SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20067
         (619 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8MLT4 Cluster: CG5820-PD, isoform D; n=9; Diptera|Rep:...    84   2e-15
UniRef50_Q17EN3 Cluster: Leucine-rich transmembrane protein; n=1...    78   2e-13
UniRef50_Q4SPP9 Cluster: Chromosome 16 SCAF14537, whole genome s...    35   1.4  
UniRef50_Q9VV09 Cluster: CG4950-PA; n=2; Sophophora|Rep: CG4950-...    35   1.4  
UniRef50_Q17L59 Cluster: Kek1; n=2; Culicidae|Rep: Kek1 - Aedes ...    35   1.8  
UniRef50_UPI00015B561B Cluster: PREDICTED: similar to leucine-ri...    34   2.4  
UniRef50_UPI0000F1EFE7 Cluster: PREDICTED: hypothetical protein;...    34   3.1  
UniRef50_UPI0000E80BF7 Cluster: PREDICTED: similar to bone speci...    33   4.1  
UniRef50_UPI0000DB74EA Cluster: PREDICTED: similar to Gp150 CG58...    33   4.1  
UniRef50_UPI000065F0FE Cluster: Homolog of Homo sapiens "Leucine...    33   4.1  
UniRef50_Q9VWI6 Cluster: CG12199-PA, isoform A; n=4; Sophophora|...    33   4.1  
UniRef50_Q6WRI0 Cluster: Immunoglobulin superfamily member 10 pr...    33   5.5  
UniRef50_UPI00006A034C Cluster: Leucine-rich repeat-containing p...    33   7.2  
UniRef50_UPI0000F1EDBC Cluster: PREDICTED: similar to adlican; n...    32   9.5  
UniRef50_Q112R7 Cluster: Putative uncharacterized protein; n=1; ...    32   9.5  
UniRef50_Q17LD1 Cluster: Kek1; n=1; Aedes aegypti|Rep: Kek1 - Ae...    32   9.5  

>UniRef50_Q8MLT4 Cluster: CG5820-PD, isoform D; n=9; Diptera|Rep:
           CG5820-PD, isoform D - Drosophila melanogaster (Fruit
           fly)
          Length = 1076

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query: 256 NEDRPCPRDCICSVS-QGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK 432
           +ED PCPR C C+ +   Y  A CS L++G QKFG DI DLVV N  P+YPI +    F+
Sbjct: 253 SEDVPCPRFCQCARNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQ 312

Query: 433 KLGLHQVATVKIVNSTIGYI 492
            LGL  VA++KI N T+ Y+
Sbjct: 313 NLGLKNVASIKIANCTLEYL 332


>UniRef50_Q17EN3 Cluster: Leucine-rich transmembrane protein; n=1;
           Aedes aegypti|Rep: Leucine-rich transmembrane protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 945

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query: 271 CPRDCICSVSQ-GYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFKKLGLH 447
           CPRDCIC  +   Y  A CS L++ TQKF   I DL V +  P+YPI L    FK++GL 
Sbjct: 212 CPRDCICERNMHAYLVATCSRLDLDTQKFSTSITDLQVLDVGPKYPIVLSAEFFKQIGLS 271

Query: 448 QVATVKIVNSTIGYIAP 498
            V ++KI N TI YI+P
Sbjct: 272 HVVSIKISNCTIEYISP 288



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           ISP  F G+ DLY+VNL+N+ +  LHP+TFA
Sbjct: 286 ISPSAFAGLDDLYSVNLTNSGIDMLHPDTFA 316


>UniRef50_Q4SPP9 Cluster: Chromosome 16 SCAF14537, whole genome
           shotgun sequence; n=2; cellular organisms|Rep:
           Chromosome 16 SCAF14537, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 838

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 13/30 (43%), Positives = 23/30 (76%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           I+P+ F G+ +L  V+L +N+L+ +HP+TF
Sbjct: 170 INPEAFYGLTNLQLVHLESNHLQQIHPDTF 199


>UniRef50_Q9VV09 Cluster: CG4950-PA; n=2; Sophophora|Rep: CG4950-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 597

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           I P+ F  +  +  VNLSNN L  +HP+TFA
Sbjct: 228 IQPEVFRNMRRIKEVNLSNNRLIFIHPDTFA 258


>UniRef50_Q17L59 Cluster: Kek1; n=2; Culicidae|Rep: Kek1 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 1091

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 2/76 (2%)
 Frame = +1

Query: 271 CPRDCICSVSQGYRQAKCSFLEIGT--QKFGDDILDLVVENADPRYPINLDDFMFKKLGL 444
           CP  C+C  S G + A C+ L I +       ++  LV+ + +  Y +N ++  F  LGL
Sbjct: 379 CPASCVCKWSSGKKSALCNNLTISSIPSNLSTELQVLVLNDNNIAY-LNREE--FTSLGL 435

Query: 445 HQVATVKIVNSTIGYI 492
             +  + + +S + Y+
Sbjct: 436 GNLQKIHLKHSRVKYV 451


>UniRef50_UPI00015B561B Cluster: PREDICTED: similar to leucine-rich
           transmembrane protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to leucine-rich transmembrane protein
           - Nasonia vitripennis
          Length = 887

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 12/25 (48%), Positives = 19/25 (76%)
 Frame = +2

Query: 503 FPGVHDLYAVNLSNNNLKSLHPETF 577
           F G+ +L+ VNL+ N L ++HP+TF
Sbjct: 224 FDGLKELFVVNLTRNGLTNIHPDTF 248


>UniRef50_UPI0000F1EFE7 Cluster: PREDICTED: hypothetical protein;
           n=2; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 348

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +2

Query: 485 VISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           VI    F G+H L+ ++LS N L+ +HPE F+
Sbjct: 116 VIQSCAFCGLHRLHLLDLSRNRLEDVHPEAFS 147


>UniRef50_UPI0000E80BF7 Cluster: PREDICTED: similar to bone specific
           CMF608; n=2; Gallus gallus|Rep: PREDICTED: similar to
           bone specific CMF608 - Gallus gallus
          Length = 1817

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           ++P  F G+  L  V+L  N LK LHP+TF
Sbjct: 179 VNPNAFYGLTSLRLVHLEGNLLKQLHPDTF 208


>UniRef50_UPI0000DB74EA Cluster: PREDICTED: similar to Gp150
           CG5820-PD, isoform D; n=1; Apis mellifera|Rep:
           PREDICTED: similar to Gp150 CG5820-PD, isoform D - Apis
           mellifera
          Length = 886

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 12/30 (40%), Positives = 21/30 (70%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           ++   F G+  L++VNL+ N+L+ +HP TF
Sbjct: 265 LNQTAFDGIPYLFSVNLTRNDLQDIHPNTF 294


>UniRef50_UPI000065F0FE Cluster: Homolog of Homo sapiens
           "Leucine-rich repeat-containing protein 15 precursor;
           n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens
           "Leucine-rich repeat-containing protein 15 precursor -
           Takifugu rubripes
          Length = 924

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           I+P+ F G+ DL  ++LS NNL SL  E F
Sbjct: 35  IAPKMFEGLSDLQVIDLSRNNLGSLAAELF 64


>UniRef50_Q9VWI6 Cluster: CG12199-PA, isoform A; n=4;
           Sophophora|Rep: CG12199-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 931

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           + F G+H L  ++LS N ++ LHP TFA
Sbjct: 117 EAFKGLHILIELDLSGNRIRELHPGTFA 144


>UniRef50_Q6WRI0 Cluster: Immunoglobulin superfamily member 10
           precursor; n=20; Mammalia|Rep: Immunoglobulin
           superfamily member 10 precursor - Homo sapiens (Human)
          Length = 2623

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 14/30 (46%), Positives = 20/30 (66%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           I+P+ F G++ L  V+L  N L  LHP+TF
Sbjct: 144 INPEVFYGLNFLRLVHLEGNQLTKLHPDTF 173


>UniRef50_UPI00006A034C Cluster: Leucine-rich repeat-containing
           protein 15 precursor (hLib).; n=3; Xenopus
           tropicalis|Rep: Leucine-rich repeat-containing protein
           15 precursor (hLib). - Xenopus tropicalis
          Length = 549

 Score = 32.7 bits (71), Expect = 7.2
 Identities = 12/31 (38%), Positives = 21/31 (67%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           ++ + F G+H L  +NL  N+L+SL  +TF+
Sbjct: 431 LNKEMFSGIHQLKELNLEKNDLRSLQDDTFS 461


>UniRef50_UPI0000F1EDBC Cluster: PREDICTED: similar to adlican; n=1;
           Danio rerio|Rep: PREDICTED: similar to adlican - Danio
           rerio
          Length = 1903

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           I PQ F G+  L  ++L  N L+ LHP TF+
Sbjct: 137 IHPQAFLGLTSLRLLHLEANRLQQLHPHTFS 167


>UniRef50_Q112R7 Cluster: Putative uncharacterized protein; n=1;
           Trichodesmium erythraeum IMS101|Rep: Putative
           uncharacterized protein - Trichodesmium erythraeum
           (strain IMS101)
          Length = 723

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%)
 Frame = +3

Query: 75  EVKEFATTWGQGPGSYYCSWQHAR---WYSANLSIKPSRKTKTPTTYW 209
           +++E+  TW Q  G+Y  + ++ R   W+ A  SI+ SR    P  +W
Sbjct: 226 QIQEWQKTWNQAEGNYQQTQEYLREEEWHQA--SIEASRLLSVPNVHW 271


>UniRef50_Q17LD1 Cluster: Kek1; n=1; Aedes aegypti|Rep: Kek1 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 815

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPET 574
           I+PQ F G+  L+A+ L+ N L  L P+T
Sbjct: 219 IAPQAFEGLTSLHALKLNGNQLSELRPKT 247


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 590,498,307
Number of Sequences: 1657284
Number of extensions: 11428338
Number of successful extensions: 32745
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 31465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32738
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44807090004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -