SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B4C3D Cluster: PREDICTED: similar to huntingtin...   112   6e-24
UniRef50_Q177T5 Cluster: Huntingtin interacting protein; n=2; Cu...   107   3e-22
UniRef50_UPI0000D561B1 Cluster: PREDICTED: similar to CG1716-PA;...   102   6e-21
UniRef50_Q9BYW2 Cluster: Histone-lysine N-methyltransferase SETD...   100   6e-20
UniRef50_Q071D9 Cluster: Huntingtin interacting protein B; n=5; ...    95   1e-18
UniRef50_Q9VYD1 Cluster: Probable histone-lysine N-methyltransfe...    68   2e-10
UniRef50_Q4RI17 Cluster: Chromosome 8 SCAF15044, whole genome sh...    64   3e-09
UniRef50_Q29G04 Cluster: GA14357-PA; n=1; Drosophila pseudoobscu...    62   1e-08
UniRef50_Q5C1K8 Cluster: SJCHGC03501 protein; n=1; Schistosoma j...    38   0.21 
UniRef50_Q8R898 Cluster: Putative uncharacterized protein; n=1; ...    34   2.6  
UniRef50_Q4A5U2 Cluster: Putative uncharacterized protein; n=1; ...    34   3.4  
UniRef50_Q044M9 Cluster: Ribonuclease BN-like family enzyme; n=2...    34   3.4  
UniRef50_Q23WQ9 Cluster: Putative uncharacterized protein; n=1; ...    34   3.4  
UniRef50_Q239U1 Cluster: Neurohypophysial hormones, N-terminal D...    34   3.4  
UniRef50_O97234 Cluster: Putative uncharacterized protein MAL3P2...    34   3.4  
UniRef50_A0CUZ0 Cluster: Chromosome undetermined scaffold_29, wh...    33   4.5  
UniRef50_UPI00006CB13E Cluster: hypothetical protein TTHERM_0061...    33   6.0  
UniRef50_Q11V40 Cluster: Possible ATP-dependent RNA helicase; n=...    33   7.9  
UniRef50_Q5CVZ3 Cluster: Putative uncharacterized protein; n=2; ...    33   7.9  

>UniRef50_UPI00015B4C3D Cluster: PREDICTED: similar to huntingtin
            interacting protein; n=1; Nasonia vitripennis|Rep:
            PREDICTED: similar to huntingtin interacting protein -
            Nasonia vitripennis
          Length = 1778

 Score =  112 bits (270), Expect = 6e-24
 Identities = 51/76 (67%), Positives = 61/76 (80%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
            LNPYR SD   GRIT T DFKHLARKLTHFV+ KELKHC+SV+EL   D+V+ KAK FV+
Sbjct: 1702 LNPYRKSDCKQGRITNTDDFKHLARKLTHFVLAKELKHCKSVDELECNDNVKHKAKDFVR 1761

Query: 193  KYMAKFGPVYKRPPEE 240
            KYM+KFG VY++  +E
Sbjct: 1762 KYMSKFGAVYQKGTDE 1777


>UniRef50_Q177T5 Cluster: Huntingtin interacting protein; n=2;
            Culicidae|Rep: Huntingtin interacting protein - Aedes
            aegypti (Yellowfever mosquito)
          Length = 2367

 Score =  107 bits (256), Expect = 3e-22
 Identities = 50/81 (61%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +1

Query: 7    EHLNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHC-RSVEELVVTDSVRSKAKT 183
            +HL  YR      GRIT T DFKHLARKLTHFV++KELKHC  ++ EL VTDSVR+KA+ 
Sbjct: 2281 QHLGAYRKDSCQTGRITNTEDFKHLARKLTHFVLVKELKHCDNTINELEVTDSVRTKARE 2340

Query: 184  FVKKYMAKFGPVYKRPPEEAD 246
            F+KKYMAK G +Y R   E D
Sbjct: 2341 FIKKYMAKHGTIYVRGDNEPD 2361


>UniRef50_UPI0000D561B1 Cluster: PREDICTED: similar to CG1716-PA; n=1;
            Tribolium castaneum|Rep: PREDICTED: similar to CG1716-PA
            - Tribolium castaneum
          Length = 1470

 Score =  102 bits (245), Expect = 6e-21
 Identities = 45/78 (57%), Positives = 60/78 (76%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
            LN YR  D   GRIT T DFKHLARKLTHFVMLKE+KH   +++LV T++V++KAK +++
Sbjct: 1392 LNAYRKPDCKEGRITNTDDFKHLARKLTHFVMLKEMKHIEKIDDLVCTENVKAKAKEYIR 1451

Query: 193  KYMAKFGPVYKRPPEEAD 246
            KYM+KFG  Y++  +E D
Sbjct: 1452 KYMSKFGENYQKRNDEPD 1469


>UniRef50_Q9BYW2 Cluster: Histone-lysine N-methyltransferase SETD2;
            n=32; Eumetazoa|Rep: Histone-lysine N-methyltransferase
            SETD2 - Homo sapiens (Human)
          Length = 2564

 Score = 99.5 bits (237), Expect = 6e-20
 Identities = 46/78 (58%), Positives = 57/78 (73%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
            LNPYR  D   GRIT T DFKHLARKLTH VM KELK+C++ E+L   ++V+ K K ++K
Sbjct: 2486 LNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIK 2545

Query: 193  KYMAKFGPVYKRPPEEAD 246
            KYM KFG VYK P E+ +
Sbjct: 2546 KYMQKFGAVYK-PKEDTE 2562


>UniRef50_Q071D9 Cluster: Huntingtin interacting protein B; n=5;
           Euteleostomi|Rep: Huntingtin interacting protein B -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 369

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 45/78 (57%), Positives = 56/78 (71%)
 Frame = +1

Query: 13  LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
           LNPYR  D   GRI+ T DFKHLARKLTH VM KELK C++ E+L   ++V+ K K ++K
Sbjct: 291 LNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKSCKNPEDLECNENVKHKTKEYIK 350

Query: 193 KYMAKFGPVYKRPPEEAD 246
           KYM KFG VY RP E+ +
Sbjct: 351 KYMQKFGSVY-RPKEDTE 367


>UniRef50_Q9VYD1 Cluster: Probable histone-lysine N-methyltransferase
            CG1716; n=2; Drosophila melanogaster|Rep: Probable
            histone-lysine N-methyltransferase CG1716 - Drosophila
            melanogaster (Fruit fly)
          Length = 2313

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 31/76 (40%), Positives = 46/76 (60%), Gaps = 1/76 (1%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCR-SVEELVVTDSVRSKAKTFV 189
            L PYR      GRIT   D+K L  +L++ +  KE+++C  S   L  T+SV+ K+  F+
Sbjct: 2236 LRPYRKESCTLGRITSDEDYKFLVNRLSYHITTKEMRYCEVSGNPLSCTESVKHKSYDFI 2295

Query: 190  KKYMAKFGPVYKRPPE 237
             +YM + GPVYK+P E
Sbjct: 2296 NQYMRQKGPVYKKPAE 2311


>UniRef50_Q4RI17 Cluster: Chromosome 8 SCAF15044, whole genome shotgun
            sequence; n=3; Tetraodontidae|Rep: Chromosome 8
            SCAF15044, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1625

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAK 180
            LNPYR  D  +GRI+ T DFKHLARKLTH VM KELK C + E+L   +   ++ +
Sbjct: 1514 LNPYRKPDCKSGRISNTEDFKHLARKLTHGVMNKELKACTNPEDLECNEKCEAQGQ 1569


>UniRef50_Q29G04 Cluster: GA14357-PA; n=1; Drosophila
            pseudoobscura|Rep: GA14357-PA - Drosophila pseudoobscura
            (Fruit fly)
          Length = 2388

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +1

Query: 7    EHLNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCR-SVEELVVTDSVRSKAKT 183
            + L P+R      GRIT  A +K L ++LT  ++ KE+++C  S   L+  DSV+ K+  
Sbjct: 2311 DFLRPFRKDSCQMGRITSDAAYKFLIKRLTEHIITKEMRYCEMSGHPLICNDSVKHKSHE 2370

Query: 184  FVKKYMAKFGPVYKRPPE 237
            F+ +YM K G VY  P +
Sbjct: 2371 FINQYMLKKGRVYVMPAD 2388


>UniRef50_Q5C1K8 Cluster: SJCHGC03501 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC03501 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 238

 Score = 37.9 bits (84), Expect = 0.21
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 11/86 (12%)
 Frame = +1

Query: 4   HEHLNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCR-------SVEELVVT-- 156
           H  L  +R +    GRI    D  +L +KL   V+LKE++          S+   V+T  
Sbjct: 82  HNTLRSFRDARCKLGRIVNDEDLYYLTKKLAQAVILKEIQKFHQTQAANTSLFSTVLTPE 141

Query: 157 --DSVRSKAKTFVKKYMAKFGPVYKR 228
              +VRS+   +V++YM   G  Y+R
Sbjct: 142 LPSTVRSRVTAYVRRYMESKGAFYRR 167


>UniRef50_Q8R898 Cluster: Putative uncharacterized protein; n=1;
           Thermoanaerobacter tengcongensis|Rep: Putative
           uncharacterized protein - Thermoanaerobacter
           tengcongensis
          Length = 192

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = -3

Query: 551 YTKDLLSFTLNHYKKYFHLLHSILNEGKIYKKAIIIHWKILQSIFFVQNNYKSSF 387
           +T  ++SFT  ++  Y ++    LN+ K YKK I++  K L   FF   N ++ F
Sbjct: 27  FTILIISFTFKYF--YPNIFFLFLNQFKEYKKTIVLFIKFLTLAFFTYGNIETVF 79


>UniRef50_Q4A5U2 Cluster: Putative uncharacterized protein; n=1;
           Mycoplasma synoviae 53|Rep: Putative uncharacterized
           protein - Mycoplasma synoviae (strain 53)
          Length = 483

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 19/66 (28%), Positives = 36/66 (54%)
 Frame = -1

Query: 571 NNSYMSYIRRIFYLSH*IITKNIFICFILF*TKAKFTKRLSSSIGKFFNQFSLFKIITSL 392
           NNS++++++RIF ++   I KN+ I  ++F        +  ++  K FN     KI+  L
Sbjct: 205 NNSFINHLQRIFVVTP--IYKNLIIFALIFVFALMIAHKFFANKNKIFNSVIRNKILKHL 262

Query: 391 VFNLIL 374
           V N ++
Sbjct: 263 VQNFLM 268


>UniRef50_Q044M9 Cluster: Ribonuclease BN-like family enzyme; n=2;
           Lactobacillus|Rep: Ribonuclease BN-like family enzyme -
           Lactobacillus gasseri (strain ATCC 33323 / DSM 20243)
          Length = 307

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 16/43 (37%), Positives = 27/43 (62%)
 Frame = -3

Query: 545 KDLLSFTLNHYKKYFHLLHSILNEGKIYKKAIIIHWKILQSIF 417
           K  L+ T N   ++F LL   +++G+I + +III + +L SIF
Sbjct: 2   KSFLNQTKNRITEFFQLLSKYISQGEINQTSIIIAYYVLLSIF 44


>UniRef50_Q23WQ9 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 107

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = -3

Query: 524 LNHYKKYFHLLHSILNEGKIY--KKAIIIHWKILQSIFFVQNNYKSSFQSHTSNEVKIVD 351
           L++YK+   LL +  NE K Y    +  I  KI  +IFF  NN+ S+F  H S EV  +D
Sbjct: 40  LHNYKQR-QLLKTFWNERKRYYCNNSQKIVCKIRGNIFF--NNHNSAFDKHFSLEVSCID 96

Query: 350 SH 345
           S+
Sbjct: 97  SN 98


>UniRef50_Q239U1 Cluster: Neurohypophysial hormones, N-terminal
           Domain containing protein; n=6; Tetrahymena thermophila
           SB210|Rep: Neurohypophysial hormones, N-terminal Domain
           containing protein - Tetrahymena thermophila SB210
          Length = 1874

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 3/47 (6%)
 Frame = -3

Query: 407 NNYKSSFQSHTS---NEVKIVDSHRALARCVERCDVCCHMTLTCTNC 276
           NN K  FQ H +   N +  +   R  A CVE CD+C   +  C+ C
Sbjct: 166 NNIKVQFQQHVTQYGNSLYGILKLRVWANCVENCDICLD-SANCSKC 211


>UniRef50_O97234 Cluster: Putative uncharacterized protein
           MAL3P2.13; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein MAL3P2.13 - Plasmodium
           falciparum (isolate 3D7)
          Length = 1446

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = -2

Query: 594 YIDFDLHLITLTCHIYEGSFIFHIESLQKIFSSASFYFKRRQNLQK-GYHHPLENSSINF 418
           +++FD  +  L C  Y      H+ +   I S   F  K+++  +K  Y+ P +N SI +
Sbjct: 759 HVNFDFFIKILECKTYNYMAASHVFTFYNILSYYLFDIKKKKKREKNSYYIPFQNKSIKY 818

Query: 417 L 415
           +
Sbjct: 819 M 819


>UniRef50_A0CUZ0 Cluster: Chromosome undetermined scaffold_29, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_29,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1554

 Score = 33.5 bits (73), Expect = 4.5
 Identities = 24/89 (26%), Positives = 42/89 (47%)
 Frame = -3

Query: 566 LLHVIYTKDLLSFTLNHYKKYFHLLHSILNEGKIYKKAIIIHWKILQSIFFVQNNYKSSF 387
           LL ++    L+ + +N+Y +YF+ L   L    ++KK     W+I  S+  + N   +S 
Sbjct: 212 LLPLLILGMLIFYIINNYNQYFNSLQLKL----LFKKEFTSIWQIKYSLIKLMNKDLNSQ 267

Query: 386 QSHTSNEVKIVDSHRALARCVERCDVCCH 300
            S    +  I   HR+  + V +C  C H
Sbjct: 268 YSEIIIKSLIASDHRSNCKDV-KCCYCGH 295


>UniRef50_UPI00006CB13E Cluster: hypothetical protein
           TTHERM_00616590; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00616590 - Tetrahymena
           thermophila SB210
          Length = 991

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 16/60 (26%), Positives = 32/60 (53%)
 Frame = -2

Query: 600 LFYIDFDLHLITLTCHIYEGSFIFHIESLQKIFSSASFYFKRRQNLQKGYHHPLENSSIN 421
           +F+I+F   +I L  H Y+   ++ IE   KIF ++ ++ +    LQ+ +   +E +  N
Sbjct: 733 IFFIEFLQQIIILFKHTYQSGILYIIEKCVKIFQNSKYHEQFIPYLQQAFETLVETTLQN 792


>UniRef50_Q11V40 Cluster: Possible ATP-dependent RNA helicase; n=1;
           Cytophaga hutchinsonii ATCC 33406|Rep: Possible
           ATP-dependent RNA helicase - Cytophaga hutchinsonii
           (strain ATCC 33406 / NCIMB 9469)
          Length = 439

 Score = 32.7 bits (71), Expect = 7.9
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = -3

Query: 560 HVIYTKDLLSFTLNHYKKYFHLLHSILNEGKIYKKAII 447
           HV+ T DL  F + +YK   +LL+ ++ +  IYKK ++
Sbjct: 210 HVLSTVDLQLFKVPNYKTKLNLLNLMMRDYDIYKKVVV 247


>UniRef50_Q5CVZ3 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 139

 Score = 32.7 bits (71), Expect = 7.9
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = +3

Query: 273 ITISTRQCHVTANVTSFDTSRQCSV*IHYFNFIRSMRLKTRLVIILNKEN*LKNFPMDDD 452
           IT + R+   T+N+ S  +S  C + +   +F+R   L    V  L+KE  +KN+P  D 
Sbjct: 8   ITSNLRRAMETSNLISKRSSENCKICV--LDFVREKALYISDVPCLSKEEIIKNYPKADI 65

Query: 453 SLFVNFAF 476
           S   +  F
Sbjct: 66  SFLPDTNF 73


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 602,133,185
Number of Sequences: 1657284
Number of extensions: 12071273
Number of successful extensions: 31289
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 30109
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31277
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 48955894634
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -