTAKKQLEMHPK 63

Query: 458 NTVFDAKRLIGREWSD 505
              FD+KR+IG+ +++
Sbjct: 64  AVAFDSKRMIGQTFNE 79


>UniRef50_Q4P3F6 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 573

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           G VIGI+ G +YS +  + ++GR ++IAN+ G R   + +AF  D +  + + A  QL  
Sbjct: 6   GAVIGINFGHSYSSIACINQHGRADVIANEDGERQLATRIAFNGD-QVYLANQATPQLVR 64

Query: 449 NPENTVFDAKRLIGREWS 502
           N  N + +   L+GR +S
Sbjct: 65  NAPNVIDNFVNLLGRPFS 82


>UniRef50_Q1E6G2 Cluster: Heat shock protein 70 homolog; n=17;
           Pezizomycotina|Rep: Heat shock protein 70 homolog -
           Coccidioides immitis
          Length = 577

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/74 (33%), Positives = 45/74 (60%), Gaps = 1/74 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           IGI  G + S +  +   G+ ++IAN++G+R  PS +++ + GE   G  AK QL  NP+
Sbjct: 18  IGISFGNSNSSIAHISPEGKPQVIANEEGDRHIPSVLSYVE-GEEYHGAQAKAQLVRNPK 76

Query: 458 NTVFDAKRLIGREW 499
           NT+   +  +G+++
Sbjct: 77  NTIAYFRDYLGKDF 90


>UniRef50_UPI00006CA81B Cluster: dnaK protein; n=1; Tetrahymena
           thermophila SB210|Rep: dnaK protein - Tetrahymena
           thermophila SB210
          Length = 811

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 28/70 (40%), Positives = 41/70 (58%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGID G++ S + V K G V++IAN+   R T + V +    +R  G+AA  Q  +N +N
Sbjct: 12  IGIDFGSSRSVIAVAKRGGVDVIANEASLRETRNIVGY-GPAQRFTGEAANAQAKSNFKN 70

Query: 461 TVFDAKRLIG 490
           TV    RL+G
Sbjct: 71  TVSFFNRLLG 80


>UniRef50_A1G644 Cluster: Heat shock protein 70; n=2;
           Salinispora|Rep: Heat shock protein 70 - Salinispora
           arenicola CNS205
          Length = 632

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 25/71 (35%), Positives = 34/71 (47%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTTY+    ++ GR EI        + PS V    D   L+G+ A  +  T P 
Sbjct: 3   VLGIDLGTTYTAAATWREGRAEIAPLGTRAAVIPSVVLLRDDETFLVGETASRRGLTEPR 62

Query: 458 NTVFDAKRLIG 490
               + KR  G
Sbjct: 63  RVAREFKRRFG 73


>UniRef50_A2FVJ6 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 726

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 11/90 (12%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGR-VEIIANDQGNRITPSYVAF----------TQDGERLIG 421
           +VI  DLGTT    GV++ GR +EI+ N+Q  R TP+ V+F           ++  R +G
Sbjct: 12  SVIAFDLGTTNMKTGVFRAGRSIEIVLNEQSKRKTPAMVSFEPQIPITVENVRNISRRVG 71

Query: 422 DAAKNQLTTNPENTVFDAKRLIGREWSDQL 511
            +A   L  N  + +     +IG++WS +L
Sbjct: 72  ISANPVLIRNSSSVIRQITEVIGKQWSPEL 101


>UniRef50_A2ECV1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 650

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEI-IANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +GIDLGTT+  V VY+    E  +   +G++  PS V +        G  AK+QL   P 
Sbjct: 7   VGIDLGTTFCSVAVYRPSTQETEVLEIEGSKTIPSQVYYGTP--TYFGQKAKDQLQITPT 64

Query: 458 NTVFDAKRLIGREWSD 505
              +D+KR+IGR + +
Sbjct: 65  LVAYDSKRMIGRTYDE 80


>UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 876

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 31/90 (34%), Positives = 50/90 (55%), Gaps = 2/90 (2%)
 Frame = +2

Query: 248 QEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           ++EK +     IGIDLGTTY  V  Y+N ++E I    G    PS V + +     +G  
Sbjct: 3   EKEKPQQPPVYIGIDLGTTYCSVAKYENNKLETI-EFNGTSTIPSRVYYGEFNS--VGYQ 59

Query: 428 AKNQLTTNP--ENTVFDAKRLIGREWSDQL 511
           A+ Q+      +N V+D+KR++G+ + DQ+
Sbjct: 60  AQQQMKFKDKIKNVVYDSKRMLGKSY-DQI 88


>UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative gdh;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           putative gdh - Nasonia vitripennis
          Length = 486

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 22/41 (53%), Positives = 29/41 (70%)
 Frame = -3

Query: 505 VTPFTTNQTLGIKDSVFRVGSKLVFGSITN*TFTILSEGHV 383
           V PF TN+TLG++  V RVG +LV GSI+N T  +  EG+V
Sbjct: 446 VGPFATNETLGVEHGVLRVGGQLVLGSISNETLAVSCEGNV 486



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 24/41 (58%), Positives = 30/41 (73%)
 Frame = -1

Query: 636 QNHSRDFFRSKYFVAL*SLYLNMRFAVLFNDLEGEELNIML 514
           +NHSRDF RS+ FVAL    L+M  AVL +D E EEL+I+L
Sbjct: 402 KNHSRDFLRSEDFVALAGGDLDMGLAVLLDDFEREELDIVL 442


>UniRef50_A4FEW4 Cluster: Putative surface layer protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: Putative
           surface layer protein - Saccharopolyspora erythraea
           (strain NRRL 23338)
          Length = 793

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 32/111 (28%), Positives = 55/111 (49%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           +G  +G+DLGTT++ V V +  R+E++       + P+ V    DG  + GDAA  +  +
Sbjct: 1   MGYSLGVDLGTTFTAVAVDRTERIEMLTLGDRTVVAPAVVFARDDGGVVTGDAAVRRAMS 60

Query: 449 NPENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATK 601
            P  T  + KR +G         +ML  +P  ++     L+ +  LHK T+
Sbjct: 61  EPFRTGREFKRRLGDPTP-----LMLGGTPYSAVALLGYLL-RDALHKVTE 105


>UniRef50_Q4Q9A4 Cluster: Heat shock 70 protein-like protein; n=3;
           Leishmania|Rep: Heat shock 70 protein-like protein -
           Leishmania major
          Length = 944

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 3/81 (3%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFTQDGE-RLIGDAAKNQL 442
           G VIGIDLGTT SC+        R +II +  G+ + P+ + F ++ + R+ G+ A+   
Sbjct: 91  GRVIGIDLGTTNSCICYIDAATRRPKIIPSPTGSWVYPTAITFDKNHQIRMFGEEARACA 150

Query: 443 TTNPENTVFDAKRLIGREWSD 505
            T+   T+   KRLIGR + +
Sbjct: 151 RTSASATLCSGKRLIGRGFGE 171


>UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera
           aphidicola|Rep: Chaperone protein hscA - Buchnera
           aphidicola subsp. Acyrthosiphon pisum (Acyrthosiphon
           pisumsymbiotic bacterium)
          Length = 611

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 26/80 (32%), Positives = 44/80 (55%)
 Frame = +2

Query: 254 EKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAK 433
           +K  D   ++GIDLGTTYS     +   V ++ + +   + PS V + ++ +  +G  A 
Sbjct: 5   KKKHDKKLLLGIDLGTTYSLAATVREKSVILLLDKKKRYLLPSVVHYKKN-KISVGWKAL 63

Query: 434 NQLTTNPENTVFDAKRLIGR 493
             +T +P NT+   KRL+GR
Sbjct: 64  ENITEDPTNTISSVKRLLGR 83


>UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera
           aphidicola str. Cc (Cinara cedri)|Rep: Molecular
           chaperone - Buchnera aphidicola subsp. Cinara cedri
          Length = 499

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 33/115 (28%), Positives = 59/115 (51%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           T+IGID GTT S V      +++II N    +  PS +  + + +  IG  A   L+++ 
Sbjct: 5   TIIGIDFGTTNSLVSTILEKKIKIINNFNKKKFFPSIIHIS-NKKISIGWKALKYLSSDA 63

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATKYLLLKK 619
           +NT+   KR IG  ++    N+ + +  S + K+   L+F  K+ K     +++K
Sbjct: 64  QNTISSIKRFIGISYNSIKKNINIPNIISENNKK--ELVFHTKIGKMNVSCIIEK 116


>UniRef50_Q2QXK2 Cluster: DnaK protein, expressed; n=2; Oryza
           sativa|Rep: DnaK protein, expressed - Oryza sativa
           subsp. japonica (Rice)
          Length = 461

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/56 (48%), Positives = 34/56 (60%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKN 436
           +GTVI +DLG T SCV  Y +   E  A        P+ VAFT DG+ L+G+AAKN
Sbjct: 43  LGTVIAVDLGNTNSCVAGYGD---EADAPPLFRLCIPTSVAFTGDGDALVGEAAKN 95


>UniRef50_Q4N5P7 Cluster: Heat shock protein 110, putative; n=2;
           Theileria|Rep: Heat shock protein 110, putative -
           Theileria parva
          Length = 840

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGE--RLIGDAAKNQLTTN 451
           V+GID+G++ S V     G ++I+ ND   R TP  +     GE  R+ GD A  Q+ +N
Sbjct: 3   VLGIDVGSSTSTVATISRGAIDIVLNDVSQRYTPLILTCVSYGEYQRVFGDQANTQIVSN 62

Query: 452 PENT 463
            +NT
Sbjct: 63  FKNT 66


>UniRef50_Q8YNT4 Cluster: DnaK-type molecular chaperone; n=2;
           Nostocaceae|Rep: DnaK-type molecular chaperone -
           Anabaena sp. (strain PCC 7120)
          Length = 712

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 24/47 (51%), Positives = 33/47 (70%)
 Frame = +2

Query: 368 RITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDQ 508
           ++T S VA+ QD + L+G+ A NQL  +PEN +   KRLIGR +SDQ
Sbjct: 12  KLTRSLVAYDQD-KLLVGNQAYNQLRADPENVIASIKRLIGRGFSDQ 57


>UniRef50_Q4ETY1 Cluster: Putative uncharacterized protein; n=2;
           Listeria monocytogenes|Rep: Putative uncharacterized
           protein - Listeria monocytogenes str. 1/2a F6854
          Length = 79

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 33/69 (47%), Positives = 40/69 (57%)
 Frame = -1

Query: 453 GLVVSWFLAASPIKRSPS*VKATYEGVMRFPWSLAMISTRPFL*TPTHE*VVPKSIPITV 274
           GLV++   A SP  RSP  +K T EGV+R P  L +I   P   T T E VVPKSIPI  
Sbjct: 7   GLVIAARFATSPTWRSPF-LKPTTEGVVRAPSGLGIILASPPSNTATAEFVVPKSIPII- 64

Query: 273 PMSLSFSSC 247
            + +  SSC
Sbjct: 65  -LLIVISSC 72


>UniRef50_Q08P77 Cluster: Chaperone protein DnaK, putative; n=1;
           Stigmatella aurantiaca DW4/3-1|Rep: Chaperone protein
           DnaK, putative - Stigmatella aurantiaca DW4/3-1
          Length = 425

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 28/88 (31%), Positives = 41/88 (46%)
 Frame = +2

Query: 242 RRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIG 421
           R  E   + +G VI +DLGTT   V V K G    +   + +  TPS+VA    G  + G
Sbjct: 17  RPPEASTRSLGPVIAVDLGTTMCRVAVLKQGTAVCVPTGRADG-TPSFVALGPGGRVVTG 75

Query: 422 DAAKNQLTTNPENTVFDAKRLIGREWSD 505
            AA+ Q  + P    +  K L+   + D
Sbjct: 76  SAARQQQASVPALATWGIKGLLAAPFGD 103


>UniRef50_A2DQ03 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 372

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGN-RITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           IGID G +++ V + K G    + N  G  +  PS+V    DG  + G  AK+     P+
Sbjct: 3   IGIDFGNSFTRVALKKEGEAPQLLNIDGELKEMPSFVYIKPDGVLVAGSEAKSHAEAEPK 62

Query: 458 NTVFDAKRLIGREWS 502
           NT+ + KR  G  +S
Sbjct: 63  NTINNIKRFTGASYS 77


>UniRef50_Q8TGR5 Cluster: Uncharacterized protein YEL030C-A; n=2;
           cellular organisms|Rep: Uncharacterized protein
           YEL030C-A - Saccharomyces cerevisiae (Baker's yeast)
          Length = 104

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 1/53 (1%)
 Frame = -1

Query: 432 LAASPIKRSPS*VKATYEGVMRFPWSLAMI-STRPFL*TPTHE*VVPKSIPIT 277
           LA SP KRSPS VKAT +GV+  P + ++I  T P +   T E VVPKSIPIT
Sbjct: 6   LAGSPTKRSPSLVKATTDGVVLEPSAFSIILGTLPSI-IATAELVVPKSIPIT 57


>UniRef50_Q3WFH0 Cluster: Heat shock protein Hsp70; n=1; Frankia sp.
           EAN1pec|Rep: Heat shock protein Hsp70 - Frankia sp.
           EAN1pec
          Length = 832

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = +2

Query: 284 GIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENT 463
           GIDLGTT S + V       I+ N   +  TPS V   ++G   +G+ A+ ++ ++P N 
Sbjct: 9   GIDLGTTNSAIAVLDGTEARIVKNAFQHDTTPSAVYADRNGRIHVGERARERVESDPANA 68

Query: 464 VFDAKRLIG-REWSDQLYNMMLSSSP 538
             + K  +G R+ +    N  LS SP
Sbjct: 69  AAEFKLKMGLRDQATTFANSGLSMSP 94


>UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3;
           Psychrobacter|Rep: 2-alkenal reductase - Psychrobacter
           sp. PRwf-1
          Length = 650

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 6/92 (6%)
 Frame = +2

Query: 248 QEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQG---NRITPSYVAFTQDGER-- 412
           Q  K  +    +GIDLGTT S V V ++G+  ++        + + PS V +    +   
Sbjct: 11  QSAKPHEHKYALGIDLGTTRSMVAVVRSGKAALLETADAKTKDNLLPSVVYYGTANDTNA 70

Query: 413 -LIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
            ++G  A +   T+P NT+  AKR +GR   D
Sbjct: 71  PIVGSEALSYFETDPVNTIISAKRFMGRSVKD 102


>UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;
           Orientia tsutsugamushi Boryong|Rep: Heat shock chaperone
           protein hscA - Orientia tsutsugamushi (strain Boryong)
           (Rickettsia tsutsugamushi)
          Length = 616

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 33/111 (29%), Positives = 53/111 (47%), Gaps = 4/111 (3%)
 Frame = +2

Query: 248 QEEKDKDIGT---VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL- 415
           +E +++ I T   V+GID GTT S V    N +  +IAN QG    PS V+F  +G  + 
Sbjct: 7   EEPQNQSIHTSEIVVGIDFGTTNSLVAHSINSKAYVIANSQGLNKLPSIVSFNHEGNVIS 66

Query: 416 IGDAAKNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANL 568
           IG   K+ +       +   KRL+G+   + L +  +       L +  N+
Sbjct: 67  IGSKEKHYI------AITSVKRLLGKSTEEILNSSAIGQEIKELLVKNTNI 111


>UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum
           ferrooxidans|Rep: HscA chaperone - Leptospirillum
           ferrooxidans
          Length = 588

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 22/60 (36%), Positives = 39/60 (65%)
 Frame = +2

Query: 326 KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           ++G++ +I + +G ++ PS VA +  G + +G AAK++L       V+ AKRL+GR +SD
Sbjct: 2   EDGKLRVIPDTEGRKLLPSVVALSSSGVQ-VGFAAKSRLNDPETIVVYSAKRLMGRSFSD 60


>UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK6 - Clostridium kluyveri DSM 555
          Length = 490

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 6/105 (5%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTT+S +  +   + E+ +  +G    PS V +    + +IG  A  +   NPE
Sbjct: 10  VVGIDLGTTFSSIARWTGTKAEVYSL-KGEYNIPS-VVYNDGSQFVIGKIAFMKGIMNPE 67

Query: 458 NTVFDAKRLIGREWS-----DQLYNMM-LSSSPSRSLKRTANLMF 574
           N     KRLIG E++     D+ YN + +S+   + L R    MF
Sbjct: 68  NMCRGVKRLIGNEYAPIKLGDKDYNSIEISAEILKYLYRNVEEMF 112


>UniRef50_Q0RLI8 Cluster: Putative uncharacterized protein; n=2;
           Frankia alni ACN14a|Rep: Putative uncharacterized
           protein - Frankia alni (strain ACN14a)
          Length = 764

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTT++ V +    R E+++    + + P+ V   +DG  L GDAA  +    P+ 
Sbjct: 5   LGIDLGTTFTAVAIGWPDRREMVSLGNRSIVAPTVVYAGRDGHLLTGDAADRRALREPDR 64

Query: 461 TVFDAKRLIG 490
              + KR +G
Sbjct: 65  AAREFKRRLG 74


>UniRef50_A2DQX2 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 1008

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 21/80 (26%), Positives = 45/80 (56%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTT 448
           + +V+GID+G     +GV     V++++N   NR+TP+ V ++ +  R  G+ +    + 
Sbjct: 1   MSSVVGIDIGNKNCVLGVPSTHGVDVVSNQSSNRLTPTMVTYSNE-RRYAGELSFQHQSE 59

Query: 449 NPENTVFDAKRLIGREWSDQ 508
             ++T+ + K LIG ++  +
Sbjct: 60  FYKSTITNLKHLIGLKYDSE 79


>UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 605

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEI-IANDQGNRITPSYVAFTQDGER-LIGDAAKNQLTTN 451
           V GIDLGTT S +G Y   +  + +     ++ TPS V +    E+ +I   +   +   
Sbjct: 4   VFGIDLGTTNSSIGYYDVNKQSVEVIKFNNDKFTPSVVYYPAKSEQDIICGVSATMMNKR 63

Query: 452 PENTVFDAKRLIGR 493
            +N +++AKR IGR
Sbjct: 64  SKNIIYEAKRFIGR 77


>UniRef50_UPI0000498B17 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 543

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 32/83 (38%), Positives = 45/83 (54%)
 Frame = +2

Query: 260 DKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQ 439
           +KD+   +GIDLGTT+S      NGR  I  ++       S VAFT   + L+G   K  
Sbjct: 4   EKDV-VYVGIDLGTTFSSACEIINGRPFIYKSEFERDSIRSCVAFT-GSQCLVGTNDK-- 59

Query: 440 LTTNPENTVFDAKRLIGREWSDQ 508
              + +NT+F+ KRLIG+  S Q
Sbjct: 60  ---SGKNTIFEVKRLIGKRMSSQ 79


>UniRef50_Q7QSV2 Cluster: GLP_127_4161_1624; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_127_4161_1624 - Giardia lamblia ATCC
           50803
          Length = 845

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/83 (26%), Positives = 41/83 (49%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           I  D G +Y+   V +   ++++ +D  NR+ PS V++T +  R +GD    Q T+N   
Sbjct: 4   IAFDFGNSYAVASVPRARGIDLVLSDTSNRLIPSCVSYTSE-RRFMGDMGIGQRTSNRRA 62

Query: 461 TVFDAKRLIGREWSDQLYNMMLS 529
             F+   L+  ++       +LS
Sbjct: 63  CFFNLPMLLNEDFGSHAVQRVLS 85


>UniRef50_P38788 Cluster: Ribosome-associated complex subunit SSZ1;
           n=12; Saccharomycetales|Rep: Ribosome-associated complex
           subunit SSZ1 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 538

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           VIGI  G T S +  +     V++IAN  G R  PS +++  + E   G  A  QL  NP
Sbjct: 5   VIGITFGNTSSSIAYINPKNDVDVIANPDGERAIPSALSYVGEDE-YHGGQALQQLIRNP 63

Query: 455 ENTVFDAKRLIG 490
           +NT+ + +  IG
Sbjct: 64  KNTIINFRDFIG 75


>UniRef50_A0W7A3 Cluster: Heat shock protein, HSP70 family; n=4;
           Desulfuromonadales|Rep: Heat shock protein, HSP70 family
           - Geobacter lovleyi SZ
          Length = 425

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 17/106 (16%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIA---NDQGNRITPSYVAFTQDGE---------RLIG 421
           V GID GTT S + +Y NG VE++A    D+   +  S + F +D E         + +G
Sbjct: 4   VFGIDFGTTNSALSIYHNGTVEVVAVDGTDRSGELMRSVLYFNEDNEIFAGNEAVRQYVG 63

Query: 422 DAAKNQ----LTTNPENTVFDAKRLIGREWS-DQLYNMMLSSSPSR 544
           D A  +    + T   NT FD+  + G+ ++ D L  ++L    +R
Sbjct: 64  DGAAGRFMQSIKTFLPNTSFDSTEIFGKRYAIDDLVAIILRQIKAR 109


>UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_226_13599_12049 - Giardia lamblia
           ATCC 50803
          Length = 516

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 24/75 (32%), Positives = 44/75 (58%)
 Frame = -3

Query: 511 QLVTPFTTNQTLGIKDSVFRVGSKLVFGSITN*TFTILSEGHV*RCDAVSLVIGNDFYTS 332
           ++V P  T+Q LG++D + R+   LV G + + T  I  EG V      +L+IG+D +  
Sbjct: 429 RVVEP-ATDQALGVEDGILRIEGALVLGGVADETLCI-REGDVGGRGVRALLIGDDLHFF 486

Query: 331 IFVDTDT*VSGTQID 287
           + ++ +  VSG+++D
Sbjct: 487 VLINANAGVSGSEVD 501


>UniRef50_Q9TX41 Cluster: 200 kDa wall antigen; n=1; Cryptosporidium
           parvum|Rep: 200 kDa wall antigen - Cryptosporidium
           parvum
          Length = 41

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/26 (69%), Positives = 23/26 (88%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEII 349
           G +IGIDLGTTYSCVGV++N  V+I+
Sbjct: 6   GQLIGIDLGTTYSCVGVWRNDTVDIV 31


>UniRef50_Q7M080 Cluster: DnaK-type molecular chaperone; n=1;
           Cricetulus griseus|Rep: DnaK-type molecular chaperone -
           Cricetulus griseus (Chinese hamster)
          Length = 137

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 434 NQLTTNPENTVFDAKRLIGREWSD 505
           NQLT+NPENTVFDAK LIGR W+D
Sbjct: 1   NQLTSNPENTVFDAK-LIGRTWND 23


>UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila
           auraria|Rep: LAC ORF protein - Drosophila auraria (Fruit
           fly)
          Length = 613

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 26/75 (34%), Positives = 41/75 (54%)
 Frame = -3

Query: 505 VTPFTTNQTLGIKDSVFRVGSKLVFGSITN*TFTILSEGHV*RCDAVSLVIGNDFYTSIF 326
           V    +++ LG+K  V  V   LV G + + T  +  E HV    AV+LV+G+D + S+ 
Sbjct: 532 VVVLASDEALGVKHRVPGVHRHLVLGRVADQTLGVC-ECHVGGRGAVALVVGDDLHLSML 590

Query: 325 VDTDT*VSGTQIDTD 281
           VD    V G Q+D++
Sbjct: 591 VDAHAGVRGAQVDSN 605


>UniRef50_A2F7Z8 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 707

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 18/68 (26%), Positives = 37/68 (54%)
 Frame = +2

Query: 284 GIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENT 463
           G+D G  Y  VG+ ++  + ++ +   NR+ P+   +++   R+ G  A+ ++  N E T
Sbjct: 6   GLDFGNKYCVVGIPQSRSISVLLDQASNRLIPTMAGYSEK-RRVFGTLAQQEILQNLEGT 64

Query: 464 VFDAKRLI 487
           +   KRL+
Sbjct: 65  ITQLKRLV 72


>UniRef50_Q5KHV7 Cluster: Heat shock protein HSP60, putative; n=2;
           Filobasidiella neoformans|Rep: Heat shock protein HSP60,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 601

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 2/88 (2%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVY-KNGRVEIIANDQGNRITPSYVAFTQDGERL-IGDAAKNQLTT 448
           +V+GI+ G +Y+ + V  K G    IAN++G R     +++   GE++ IG+ A   L  
Sbjct: 5   SVLGINFGQSYASIAVIDKEGHPTCIANEEGERQIACAISYA--GEQVYIGNGAMPHLVK 62

Query: 449 NPENTVFDAKRLIGREWSDQLYNMMLSS 532
           N +NT+   + L+G  + +  +  +L++
Sbjct: 63  NGKNTIMGFRNLLGHTYDEVDHTAILTA 90


>UniRef50_UPI000049A5F3 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 629

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 24/82 (29%), Positives = 41/82 (50%)
 Frame = +2

Query: 242 RRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIG 421
           R  ++K K   ++IGID G     +G Y NG V+II +  G     + ++  +   R   
Sbjct: 2   RTSQQKGKQRYSIIGIDFGNENIVIGKYYNGGVDIIDSPIGKHSISNCISCIKKEIRCGV 61

Query: 422 DAAKNQLTTNPENTVFDAKRLI 487
           D  ++Q+   P+N +   K+LI
Sbjct: 62  DRNESQIKRRPKNCIIGLKKLI 83


>UniRef50_UPI0000510557 Cluster: COG0443: Molecular chaperone; n=1;
           Brevibacterium linens BL2|Rep: COG0443: Molecular
           chaperone - Brevibacterium linens BL2
          Length = 340

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 29/75 (38%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKN-GRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           ++IGIDLGTT S V      G    IA   G+R  PS V F    E  IG  AK+     
Sbjct: 2   SIIGIDLGTTNSAVAATDAMGITTTIAARDGSRTLPSAVYFEPSDEVSIGARAKSMAVME 61

Query: 452 PENTVFDAKRLIGRE 496
           PE      KR +G +
Sbjct: 62  PERVAMLFKRGMGEK 76


>UniRef50_A2E5D4 Cluster: DnaK protein; n=3; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 668

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           KD    +GID G   + V    N  +++  N    R++P+ V++  D  R  GD A+   
Sbjct: 2   KDSIHCVGIDFGNQNAIVAANTNENIKVCLNPSSTRLSPTLVSY-GDERRFFGDLAQQNQ 60

Query: 443 TTNPENTVFDAKRLIGREW 499
             N  +T+   K+LIG ++
Sbjct: 61  LENINSTITCLKKLIGLKY 79


>UniRef50_Q9Y4L1 Cluster: Hypoxia up-regulated protein 1 precursor;
           n=39; Deuterostomia|Rep: Hypoxia up-regulated protein 1
           precursor - Homo sapiens (Human)
          Length = 999

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           D   V+ +DLG+    V + K G  +EI+ N +  R TP  V   ++ ER  GD+A +  
Sbjct: 31  DTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-KENERFFGDSAASMA 89

Query: 443 TTNPENTVFDAKRLIGRE 496
             NP+ T+   + L+G++
Sbjct: 90  IKNPKATLRYFQHLLGKQ 107


>UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock
           cognate 71 kDa protein (Heat shock 70 kDa protein 8);
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           Heat shock cognate 71 kDa protein (Heat shock 70 kDa
           protein 8) - Canis familiaris
          Length = 393

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           VQ D+K +PF VV    +P VQV+     K F PEE+S+MVL
Sbjct: 23  VQSDMKHWPFMVVNDAGRPKVQVEYKGKTKSFYPEELSSMVL 64


>UniRef50_A2E1V3 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 600

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 22/76 (28%), Positives = 37/76 (48%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           I +DLG  +S     +   V+I+ ++   R+ PS + FT D     G  A +    N + 
Sbjct: 6   ISLDLGNKFSVAAAPRENGVDILQSETFERLIPSVLGFT-DRRLHFGQMAADYQNQNLDG 64

Query: 461 TVFDAKRLIGREWSDQ 508
           T+ + K LIG +W  +
Sbjct: 65  TITNTKSLIGLKWDSE 80


>UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188;
           Bacteria|Rep: Chaperone protein hscA - Yersinia pestis
          Length = 650

 Score = 31.5 bits (68), Expect(2) = 0.006
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +2

Query: 347 IANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           + N++   + PS V +   G   +G  A+N    +P NT+   KR++GR  +D
Sbjct: 78  LINEKQRDLLPSVVHYHPQGID-VGWKARNLAALDPVNTISSVKRMMGRSLAD 129



 Score = 30.7 bits (66), Expect(2) = 0.006
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +2

Query: 284 GIDLGTTYSCVGVYKNGRVEIIANDQ 361
           GIDLGTT S V   ++G+ + +A++Q
Sbjct: 23  GIDLGTTNSLVATVRSGKAQTLADEQ 48


>UniRef50_A2G573 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 621

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 4/90 (4%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL----IGDAAKNQLTT 448
           +GIDLGT+ S V  Y  G+        G+   PS V   +D        +G   K+ +  
Sbjct: 4   VGIDLGTSNS-VCAYFIGKRSDRVQFGGDYYLPSLVCIEKDQNNKTSFSLGSTIKDYMVN 62

Query: 449 NPENTVFDAKRLIGREWSDQLYNMMLSSSP 538
           +PE   + +KRLIGR+++D      + + P
Sbjct: 63  HPERVAYGSKRLIGRKFNDPYVQNFIKTCP 92


>UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma
           marginale str. St. Maries|Rep: Heat shock protein -
           Anaplasma marginale (strain St. Maries)
          Length = 602

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +2

Query: 284 GIDLGTTYSCVGVY-KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           GIDLGTT S + V   +G V++  +  G  + PS V +T+DG   +G  A      NP  
Sbjct: 19  GIDLGTTNSLIAVVGHDGGVKVFEDPAGRSLIPSIVEYTRDGVVKVGHDA------NPLR 72

Query: 461 TVFDAKRLIGR 493
            +   KRL+G+
Sbjct: 73  ALRSTKRLMGK 83


>UniRef50_A0DJC4 Cluster: Chromosome undetermined scaffold_53, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_53,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 817

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 24/70 (34%), Positives = 38/70 (54%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGID G+  S +     G V+++ N+  +R T + V FT + ER IG+    Q  +N +N
Sbjct: 7   IGIDFGSQRSVIAAALKGGVKVLDNEGSHRETQNVVGFTVE-ERFIGEQGALQQKSNFKN 65

Query: 461 TVFDAKRLIG 490
           +V    R +G
Sbjct: 66  SVAFFNRFLG 75


>UniRef50_A1FNI8 Cluster: Glutamate dehydrogenase; n=1; Pseudomonas
           putida W619|Rep: Glutamate dehydrogenase - Pseudomonas
           putida W619
          Length = 710

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 24/74 (32%), Positives = 36/74 (48%)
 Frame = -3

Query: 487 NQTLGIKDSVFRVGSKLVFGSITN*TFTILSEGHV*RCDAVSLVIGNDFYTSIFVDTDT* 308
           ++ L  +  V RVG  L  G + N  F I+  GH  R    +  + +D   ++F + D  
Sbjct: 632 DEALHCEQCVVRVGDGLALGRLANQDFAIIGVGHDRRGGTRTFGVFDDLDVTVFQNGDAR 691

Query: 307 VSGTQIDTDYCADV 266
           V G Q+DTD  A V
Sbjct: 692 VGGPQVDTDDFAHV 705


>UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 527

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 2/75 (2%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDA-AKNQLT 445
           G  +G+DLGTTYS +  +  +G+   + N     ITPS V   ++G  ++G +  +  + 
Sbjct: 6   GHTVGVDLGTTYSAIAQLDSDGQPISLKNTDDRSITPSVVLLGEEGRVVVGPSFERTAIE 65

Query: 446 TNPENTVFDAKRLIG 490
            +P   +   KR +G
Sbjct: 66  DDPSRIIEAVKRHMG 80


>UniRef50_Q9M7S4 Cluster: Heat shock protein 70; n=1; Triticum
           aestivum|Rep: Heat shock protein 70 - Triticum aestivum
           (Wheat)
          Length = 130

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 30/95 (31%), Positives = 43/95 (45%)
 Frame = +1

Query: 265 GHRHSNRYRFGYHLLMCRCLQKWTCRNHCQ*PGKPHHTFIRGLHSRW*TFNW*CCQKPAY 444
           GHRH  R+    HLL+ R +     R+H Q PG+PHH  +R LH R    +  C +    
Sbjct: 40  GHRHRPRH----HLLVRRRVAARPRRDHRQRPGQPHHALVRRLH-RLGASHRRCAKNQVA 94

Query: 445 YQP*KHCL*CQASDWS*ME*PTVQHDVKFFPFKVV 549
             P              +  P  Q D+K +P+KV+
Sbjct: 95  MNPINTVFDANVLSAEGLLMP-CQSDIKMWPYKVI 128


>UniRef50_Q4RRT3 Cluster: Chromosome 16 SCAF15002, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 16 SCAF15002, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 52

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 19/35 (54%), Positives = 24/35 (68%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPS 382
           V+ I LGTTYSCVGV++ G+VEI A      + PS
Sbjct: 2   VVAIGLGTTYSCVGVFQRGKVEIRAAGPHPAMLPS 36


>UniRef50_Q9SKY8 Cluster: 70kD heat shock protein; n=6;
           Magnoliophyta|Rep: 70kD heat shock protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 563

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE- 457
           +GID+GT+   + V+   +V I+ N +  ++  S+V F    + +      NQL    E 
Sbjct: 31  LGIDIGTSQCSIAVWNGSQVHILRNTRNQKLIKSFVTFK---DEVPAGGVSNQLAHEQEM 87

Query: 458 ---NTVFDAKRLIGREWSD 505
                +F+ KRL+GR  +D
Sbjct: 88  LTGAAIFNMKRLVGRVDTD 106


>UniRef50_A5N5I8 Cluster: DnaK4; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK4 - Clostridium kluyveri DSM 555
          Length = 604

 Score = 40.7 bits (91), Expect = 0.029
 Identities = 35/103 (33%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGID GTTYS V  +   + EI     G    PS V F Q G+  +G+ A  +    PE
Sbjct: 10  VIGIDFGTTYSSVSKWDGKKAEIYGK-MGEYAIPSVVYFKQ-GKFDVGNGALAKGIFYPE 67

Query: 458 NTVFDAKRLI--GREWSDQLYNMMLSSSPSRSLKRTANLMFKY 580
           N +   K +I  G+E        +L  +   +LK   +++FKY
Sbjct: 68  NYISGIKGIIACGQE-------TVLLDNREFTLKDICSVIFKY 103


>UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM
           555|Rep: DnaK7 - Clostridium kluyveri DSM 555
          Length = 496

 Score = 40.7 bits (91), Expect = 0.029
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +2

Query: 260 DKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLI-GDAAKN 436
           D     VIGIDLGTT+S +  +     E   + +G R+  S V + +   + I G+ A  
Sbjct: 4   DAQNSPVIGIDLGTTFSSIARWTGEEAETY-SPKGERMIRSVVYYDEKNSKYIFGNTAFM 62

Query: 437 QLTTNPENTVFDAKRLI 487
               NP+N +   KRL+
Sbjct: 63  SGILNPDNVIVGVKRLM 79


>UniRef50_Q9UQC1 Cluster: Heat shock protein 72; n=10; Fungi/Metazoa
           group|Rep: Heat shock protein 72 - Homo sapiens (Human)
          Length = 151

 Score = 40.7 bits (91), Expect = 0.029
 Identities = 19/38 (50%), Positives = 24/38 (63%)
 Frame = +1

Query: 523 VKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +K +PF+V+    KP VQV      K F PEEIS+MVL
Sbjct: 1   MKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVL 38


>UniRef50_UPI000049A5EA Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 557

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 2/45 (4%)
 Frame = +2

Query: 281 IGIDLGTTYSCVG--VYKNGRVEIIANDQGNRITPSYVAFTQDGE 409
           +GID GTTYS +G  V K G++ II +D  +R  PS +  + +GE
Sbjct: 7   VGIDFGTTYSSIGYCVGKTGKINIIQDDNSSRFIPSTIEIS-NGE 50


>UniRef50_Q8RH06 Cluster: Putative uncharacterized protein FN0115;
           n=2; Bacteria|Rep: Putative uncharacterized protein
           FN0115 - Fusobacterium nucleatum subsp. nucleatum
          Length = 98

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 27/71 (38%), Positives = 36/71 (50%)
 Frame = -1

Query: 465 TVFSGLVVSWFLAASPIKRSPS*VKATYEGVMRFPWSLAMISTRPFL*TPTHE*VVPKSI 286
           TV  G V +   A SP   SP  +  T +GV+  P    +I   P   T T E VVPKSI
Sbjct: 5   TVEVGFVTACLFAISPTTTSPLSLIFTTDGVVLAPSEFGIIVALPPSITATQEFVVPKSI 64

Query: 285 PITVPMSLSFS 253
           PI + +  S++
Sbjct: 65  PIILLILSSYN 75


>UniRef50_A2EFJ4 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 719

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 1/76 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIAND-QGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           +GID GTT SC       R E       G    P+ + + +D E+ I      +L     
Sbjct: 9   VGIDFGTTNSCAYFVSQNREETTPIPINGKNFAPTNLTYVEDEEQPIACVDTTRLVYPAG 68

Query: 458 NTVFDAKRLIGREWSD 505
           N + + KR+IG++ +D
Sbjct: 69  NCIHNIKRIIGKKLND 84


>UniRef50_Q6CM78 Cluster: Similarities with sp|Q12355 Saccharomyces
           cerevisiae YDR055w PST1; n=1; Kluyveromyces lactis|Rep:
           Similarities with sp|Q12355 Saccharomyces cerevisiae
           YDR055w PST1 - Kluyveromyces lactis (Yeast) (Candida
           sphaerica)
          Length = 207

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 20/36 (55%), Positives = 24/36 (66%)
 Frame = -3

Query: 493 TTNQTLGIKDSVFRVGSKLVFGSITN*TFTILSEGH 386
           TTNQ+LG K SVF V + L     TN TFT+LSE +
Sbjct: 147 TTNQSLGSKQSVFWVNNSLTLSWNTNQTFTVLSESN 182


>UniRef50_A1XM67 Cluster: Heat shock protein Hsp70-6; n=1;
           Blastocladiella emersonii|Rep: Heat shock protein
           Hsp70-6 - Blastocladiella emersonii (Aquatic fungus)
          Length = 605

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 25/79 (31%), Positives = 39/79 (49%)
 Frame = +2

Query: 302 TYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKR 481
           T++ +      R EIIAN+ G R  P+ VA     E + G AAK Q+  N   TV     
Sbjct: 68  TFTLLPAEAGQRGEIIANEDGERQIPAIVAIA-GSEEIAGTAAKAQMIRNMVGTVRRFVP 126

Query: 482 LIGREWSDQLYNMMLSSSP 538
           L+G +++D   +    ++P
Sbjct: 127 LVGLKFADPKVDAAAKATP 145


>UniRef50_Q98BE0 Cluster: DnaK-type molecular chaperone; DnaK; n=2;
           Rhizobiales|Rep: DnaK-type molecular chaperone; DnaK -
           Rhizobium loti (Mesorhizobium loti)
          Length = 418

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = +2

Query: 284 GIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFT-QDGERLIGDAAKNQLTTNPEN 460
           GID GT+ S VGV +NG+  ++A + G    PS V F  +DG    G  A    T + E 
Sbjct: 7   GIDFGTSNSTVGVVRNGQPHLVALEGGQVTLPSAVFFNFEDGRICFGRQAIANYTDSVEG 66

Query: 461 TVF-DAKRLIG 490
            +    K ++G
Sbjct: 67  RLMRSLKSVLG 77


>UniRef50_Q1D082 Cluster: DnaK family protein; n=2;
           Cystobacterineae|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 1293

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 2/73 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRIT--PSYVAFTQDGERLIGDAAKNQLTTN 451
           V+GIDLGT+++ V V ++G  ++I    G   T  P+ +A    G+ ++G  A+ +    
Sbjct: 774 VLGIDLGTSHARVAVVQDGTPKLIPL-PGTTTTDLPALIAVNGTGDLVVGATAQTEGQRA 832

Query: 452 PENTVFDAKRLIG 490
           P   +   KRL+G
Sbjct: 833 PRRAISGLKRLLG 845


>UniRef50_O46067 Cluster: CG2918-PA; n=3; Diptera|Rep: CG2918-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 923

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           V+ +DLG+ +  VGV   G  +EI  N +  R TP+ +AF +DG R IG+ A+     +P
Sbjct: 22  VMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAF-RDGTRTIGEDAQTIGIKDP 80

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSP 538
            +       L+G+   + + ++     P
Sbjct: 81  NSAYGYLLDLLGKTIDNPIVDLYRKRFP 108


>UniRef50_Q805J2 Cluster: Heat shock protein 70-like protein; n=139;
           Crinivirus|Rep: Heat shock protein 70-like protein -
           Strawberry pallidosis associated virus
          Length = 556

 Score = 39.1 bits (87), Expect = 0.088
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +G+D GTT+S +  Y N ++ ++  +    I P+ +A + D + +IG AA+   ++   N
Sbjct: 6   VGLDFGTTFSTISSYINNKMHVLKINDSPYI-PTCLAISIDKDVIIGGAAQVLDSSEVAN 64

Query: 461 TVF-DAKRLIG 490
             F D KR +G
Sbjct: 65  CYFYDLKRWVG 75


>UniRef50_Q9VSI1 Cluster: CG7182-PA; n=2; Sophophora|Rep: CG7182-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 513

 Score = 39.1 bits (87), Expect = 0.088
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +2

Query: 284 GIDLGTTYSCVG-VYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           GI +G +  C+  V  +G+ E+IAN QG+R++ + + +    E   G  AK ++   P  
Sbjct: 6   GIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANRPRQ 65

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSS 535
            V  + +L+  +  ++L    LSS+
Sbjct: 66  AVAHSFQLL--QPKEELTEEKLSSA 88


>UniRef50_Q86JV8 Cluster: Similar to heat shock protein; n=2;
           Dictyostelium discoideum|Rep: Similar to heat shock
           protein - Dictyostelium discoideum (Slime mold)
          Length = 926

 Score = 39.1 bits (87), Expect = 0.088
 Identities = 26/87 (29%), Positives = 42/87 (48%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLG+    V + K G  E + N+Q  R T S V + +D ERL    + +    NP+
Sbjct: 28  VIGIDLGSQTFKVSLIKPGAFETVLNEQSGRKTISSVGWFKD-ERLFSSDSFSVWARNPK 86

Query: 458 NTVFDAKRLIGREWSDQLYNMMLSSSP 538
                 +  +G ++ + L   + +  P
Sbjct: 87  QNYNLIQAFLGIKYKEGLVEEISNGLP 113


>UniRef50_A2FYV4 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 728

 Score = 39.1 bits (87), Expect = 0.088
 Identities = 17/39 (43%), Positives = 26/39 (66%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAF 394
           VIGID+G+     G+++   VE+I N+Q  R+T + VAF
Sbjct: 14  VIGIDIGSETIKAGIFRKKIVEVILNEQSKRLTDALVAF 52


>UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13;
           Rickettsiales|Rep: Heat shock protein Hsp70 - Ehrlichia
           canis (strain Jake)
          Length = 618

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 1/86 (1%)
 Frame = +2

Query: 251 EEKDKDIGTVIGIDLGTTYSCVGVYKN-GRVEIIANDQGNRITPSYVAFTQDGERLIGDA 427
           E K  +     GIDLGTT S + +  N G+  I +++ G  + PS V++  +      + 
Sbjct: 8   EPKTNENTLAFGIDLGTTNSLISMIDNEGKTIIFSDENGRFLIPSTVSYINNQV----EV 63

Query: 428 AKNQLTTNPENTVFDAKRLIGREWSD 505
            KN    + +NT+   KRL+G+   D
Sbjct: 64  GKNY---SNDNTISSIKRLMGKSIKD 86


>UniRef50_A2F6W8 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 682

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 11/94 (11%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGR-VEIIANDQGNRITPSYVA----------FTQDGERLIG 421
           T++ ID+G+ +  +     G+ VEII N    R+TPS ++          +++  +R IG
Sbjct: 12  TIVAIDIGSEHMAIAAISQGKHVEIIMNQFSKRLTPSIISLQSNLPLSAEYSESVDRKIG 71

Query: 422 DAAKNQLTTNPENTVFDAKRLIGREWSDQLYNMM 523
             A  QL  N  + + +  + IGR   ++L  ++
Sbjct: 72  VYAIPQLERNSSSVIRNFPQTIGRICDEKLDTLL 105


>UniRef50_A2DAR6 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 749

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGR-VEIIANDQGNRITPSYVAFTQDGE 409
           +  +D G+ +  +   K GR VEI+ NDQ +R TP+Y+A+  D +
Sbjct: 13  IYSLDFGSKFVRLAKQKPGRQVEIVTNDQSSRHTPNYLAYISDSD 57


>UniRef50_Q8SWH2 Cluster: Similarity to HSP70-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: Similarity to
           HSP70-RELATED PROTEIN - Encephalitozoon cuniculi
          Length = 687

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 2/69 (2%)
 Frame = +2

Query: 239 CRRQEEKDKDIGTVIGIDLGTTYSCVGVY--KNGRVEIIANDQGNRITPSYVAFTQDGER 412
           C   ++ D      +GIDLGTTYSC+ VY   +     + +  G    PS V F +  E 
Sbjct: 19  CGAPKDTDLRESVAVGIDLGTTYSCISVYSPSSKDTRFVLSPGGEETYPSVVYFKKLPE- 77

Query: 413 LIGDAAKNQ 439
             GD  K++
Sbjct: 78  --GDGKKSK 84


>UniRef50_UPI000049A3E9 Cluster: 70 kDa heat shock protein; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: 70 kDa heat shock
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 674

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 3/75 (4%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL---IGDAAKNQLTTN 451
           +GIDLGTT   V   ++G    I         PS+++ +     L   IG+AAKN + ++
Sbjct: 9   VGIDLGTTCCYVACIEDGNEPKILLMNNEDYLPSWISLSNVKNGLGVIIGEAAKNNIHSH 68

Query: 452 PENTVFDAKRLIGRE 496
                +D+KRL+GR+
Sbjct: 69  CVG--YDSKRLVGRK 81


>UniRef50_A6FX30 Cluster: Chaperone protein DnaK; n=1; Plesiocystis
           pacifica SIR-1|Rep: Chaperone protein DnaK -
           Plesiocystis pacifica SIR-1
          Length = 1056

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLI-GDAAKNQLTTNP 454
           V+ +DLG++     +  +GR E++         P+ +    DGERL+ GDAA+    T P
Sbjct: 15  VLVVDLGSSRCRAALVIDGRPEVLDWADFGGTLPTVIGL--DGERLVFGDAARRLAITEP 72

Query: 455 ENTVFDAKRLIG 490
              VF A R+ G
Sbjct: 73  RAQVFAAPRMAG 84


>UniRef50_A5VT75 Cluster: Putative NAD-specific glutamate
           dehydrogenase encoded in antisense gene pair with dnaKJ;
           n=1; Brucella ovis ATCC 25840|Rep: Putative NAD-specific
           glutamate dehydrogenase encoded in antisense gene pair
           with dnaKJ - Brucella ovis (strain ATCC 25840 / 63/290 /
           NCTC 10512)
          Length = 1124

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 25/71 (35%), Positives = 32/71 (45%)
 Frame = -3

Query: 493 TTNQTLGIKDSVFRVGSKLVFGSITN*TFTILSEGHV*RCDAVSLVIGNDFYTSIFVDTD 314
           T NQ L  K   FRVG  L    +T+  F  + EG   R  A +  I ND       D +
Sbjct: 604 TANQALDGKKGAFRVGDGLTLRRLTSEAFVTIGEGDDRRGGACTFCIFNDLRVLSVHDGN 663

Query: 313 T*VSGTQIDTD 281
             V  +QIDT+
Sbjct: 664 AGVGRSQIDTN 674


>UniRef50_A2UL28 Cluster: Glutamate dehydrogenase; n=5;
           Enterobacteriaceae|Rep: Glutamate dehydrogenase -
           Escherichia coli B
          Length = 678

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 24/70 (34%), Positives = 34/70 (48%)
 Frame = -3

Query: 487 NQTLGIKDSVFRVGSKLVFGSITN*TFTILSEGHV*RCDAVSLVIGNDFYTSIFVDTDT* 308
           NQ    K  V RV   L F  +TN +FTIL  G+  R  A++  +     +    +  T 
Sbjct: 593 NQAFNRKQGVLRVCHCLTFSRLTNQSFTILGIGNDRRRGAIAFGVLQHARSGAIHNRYTR 652

Query: 307 VSGTQIDTDY 278
           V  TQ+DT+Y
Sbjct: 653 VGSTQVDTNY 662


>UniRef50_A2XF45 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 59

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +2

Query: 260 DKDIGTVIGIDLGTTYSCVGVYKN 331
           +K  G  IGIDLGTTYSCVGV+++
Sbjct: 4   NKGEGPAIGIDLGTTYSCVGVWQH 27


>UniRef50_Q22758 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 925

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +2

Query: 287 IDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENT 463
           IDLGT +  +G+ K G  ++I  N +  R TP+ V   QDG R   DAA       P   
Sbjct: 29  IDLGTQFLKIGIVKPGIPMDIALNTESRRKTPN-VVMIQDGHRTFADAAIGMQVRYPHLV 87

Query: 464 VFDAKRLIGR 493
                 L+G+
Sbjct: 88  HGQLNDLVGK 97


>UniRef50_A2F432 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 629

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 5/82 (6%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYV--AFTQDGERL---IGDAAKNQL 442
           ++GIDLGT+ +     +NG  EI+    G  + PSY+   + +D + +   +G   ++  
Sbjct: 7   IVGIDLGTSNTSCTFEQNGSPEIL-RFNGASLLPSYIFEQYDEDKKNISNAMGPTIRDLA 65

Query: 443 TTNPENTVFDAKRLIGREWSDQ 508
            +  +  +F AKRL+GR +  +
Sbjct: 66  ASYNKKLLFGAKRLLGRNFDHE 87


>UniRef50_UPI00004999A1 Cluster: 70 kDa heat shock protein; n=4;
           Entamoeba histolytica HM-1:IMSS|Rep: 70 kDa heat shock
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 672

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 3/73 (4%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGR---VEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           IGIDLGTTYS + +Y       VE++         PS+V   + G+ L           N
Sbjct: 13  IGIDLGTTYSSIAIYSENETNPVEVLQISNNEFSIPSWVEIFKGGDGLKKYNVGLIAKKN 72

Query: 452 PENTVFDAKRLIG 490
               + D+KRLIG
Sbjct: 73  GGICLHDSKRLIG 85


>UniRef50_A4ZIR9 Cluster: Heat shock protein 70; n=12;
           Closterovirus|Rep: Heat shock protein 70 - Grapevine
           leafroll-associated virus 2
          Length = 599

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 2/73 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V G+D GTT+S V VYK+GRV     +    I      F+   +   G  A++ +  +  
Sbjct: 3   VFGLDFGTTFSTVCVYKDGRVYSFKQNNSAYIPTYLYLFSNSNDMTFGYEAESLMHNSKV 62

Query: 458 NTVF--DAKRLIG 490
              F  D KR +G
Sbjct: 63  RGSFYRDLKRWVG 75


>UniRef50_A1R9R9 Cluster: Putative DnaK family protein; n=1;
           Arthrobacter aurescens TC1|Rep: Putative DnaK family
           protein - Arthrobacter aurescens (strain TC1)
          Length = 694

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 5/76 (6%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGR-----VEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           V+ ID+GT+++   + K  +      EI++        PS + +  DG  L+G+AA+ + 
Sbjct: 4   VLAIDVGTSFTAAALVKPQQGPAPTPEILSLGLHGSAVPSVLFYADDGRILVGEAAERRG 63

Query: 443 TTNPENTVFDAKRLIG 490
             +P+  V + KR IG
Sbjct: 64  LDDPQRMVREFKRRIG 79


>UniRef50_A0YV37 Cluster: Heat shock protein 70; n=2;
           Oscillatoriales|Rep: Heat shock protein 70 - Lyngbya sp.
           PCC 8106
          Length = 538

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEII--ANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           IG+D GTT S +  ++  ++E      + G +  PS++ + +DG   IG  A+     +P
Sbjct: 6   IGLDFGTTNSIISYWEKDQLEAFQYGGENGTKYIPSFITY-EDGFIEIGSGARTTAANHP 64

Query: 455 ENTVF 469
           E T +
Sbjct: 65  EVTSY 69


>UniRef50_Q388G4 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 861

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +2

Query: 317 GVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTV 466
           G+  +  V +IAN  G+R+TP+  AF ++ E L G+ A+      P+  V
Sbjct: 26  GIESSVPVRVIANSSGHRVTPTMAAFAENNEVLFGEDARALYARAPQVVV 75


>UniRef50_Q22E65 Cluster: DnaK protein; n=1; Tetrahymena thermophila
           SB210|Rep: DnaK protein - Tetrahymena thermophila SB210
          Length = 969

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 1/90 (1%)
 Frame = +2

Query: 245 RQEEKDKDIGTV-IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIG 421
           +Q E D+ +    +GI LG T       +      I N +      SYV+F  DG  L G
Sbjct: 448 QQREVDQKLEKYYLGIHLGNTNLYSAKKRYDTPFKIPNSENQNGILSYVSFLNDGNSLDG 507

Query: 422 DAAKNQLTTNPENTVFDAKRLIGREWSDQL 511
            + K+ +  N  +T + AKR IG ++ D +
Sbjct: 508 QSIKDLMKIN--STFYGAKRFIGMKFDDPI 535


>UniRef50_A2DZ76 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 641

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGV-YKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           + ID GTT SC+ +    G+  +     GN   P+ + F  +G   I     + L   P 
Sbjct: 7   VAIDFGTTNSCIAIALHTGQDTMPILIDGNNYVPTNLTFVDEGPP-IACFDTSSLVYTPG 65

Query: 458 NTVFDAKRLIGREWSD 505
           N++ + KR+IG+   D
Sbjct: 66  NSLHNIKRIIGKRLDD 81


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 633,424,944
Number of Sequences: 1657284
Number of extensions: 13014412
Number of successful extensions: 31376
Number of sequences better than 10.0: 293
Number of HSP's better than 10.0 without gapping: 30239
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31217
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 47296372782
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -