SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P62701 Cluster: 40S ribosomal protein S4, X isoform; n=...   158   1e-37
UniRef50_P41042 Cluster: 40S ribosomal protein S4; n=38; Eukaryo...   154   2e-36
UniRef50_P49204 Cluster: 40S ribosomal protein S4-2; n=55; Eukar...   138   1e-31
UniRef50_UPI000065EA48 Cluster: similar to 40S ribosomal protein...   133   2e-31
UniRef50_UPI00005A08FF Cluster: PREDICTED: similar to 40S riboso...   122   8e-27
UniRef50_UPI00006CBCC9 Cluster: Ribosomal family S4e containing ...   118   1e-25
UniRef50_UPI0000499069 Cluster: 40S ribosomal protein S4; n=2; E...   116   4e-25
UniRef50_UPI0000D9EB72 Cluster: PREDICTED: similar to 40S riboso...   114   2e-24
UniRef50_Q9XG32 Cluster: 40S ribosomal protein S4; n=1; Guillard...   113   3e-24
UniRef50_A2ECC6 Cluster: 40S ribosomal protein S4-C, putative; n...   111   2e-23
UniRef50_Q7KJQ3 Cluster: 40S ribosomal protein S4; n=9; Eukaryot...   100   7e-20
UniRef50_Q8SRB9 Cluster: 40S RIBOSOMAL PROTEIN S4; n=1; Encephal...    83   5e-15
UniRef50_P62428 Cluster: 30S ribosomal protein S4e; n=12; Euryar...    67   4e-10
UniRef50_Q8TW18 Cluster: 30S ribosomal protein S4e; n=1; Methano...    66   6e-10
UniRef50_A5UL76 Cluster: Ribosomal protein S4e; n=2; Methanobact...    61   3e-08
UniRef50_Q8ZTD3 Cluster: 30S ribosomal protein S4e; n=4; Pyrobac...    60   4e-08
UniRef50_Q56230 Cluster: 30S ribosomal protein S4e; n=3; Thermop...    58   3e-07
UniRef50_A1RWS3 Cluster: Ribosomal protein S4E, central; n=1; Th...    56   8e-07
UniRef50_O05634 Cluster: 30S ribosomal protein S4e; n=5; Sulfolo...    55   1e-06
UniRef50_A3H986 Cluster: Ribosomal protein S4E; n=1; Caldivirga ...    55   2e-06
UniRef50_Q9YF85 Cluster: 30S ribosomal protein S4e; n=4; Desulfu...    55   2e-06
UniRef50_UPI000038E22A Cluster: hypothetical protein Faci_030011...    54   2e-06
UniRef50_P62429 Cluster: 30S ribosomal protein S4e; n=1; Nanoarc...    51   2e-05
UniRef50_Q0W1X6 Cluster: 30S ribosomal protein S4E; n=2; Euryarc...    50   4e-05
UniRef50_A2SPL4 Cluster: Ribosomal protein S4E, central; n=1; Me...    48   2e-04
UniRef50_Q673R6 Cluster: Ribosomal protein S4; n=2; environmenta...    48   3e-04
UniRef50_Q8PV38 Cluster: 30S ribosomal protein S4e; n=4; Euryarc...    48   3e-04
UniRef50_Q40941 Cluster: 40S ribosomal protein S4; n=2; Bigelowi...    46   6e-04
UniRef50_A3CT09 Cluster: Ribosomal protein S4E, central; n=3; Me...    46   9e-04
UniRef50_Q12ZT9 Cluster: Ribosomal protein S4E; n=1; Methanococc...    46   0.001
UniRef50_P22510 Cluster: 30S ribosomal protein S4E; n=6; Halobac...    39   0.098
UniRef50_Q6L1B5 Cluster: 30S ribosomal protein S4e; n=1; Picroph...    38   0.17 
UniRef50_Q7U147 Cluster: PROBABLE OXIDASE; n=7; Mycobacterium tu...    35   1.6  
UniRef50_Q890E3 Cluster: Acetyltransferase (GNAT) family; n=1; L...    35   2.1  
UniRef50_Q293C6 Cluster: GA20855-PA; n=1; Drosophila pseudoobscu...    34   2.8  
UniRef50_Q5UP36 Cluster: Cysteinyl-tRNA synthetase; n=1; Acantha...    34   3.7  
UniRef50_A6E8K7 Cluster: Putative uncharacterized protein; n=1; ...    33   4.9  
UniRef50_Q00TF1 Cluster: Chromosome 17 contig 1, DNA sequence; n...    33   4.9  
UniRef50_Q57WH1 Cluster: Putative uncharacterized protein; n=6; ...    33   4.9  
UniRef50_A0HHE0 Cluster: Putative uncharacterized protein precur...    33   8.5  

>UniRef50_P62701 Cluster: 40S ribosomal protein S4, X isoform;
           n=137; Eukaryota|Rep: 40S ribosomal protein S4, X
           isoform - Homo sapiens (Human)
          Length = 263

 Score =  158 bits (383), Expect = 1e-37
 Identities = 77/134 (57%), Positives = 89/134 (66%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDV+SI+KT E FRLIYD KGRF +HRITPEEAKYKLCKV+++ 
Sbjct: 71  KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K +P+LVTHD RTIRYPDPLIKV       L+  ++        G           G
Sbjct: 131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RIGVITNRERHPGS 204



 Score =  135 bits (327), Expect = 8e-31
 Identities = 62/75 (82%), Positives = 67/75 (89%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYALTG+E
Sbjct: 1   MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  QR IK+ GK
Sbjct: 61  VKKICMQRFIKIDGK 75



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DFIKF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 152 PLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>UniRef50_P41042 Cluster: 40S ribosomal protein S4; n=38;
           Eukaryota|Rep: 40S ribosomal protein S4 - Drosophila
           melanogaster (Fruit fly)
          Length = 261

 Score =  154 bits (374), Expect = 2e-36
 Identities = 75/134 (55%), Positives = 87/134 (64%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTDPTYPAG+MDV+++EKT E FRL+YDVKGRF IHRI+ EEAKYKLCKVK+  
Sbjct: 71  KVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQ 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G K VP+LVTHDGRTIRYPDPLI         +   ++        G           G
Sbjct: 131 LGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLG 190

Query: 609 VWAPSCSRERHPGS 650
                 +RERHPGS
Sbjct: 191 RVGTVVNRERHPGS 204



 Score =  138 bits (334), Expect = 1e-31
 Identities = 65/75 (86%), Positives = 68/75 (90%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKHLKRL APKAWMLDKLGGV+APRPSTGPHKLRE LPL+IFLRNRLKYAL G E
Sbjct: 1   MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KIV QRL+KV GK
Sbjct: 61  VTKIVMQRLVKVDGK 75



 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 41/62 (66%), Positives = 48/62 (77%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P   + DS+Q+DIA+ KI D+IKF+SGNLCMITGGRNLGRVGT+V        FDIVHIK
Sbjct: 152 PLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIK 211

Query: 671 DS 676
           DS
Sbjct: 212 DS 213


>UniRef50_P49204 Cluster: 40S ribosomal protein S4-2; n=55;
           Eukaryota|Rep: 40S ribosomal protein S4-2 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 262

 Score =  138 bits (334), Expect = 1e-31
 Identities = 71/132 (53%), Positives = 83/132 (62%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVRTD TYPAGFMDVVSI KTNE FRL+YD KGRF +H I  EEAK+KLCKV+ +  G
Sbjct: 73  DGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFG 132

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWGVW 614
            K +PYL T+DGRTIRYPDPLIK        L+  ++        G  V        G  
Sbjct: 133 QKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRV 192

Query: 615 APSCSRERHPGS 650
               +RE+H GS
Sbjct: 193 GVIKNREKHKGS 204



 Score =  122 bits (295), Expect = 6e-27
 Identities = 56/75 (74%), Positives = 64/75 (85%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARG KKHLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPLV+ +RNRLKYALT  E
Sbjct: 1   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V+ I+ QR I+V GK
Sbjct: 61  VISILMQRHIQVDGK 75



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 30/63 (47%), Positives = 43/63 (68%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+I+LD+   KI++FIKF+ GN+ M+TGGRN GRVG I    +    F+ +HI+
Sbjct: 152 PLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQ 211

Query: 671 DST 679
           DST
Sbjct: 212 DST 214


>UniRef50_UPI000065EA48 Cluster: similar to 40S ribosomal protein
           S4, X isoform (LOC126235), mRNA; n=1; Takifugu
           rubripes|Rep: similar to 40S ribosomal protein S4, X
           isoform (LOC126235), mRNA - Takifugu rubripes
          Length = 291

 Score =  133 bits (322), Expect = 3e-30
 Identities = 61/74 (82%), Positives = 66/74 (89%)
 Frame = +1

Query: 43  ARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEV 222
           ARGPKKHLKR+ APK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYALTG+EV
Sbjct: 2   ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEV 61

Query: 223 LKIVKQRLIKVMGK 264
            KI  QR IK+ GK
Sbjct: 62  KKICMQRFIKIDGK 75



 Score = 89.4 bits (212), Expect(2) = 2e-31
 Identities = 41/50 (82%), Positives = 44/50 (88%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAK 398
           K DGKVRTD TYP GFMDV+SI+KT E FRLIYDVKGRFT+HRIT EEAK
Sbjct: 71  KIDGKVRTDITYPTGFMDVISIDKTGEHFRLIYDVKGRFTVHRITAEEAK 120



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D++++D+ T KI DFIKF++ N+CM+TGG NLGR+G I         FD+VH+K
Sbjct: 184 PLIKVNDTVRIDLDTGKITDFIKFDTSNMCMVTGGANLGRIGVITNRERHPGSFDVVHVK 243

Query: 671 DST 679
           DST
Sbjct: 244 DST 246



 Score = 69.7 bits (163), Expect(2) = 2e-31
 Identities = 36/85 (42%), Positives = 44/85 (51%)
 Frame = +3

Query: 396 KYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGT 575
           +YKLCKVK++  G K +P+LVTHD RTIRYPDPLIKV       L   ++          
Sbjct: 152 QYKLCKVKKILIGTKGIPHLVTHDARTIRYPDPLIKVNDTVRIDLDTGKITDFIKFDTSN 211

Query: 576 CV*SREAVTWGVWAPSCSRERHPGS 650
                     G      +RERHPGS
Sbjct: 212 MCMVTGGANLGRIGVITNRERHPGS 236


>UniRef50_UPI00005A08FF Cluster: PREDICTED: similar to 40S ribosomal
           protein S4, X isoform; n=3; Eutheria|Rep: PREDICTED:
           similar to 40S ribosomal protein S4, X isoform - Canis
           familiaris
          Length = 240

 Score =  122 bits (294), Expect = 8e-27
 Identities = 56/75 (74%), Positives = 62/75 (82%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MA  P+KHLK + APK WMLDKL GV+AP PSTGPHKLRECLPL+IFLRNRLKYALTG+E
Sbjct: 1   MAHSPRKHLKHVAAPKHWMLDKLTGVFAPHPSTGPHKLRECLPLIIFLRNRLKYALTGDE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V KI  Q  IK+ GK
Sbjct: 61  VKKIRMQHFIKMDGK 75



 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 47/101 (46%), Positives = 58/101 (57%)
 Frame = +3

Query: 348 DVKGRFTIHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*T 527
           D KGRF +HRITPEEAKYKL KV+++  G K +P+LVTHD RTIRYPDPLIK+       
Sbjct: 76  DTKGRFAVHRITPEEAKYKLGKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKMNDTIQID 135

Query: 528 LQLRRLWTSSSLSPGTCV*SREAVTWGVWAPSCSRERHPGS 650
           L+  ++        G           G      +RE HPGS
Sbjct: 136 LETGKITDFFKFDTGNLCMVTGGTNLGRIGVITNRENHPGS 176



 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 32/62 (51%), Positives = 43/62 (69%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+IQ+D+ T KI DF KF++GNLCM+TGG NLGR+G I         FD+VH+K
Sbjct: 124 PLIKMNDTIQIDLETGKITDFFKFDTGNLCMVTGGTNLGRIGVITNRENHPGSFDVVHVK 183

Query: 671 DS 676
           D+
Sbjct: 184 DA 185


>UniRef50_UPI00006CBCC9 Cluster: Ribosomal family S4e containing
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ribosomal family S4e containing protein - Tetrahymena
           thermophila SB210
          Length = 370

 Score =  118 bits (284), Expect = 1e-25
 Identities = 60/136 (44%), Positives = 79/136 (58%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVR D  YP G MDVV IEKT++ FR++YD KGRF +  ++ EEAKYKL KV   A G
Sbjct: 185 DGKVRRDKGYPTGLMDVVRIEKTDQSFRILYDTKGRFVLKSLSKEEAKYKLLKVTAKAIG 244

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWGVW 614
           P  +PY+VTHD RTIR+P+P IK+       L   ++   + L  G     ++    G  
Sbjct: 245 PNQIPYIVTHDSRTIRFPNPEIKIGDTLKYDLVNNKIENFAHLESGNVCYIQQGNNIGRV 304

Query: 615 APSCSRERHPGSSTLC 662
                 E+H GS  +C
Sbjct: 305 GIIQHIEKHQGSFDIC 320



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 45/105 (42%), Positives = 58/105 (55%), Gaps = 31/105 (29%)
 Frame = +1

Query: 43  ARGPKKHLKRLNAPKAWMLDKLGG-------------------------VYAPRPSTGP- 144
           ARGPKKHLKR+NAPK+WML+KLGG                         +Y  + +T P 
Sbjct: 83  ARGPKKHLKRINAPKSWMLNKLGGIWVITFFAFRLRKNDFITTIPKLKFIYFKKQATRPS 142

Query: 145 ---HKLRECLPLVIFLRNRLKYALTGNEVLKIV--KQRLIKVMGK 264
              HKLRE LPL + L+ RL YAL G +V  I+  K++ + V GK
Sbjct: 143 QGPHKLRESLPLSVLLKERLNYALNGRDVTLILNDKEQNVFVDGK 187



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 25/62 (40%), Positives = 36/62 (58%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+++ D+   KI +F   ESGN+C I  G N+GRVG I    +    FDI H+K
Sbjct: 264 PEIKIGDTLKYDLVNNKIENFAHLESGNVCYIQQGNNIGRVGIIQHIEKHQGSFDICHVK 323

Query: 671 DS 676
           D+
Sbjct: 324 DA 325


>UniRef50_UPI0000499069 Cluster: 40S ribosomal protein S4; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: 40S ribosomal
           protein S4 - Entamoeba histolytica HM-1:IMSS
          Length = 326

 Score =  116 bits (280), Expect = 4e-25
 Identities = 51/75 (68%), Positives = 59/75 (78%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGP+ HLKRLNAP  WML KLGG +AP+PS GPH ++ECLPL++ LRNRL YAL G E
Sbjct: 1   MARGPRHHLKRLNAPHHWMLSKLGGTFAPKPSHGPHGMKECLPLILILRNRLNYALNGRE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V  IVK R IK+ GK
Sbjct: 61  VTMIVKNRTIKIDGK 75



 Score =  111 bits (267), Expect = 2e-23
 Identities = 57/134 (42%), Positives = 76/134 (56%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGK+RTD  YP GFMDV+SI +T E FRL+Y+ K RF +  +T E+AK+KLCK+++  
Sbjct: 71  KIDGKIRTDTRYPVGFMDVLSIPRTKENFRLMYNTKRRFCLVPLTAEQAKFKLCKIEKRV 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
            G   +PY+VTHDGRTIRYP P ++        L+  ++        G           G
Sbjct: 131 LGTGAIPYIVTHDGRTIRYPHPELQANDTIKLNLETGKIVDFVKFDIGNTAMMIGGNGMG 190

Query: 609 VWAPSCSRERHPGS 650
                  RE HPGS
Sbjct: 191 RVGVIVKREVHPGS 204



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/62 (48%), Positives = 42/62 (67%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  Q+ D+I+L++ T KI+DF+KF+ GN  M+ GG  +GRVG IV        F+IVHIK
Sbjct: 152 PELQANDTIKLNLETGKIVDFVKFDIGNTAMMIGGNGMGRVGVIVKREVHPGSFEIVHIK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>UniRef50_UPI0000D9EB72 Cluster: PREDICTED: similar to 40S ribosomal
           protein S4, X isoform; n=1; Macaca mulatta|Rep:
           PREDICTED: similar to 40S ribosomal protein S4, X
           isoform - Macaca mulatta
          Length = 244

 Score =  114 bits (275), Expect = 2e-24
 Identities = 59/134 (44%), Positives = 77/134 (57%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGK+RTD   P   MDV+SI+K  E F LIY +  RF +HRITPEE KYKLCK++++ 
Sbjct: 81  KVDGKIRTDNNLPYWIMDVISIDKMGEDFCLIYGINRRFALHRITPEEVKYKLCKMRKIF 140

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWG 608
              K +P+LV HD  T+R+PD LIKV       L+  ++ T+     G          WG
Sbjct: 141 VRAKGIPHLVIHDIHTVRHPDSLIKVNDTIQIDLETGKI-TALKFDTGNLCLVTGGGNWG 199

Query: 609 VWAPSCSRERHPGS 650
                 +RERHP S
Sbjct: 200 RIGVITNRERHPVS 213



 Score =  109 bits (262), Expect = 6e-23
 Identities = 55/78 (70%), Positives = 63/78 (80%)
 Frame = +1

Query: 31  LSNMARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALT 210
           ++ +A GPK+HLKR+ A + WMLDKL GV+A RPSTGPHKLRECLP  IFLRNRLKYALT
Sbjct: 9   ITAVAFGPKQHLKRVAALQHWMLDKLTGVFAARPSTGPHKLRECLP-HIFLRNRLKYALT 67

Query: 211 GNEVLKIVKQRLIKVMGK 264
           G+EV KI  Q  IKV GK
Sbjct: 68  GDEVKKICMQWFIKVDGK 85



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 26/56 (46%), Positives = 37/56 (66%)
 Frame = +2

Query: 509 DSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIKDS 676
           D+IQ+D+ T KI   +KF++GNLC++TGG N GR+G I         FD  H+KD+
Sbjct: 168 DTIQIDLETGKITA-LKFDTGNLCLVTGGGNWGRIGVITNRERHPVSFDTFHVKDA 222


>UniRef50_Q9XG32 Cluster: 40S ribosomal protein S4; n=1; Guillardia
           theta|Rep: 40S ribosomal protein S4 - Guillardia theta
           (Cryptomonas phi)
          Length = 257

 Score =  113 bits (273), Expect = 3e-24
 Identities = 50/83 (60%), Positives = 65/83 (78%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVR D  +PAG MDV+SI+ T E +R++YD  G F +HRIT +E+ +KLCKV RV+ G
Sbjct: 73  DGKVRADKNFPAGVMDVISIKTTKENYRVLYDNVGHFFLHRITIKESMFKLCKVIRVSIG 132

Query: 435 PKNVPYLVTHDGRTIRYPDPLIK 503
            K +PY+VTHDGRTIR+P+ LIK
Sbjct: 133 SKGIPYIVTHDGRTIRFPNLLIK 155



 Score = 97.5 bits (232), Expect = 3e-19
 Identities = 44/75 (58%), Positives = 57/75 (76%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           M+RG KKH KRLNAPK W+L+KLGG++APR S+GPHK +  +PLVI +RN+LKY+    E
Sbjct: 1   MSRGIKKHYKRLNAPKKWLLNKLGGIWAPRSSSGPHKKQNSIPLVIVIRNKLKYSTNQRE 60

Query: 220 VLKIVKQRLIKVMGK 264
            L I+K+  I V GK
Sbjct: 61  SLNILKKNEIYVDGK 75



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 20/42 (47%), Positives = 30/42 (71%)
 Frame = +2

Query: 500 QSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIV 625
           +S DSI LD+   K++DFIKF  G+LC++  G N+GR+G  +
Sbjct: 155 KSNDSIVLDLLNNKVIDFIKFSIGSLCVVIKGSNIGRIGVFI 196


>UniRef50_A2ECC6 Cluster: 40S ribosomal protein S4-C, putative; n=4;
           Trichomonas vaginalis G3|Rep: 40S ribosomal protein
           S4-C, putative - Trichomonas vaginalis G3
          Length = 269

 Score =  111 bits (267), Expect = 2e-23
 Identities = 48/86 (55%), Positives = 63/86 (73%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRT+  YP G MDV+ + K+NELFR+IYD KGRF +H I  +EA +KL +V +  
Sbjct: 85  KVDGKVRTNYRYPTGLMDVIELGKSNELFRIIYDCKGRFCVHHIEAKEASFKLLRVNQFK 144

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKV 506
            G K +P++VTHDGRTI Y DP ++V
Sbjct: 145 IGAKGIPHVVTHDGRTISYVDPSVRV 170



 Score =  105 bits (252), Expect = 1e-21
 Identities = 53/88 (60%), Positives = 62/88 (70%)
 Frame = +1

Query: 1   RHEVSFSI*YLSNMARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIF 180
           R + SFS   L  M R  + HLKRL AP  W+L K  G +A  PSTGPHKLRECLP+ IF
Sbjct: 2   RRKKSFSWSVLFLMPRCQRFHLKRLTAPHHWLLAKSAGKFASHPSTGPHKLRECLPINIF 61

Query: 181 LRNRLKYALTGNEVLKIVKQRLIKVMGK 264
           LR+RLKYALT  E + IVK+RL+KV GK
Sbjct: 62  LRDRLKYALTAKEAVAIVKRRLVKVDGK 89



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 25/63 (39%), Positives = 42/63 (66%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P+ +  D+++ +I T ++   IKF+ G++ M+T G N+GRVGTI    +    FDIVH+K
Sbjct: 166 PSVRVHDALKFNIKTGEVESVIKFKVGDVAMVTAGGNVGRVGTIQKIEKQMASFDIVHLK 225

Query: 671 DST 679
           D++
Sbjct: 226 DTS 228


>UniRef50_Q7KJQ3 Cluster: 40S ribosomal protein S4; n=9;
           Eukaryota|Rep: 40S ribosomal protein S4 - Leishmania
           major
          Length = 273

 Score = 99.5 bits (237), Expect = 7e-20
 Identities = 45/67 (67%), Positives = 52/67 (77%)
 Frame = +1

Query: 55  KKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIV 234
           KKHLKRL APK WML KL GV+APRP  GPHKLRECLPL++ +RNRLKYAL   E   I+
Sbjct: 3   KKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLRECLPLLVIIRNRLKYALNAREGEMIL 62

Query: 235 KQRLIKV 255
           +Q L+ V
Sbjct: 63  RQGLVHV 69



 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 45/80 (56%), Positives = 52/80 (65%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           D   R D  YPAGFMDVV I KT + FRL+YDVKGRF +  ++  EA+ KL KV  + T 
Sbjct: 70  DNHPRRDGKYPAGFMDVVEIPKTGDRFRLMYDVKGRFALVNLSEAEAQIKLMKVVNLYTA 129

Query: 435 PKNVPYLVTHDGRTIRYPDP 494
              VP  VTHDG  IRYPDP
Sbjct: 130 TGRVPVAVTHDGHRIRYPDP 149



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/57 (36%), Positives = 32/57 (56%)
 Frame = +2

Query: 509 DSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIKDST 679
           D+I  ++   K +D IK   G   ++TGG N GR+G IV        F+I H+KD++
Sbjct: 155 DTIVYNVKEKKCVDLIKNRQGKAVIVTGGANRGRIGEIVKVECHPGAFNIAHLKDAS 211


>UniRef50_Q8SRB9 Cluster: 40S RIBOSOMAL PROTEIN S4; n=1;
           Encephalitozoon cuniculi|Rep: 40S RIBOSOMAL PROTEIN S4 -
           Encephalitozoon cuniculi
          Length = 268

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 40/84 (47%), Positives = 58/84 (69%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K +G+VRT+  +P G  DVVSIEKT E FR++Y+V  +F +HRI+ EEA Y+L KV +  
Sbjct: 71  KVNGRVRTNSHFPVGLFDVVSIEKTGEHFRVLYNVHKKFHLHRISSEEASYRLTKVTKKY 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLI 500
              + +PY+V+  G +IR+ DP I
Sbjct: 131 EN-QGIPYIVSSCGLSIRFCDPAI 153



 Score = 76.2 bits (179), Expect = 7e-13
 Identities = 35/75 (46%), Positives = 48/75 (64%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           M  G + HLKR  APK+WMLDK GG +A  P++GPHK  EC+PL   +   L+YA    E
Sbjct: 1   MPTGHRDHLKRKTAPKSWMLDKQGGTFALMPASGPHKKTECIPLGYLISRFLRYASNFKE 60

Query: 220 VLKIVKQRLIKVMGK 264
           +  I+ ++ IKV G+
Sbjct: 61  LSIILAEKNIKVNGR 75


>UniRef50_P62428 Cluster: 30S ribosomal protein S4e; n=12;
           Euryarchaeota|Rep: 30S ribosomal protein S4e -
           Methanococcus maripaludis
          Length = 244

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 31/72 (43%), Positives = 44/72 (61%)
 Frame = +1

Query: 46  RGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVL 225
           +GP+KHLKRL AP  W L +    +  RPS GPH + + LPL++ +R+ LKYA    E  
Sbjct: 4   KGPRKHLKRLAAPANWQLPRKVKTFTVRPSPGPHSMDKSLPLLLVVRDVLKYADNAREAK 63

Query: 226 KIVKQRLIKVMG 261
           KI++   I + G
Sbjct: 64  KIIQTGKILIDG 75



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKV--KRVA 428
           DG  R +  +PAG MDV+SI + +E + +++D  GR ++ +   ++   KLCK+  K V 
Sbjct: 74  DGLKRKEYKHPAGLMDVLSIPEMDETYLVLFDESGRISLKK--TDKTDVKLCKIVNKTVV 131

Query: 429 TGPKNVPYLVTHDGR 473
            G  N+  L  HDGR
Sbjct: 132 KG-GNI-QLNLHDGR 144



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 18/59 (30%), Positives = 30/59 (50%)
 Frame = +2

Query: 497 YQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIKD 673
           Y++ DS+ + I    I   + F  G L  ITGG+++G    IV     +   DIV +++
Sbjct: 161 YKTGDSVLISIPEQSIAGHVAFGEGKLAYITGGKHVGEFAKIVEVENRALYSDIVTLEN 219


>UniRef50_Q8TW18 Cluster: 30S ribosomal protein S4e; n=1;
           Methanopyrus kandleri|Rep: 30S ribosomal protein S4e -
           Methanopyrus kandleri
          Length = 260

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 1/72 (1%)
 Frame = +1

Query: 49  GPKKHLKRLNAPKAWMLD-KLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVL 225
           GPK+H+KRL AP AW +  K GG +APRP  GPH +   +PL+I +R+ L YA    E  
Sbjct: 7   GPKRHVKRLAAPYAWPIPRKEGGKFAPRPYPGPHTMDTSVPLLILVRDMLGYADYAREAR 66

Query: 226 KIVKQRLIKVMG 261
           KI+ +  I V G
Sbjct: 67  KIITRGEIYVDG 78



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 2/82 (2%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DG VR +P +P G MDVV I +T + +R++ +   R  +  I+ EEA+ K+C++K     
Sbjct: 77  DGVVRKEPKFPVGIMDVVEIPRTGDRYRVVMNEHHRLDVVPISEEEARVKVCRIKNKTYV 136

Query: 435 PKNVPYLVTHDGRT--IRYPDP 494
                 +  HDG+   +   DP
Sbjct: 137 RGGNLQITMHDGKNWLVEIEDP 158


>UniRef50_A5UL76 Cluster: Ribosomal protein S4e; n=2;
           Methanobacteriaceae|Rep: Ribosomal protein S4e -
           Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM
           861)
          Length = 242

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 29/75 (38%), Positives = 45/75 (60%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DG+V  D  +P GFMD++ I KT E++R++ D KGR  +++I  EE   KLCK+   +T 
Sbjct: 74  DGRVIKDYKFPVGFMDIIEIPKTGEVYRVLLDKKGRLQLNKI--EENDSKLCKIVNKSTI 131

Query: 435 PKNVPYLVTHDGRTI 479
                 +  HDG+ +
Sbjct: 132 KGGKIQVNLHDGKNV 146



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 23/72 (31%), Positives = 35/72 (48%)
 Frame = +1

Query: 49  GPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLK 228
           G +KHLK   APK W +      +  +PS G H +   L L + +R+ LK A    E  +
Sbjct: 5   GSRKHLKTYKAPKTWPIHPKEDTWTVKPSAGSHSIENSLSLTLVIRDILKLADNSREAKR 64

Query: 229 IVKQRLIKVMGK 264
           I+    + V G+
Sbjct: 65  IINSGNVLVDGR 76


>UniRef50_Q8ZTD3 Cluster: 30S ribosomal protein S4e; n=4;
           Pyrobaculum|Rep: 30S ribosomal protein S4e - Pyrobaculum
           aerophilum
          Length = 238

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 31/68 (45%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +1

Query: 61  HLKRLNAPKAWMLD-KLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVK 237
           HL+R  AP  W +  K GGV+  RPS GPH L   LPL + +R+ LKYA T +E   I+ 
Sbjct: 3   HLRRTLAPAWWPIPRKKGGVWVVRPSPGPHSLAYSLPLALIIRDVLKYAKTMHEARYIIS 62

Query: 238 QRLIKVMG 261
           +  +KV G
Sbjct: 63  RGYVKVDG 70



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 28/77 (36%), Positives = 40/77 (51%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DG VR D  +P G MDV+ I  T E++R++ D    + +  I+ EEA  KL +V+   
Sbjct: 67  KVDGVVRRDYKFPVGLMDVIEIVPTGEVYRVVPDADKYYNLLPISTEEAALKLLRVEGKT 126

Query: 429 TGPKNVPYLVTHDGRTI 479
                   L  HDGR +
Sbjct: 127 MVKGGRIQLHFHDGRNL 143


>UniRef50_Q56230 Cluster: 30S ribosomal protein S4e; n=3;
           Thermoplasma|Rep: 30S ribosomal protein S4e -
           Thermoplasma acidophilum
          Length = 235

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 33/86 (38%), Positives = 44/86 (51%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGK   +  +  GFMDV+ I    E +R++Y+ +G   + + T E A  KL KV+   
Sbjct: 67  KVDGKTVREKKFAVGFMDVIEIN--GESYRVVYNDQGALVLMKETKERASMKLLKVRSKV 124

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKV 506
             P N   L THDGRT    D   KV
Sbjct: 125 IAPGNRIQLGTHDGRTFITDDKSKKV 150


>UniRef50_A1RWS3 Cluster: Ribosomal protein S4E, central; n=1;
           Thermofilum pendens Hrk 5|Rep: Ribosomal protein S4E,
           central - Thermofilum pendens (strain Hrk 5)
          Length = 251

 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 27/78 (34%), Positives = 43/78 (55%)
 Frame = +1

Query: 31  LSNMARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALT 210
           +    +G  +HL+R  AP  W + +   V+  +PS GPH L   +P+ I LR+   YA T
Sbjct: 1   MGRKVKGSLRHLRRSVAPPFWPIKRKEYVWTVKPSPGPHSLLSSIPIGIVLRDVFGYAKT 60

Query: 211 GNEVLKIVKQRLIKVMGK 264
             E  +I+  R+I+V G+
Sbjct: 61  MKEARRILASRVIEVDGR 78



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DG+V TD  +P G MDV+ I    + +R++ D   +     I PEEA YKL +++R  T 
Sbjct: 76  DGRVVTDYKFPVGLMDVLHIIPEEKYYRVVPDPARKLRFVEIKPEEAGYKLAQIRRKMTV 135

Query: 435 PKNVPYLVTHDGRTI 479
                    HDGR +
Sbjct: 136 KNGDLQFTLHDGRNV 150


>UniRef50_O05634 Cluster: 30S ribosomal protein S4e; n=5;
           Sulfolobaceae|Rep: 30S ribosomal protein S4e -
           Sulfolobus acidocaldarius
          Length = 244

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 35/95 (36%), Positives = 47/95 (49%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVR D  YP G MDVV I   +   R+I D     T   I+ E+AKYK  ++    T 
Sbjct: 68  DGKVRRDYKYPVGLMDVVEIPSADLRVRIIPDNVRYLTTINISREDAKYKFVRIMNKTTL 127

Query: 435 PKNVPYLVTHDGRTIRYP-DPLIKVKIPSS*TLQL 536
              V  L   DGR I    + L +  +P+  TL++
Sbjct: 128 KSGVLQLNLEDGRNILLKGEELSQYNLPTLTTLKI 162



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 23/68 (33%), Positives = 33/68 (48%)
 Frame = +1

Query: 61  HLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQ 240
           H+ R  AP    + K    +  R   GPHK++E +PL I L+  LK   T  E  +I+  
Sbjct: 3   HITRFEAPWFLKVGKKEYKWIIRSRAGPHKIQESVPLAILLKYYLKAVDTTREAKRIIFD 62

Query: 241 RLIKVMGK 264
             + V GK
Sbjct: 63  GKVLVDGK 70


>UniRef50_A3H986 Cluster: Ribosomal protein S4E; n=1; Caldivirga
           maquilingensis IC-167|Rep: Ribosomal protein S4E -
           Caldivirga maquilingensis IC-167
          Length = 237

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/77 (38%), Positives = 38/77 (49%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVR D  YP G MDV+ +   NE +R+I D        RI   EA  K+C+++   
Sbjct: 66  KVDGKVRRDYKYPVGLMDVIELTPINEYYRIIPDPVNFLRPIRIDKSEAGVKVCRIEDKT 125

Query: 429 TGPKNVPYLVTHDGRTI 479
                   L  HDGR I
Sbjct: 126 MVKAGKIQLNLHDGRNI 142



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 24/68 (35%), Positives = 39/68 (57%)
 Frame = +1

Query: 61  HLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQ 240
           HL+R  +P+ W +++ G  ++ +PS GPH     +PL + LR+   YA T  E   I+ +
Sbjct: 3   HLRRSTSPEWWPVERKGAPWSIKPSPGPHPANSSIPLAVLLRDVFHYAKTLREARLIIGK 62

Query: 241 RLIKVMGK 264
             +KV GK
Sbjct: 63  GYVKVDGK 70


>UniRef50_Q9YF85 Cluster: 30S ribosomal protein S4e; n=4;
           Desulfurococcales|Rep: 30S ribosomal protein S4e -
           Aeropyrum pernix
          Length = 253

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 34/83 (40%), Positives = 43/83 (51%), Gaps = 3/83 (3%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLI-YDVKGRFTIHRITPEEAKYKLCKVKRVAT 431
           DG VR D  +P GFMDV+ +  T E FR++ Y VK  F +H I  EE   K  +++   T
Sbjct: 74  DGVVRKDYKFPVGFMDVIEVVDTGEKFRMLPYPVK-FFKLHPIPEEEGDLKPVRIENKTT 132

Query: 432 GPKNVPYLVTHDGRTI--RYPDP 494
                  L  HDGR I  R  DP
Sbjct: 133 VKGGHVQLNLHDGRNILVRVKDP 155



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query: 40  MAR-GPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGN 216
           MAR G ++ LK L AP+ W + +    +A +P  GPH   + LPL++ +RN L YA T  
Sbjct: 1   MARMGGQRRLKALAAPRFWPILRKEYKWAVKPRPGPHPAEKSLPLLLIVRNVLGYAQTAR 60

Query: 217 EVLKIVKQRLIKVMG 261
           E  K++ +   +V G
Sbjct: 61  EARKLISEGHFRVDG 75



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +2

Query: 470 PHHPLSRPTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTI 622
           P +P+    Y++ D++ + +   +I   IKF  G + +I GGRN+GRVG +
Sbjct: 155 PRNPVE-DVYRTMDTLLITVPGQEIKGHIKFGEGAIAIIVGGRNVGRVGVV 204


>UniRef50_UPI000038E22A Cluster: hypothetical protein Faci_03001139;
           n=1; Ferroplasma acidarmanus fer1|Rep: hypothetical
           protein Faci_03001139 - Ferroplasma acidarmanus fer1
          Length = 241

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCK-VKRV 425
           K DG++  D  +P GFMDV+SI+     + ++YD KG+  I +  P     KL K VK+ 
Sbjct: 68  KVDGRIVKDRRFPVGFMDVLSIDTLENDYIIVYDRKGKLVIRQNAPGNKGLKLFKVVKKT 127

Query: 426 ATGPKNVPYLVTHDGRTI 479
             G   +  L  HDG+TI
Sbjct: 128 IIGTGKI-QLGFHDGKTI 144


>UniRef50_P62429 Cluster: 30S ribosomal protein S4e; n=1;
           Nanoarchaeum equitans|Rep: 30S ribosomal protein S4e -
           Nanoarchaeum equitans
          Length = 234

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 26/75 (34%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCK-VKRVAT 431
           DG+   D  +P G  DV++I + NE +R++ D +G+  + +I  EEA  K  K +++V+ 
Sbjct: 74  DGRPIKDYKFPVGLFDVLAIPEINEYYRVLLDERGKLYLKKIDKEEANIKYGKIIRKVSV 133

Query: 432 GPKNVPYLVTHDGRT 476
               + Y +T DGRT
Sbjct: 134 RGGKIQYTLT-DGRT 147



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +1

Query: 55  KKHLKRLNAPKAWMLD-KLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKI 231
           K+HL+ L  P+ W +  K  G +  +PS GPH     +P+ ++LR+ L  A    EV  +
Sbjct: 6   KRHLRSLAVPRTWPVPRKSRGYWIVKPSPGPHSKEFAMPIAVWLRDYLGLAENMREVRYL 65

Query: 232 VKQRLIKVMGK 264
           +    + V G+
Sbjct: 66  LNNGKVLVDGR 76


>UniRef50_Q0W1X6 Cluster: 30S ribosomal protein S4E; n=2;
           Euryarchaeota|Rep: 30S ribosomal protein S4E -
           Uncultured methanogenic archaeon RC-I
          Length = 234

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 24/68 (35%), Positives = 38/68 (55%)
 Frame = +1

Query: 61  HLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQ 240
           HLKR+ AP+ W + +    +  +P  G H     +PLV+ LR+ LK A   +E+ KI+ +
Sbjct: 5   HLKRVAAPRTWPITRKTSKWVAKPMPGAHSEERGMPLVVVLRDLLKVADNTSEIKKILHE 64

Query: 241 RLIKVMGK 264
             + V GK
Sbjct: 65  GKVLVDGK 72



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/75 (33%), Positives = 36/75 (48%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVR D  Y  G  D +SI   N  +R++  + G+F  H +   +A  K+CK+      
Sbjct: 70  DGKVRKDYRYTVGMFDTISIPAINANYRVVIGMDGKF--HLVPVTDASAKICKIVNKTAL 127

Query: 435 PKNVPYLVTHDGRTI 479
                 L  HDG T+
Sbjct: 128 RGGKIQLNLHDGTTM 142


>UniRef50_A2SPL4 Cluster: Ribosomal protein S4E, central; n=1;
           Methanocorpusculum labreanum Z|Rep: Ribosomal protein
           S4E, central - Methanocorpusculum labreanum (strain ATCC
           43576 / DSM 4855 / Z)
          Length = 239

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/65 (36%), Positives = 37/65 (56%)
 Frame = +1

Query: 67  KRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQRL 246
           KR+ AP AW + +    Y    S+GPH     LP+ I+LR+ +++AL   EV KI+  R 
Sbjct: 5   KRMTAPDAWQIARKESKYVVSTSSGPHD-GSALPIGIWLRDHMQFALNTKEVRKILHDRQ 63

Query: 247 IKVMG 261
           + + G
Sbjct: 64  VLLNG 68



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVAT 431
           +G + TD        D++S  K ++ + ++ D KGR   + I+ + AK +L KV    T
Sbjct: 67  NGHIVTDEHIGIDVFDIISFPKIDKHYMILVDEKGRHNEYEISADAAKLQLVKVANKTT 125


>UniRef50_Q673R6 Cluster: Ribosomal protein S4; n=2; environmental
           samples|Rep: Ribosomal protein S4 - uncultured marine
           group II euryarchaeote DeepAnt-JyKC7
          Length = 232

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 27/79 (34%), Positives = 40/79 (50%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DG++ TD     G MDV+++ + +  FR I DV G+     I+ + A  KLC+V   +T 
Sbjct: 70  DGRIETDLGRGVGLMDVLTVGEDS--FRCILDVNGKLRYRSISDKAAASKLCRVMGKSTI 127

Query: 435 PKNVPYLVTHDGRTIRYPD 491
                 +  HDGR I   D
Sbjct: 128 TDGKTQIHLHDGRNILVSD 146



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/68 (30%), Positives = 37/68 (54%)
 Frame = +1

Query: 61  HLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQ 240
           H+KRL  P++W L +   ++  +P+ G H    C+PL + LR+ L  A    E  +++  
Sbjct: 5   HMKRLTMPRSWPLTRKTDIWVQKPNPGGHSDEMCMPLGVILRDVLDLAHNLREAKRMLAT 64

Query: 241 RLIKVMGK 264
           R + V G+
Sbjct: 65  RQVLVDGR 72


>UniRef50_Q8PV38 Cluster: 30S ribosomal protein S4e; n=4;
           Euryarchaeota|Rep: 30S ribosomal protein S4e -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 235

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/75 (32%), Positives = 38/75 (50%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DG  R D  +P G  DV+++   NE +R++ D KGR  ++++  E    KLC++    T 
Sbjct: 68  DGISRKDLRFPVGLFDVITLPLVNEAYRMLQDEKGRLVLYKLN-ETNVNKLCRINNKTTV 126

Query: 435 PKNVPYLVTHDGRTI 479
                 L  +DG  I
Sbjct: 127 KGGKIQLNLNDGTNI 141



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 21/67 (31%), Positives = 33/67 (49%)
 Frame = +1

Query: 61  HLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQ 240
           H KRL+ PK+W + + G  +      GPH     LPL + +R+ LK      E  +I+ +
Sbjct: 3   HQKRLSVPKSWKVGRKGNKWISTTRPGPHSQARSLPLGLIIRDVLKLVDNNREGKRILSE 62

Query: 241 RLIKVMG 261
             + V G
Sbjct: 63  GKVLVDG 69



 Score = 41.5 bits (93), Expect = 0.018
 Identities = 19/47 (40%), Positives = 29/47 (61%)
 Frame = +2

Query: 497 YQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRE 637
           Y ++DS+ L I    ++  +KFE GNL M+ GG++ G  G I+  RE
Sbjct: 147 YGTKDSLILSIPDKHVVKHLKFEVGNLAMVIGGQHSGETGKIMEIRE 193


>UniRef50_Q40941 Cluster: 40S ribosomal protein S4; n=2;
           Bigelowiella natans|Rep: 40S ribosomal protein S4 -
           Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 242

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/85 (25%), Positives = 40/85 (47%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           +GK      +P   MD +S    N+ +R++    G+ T++ I   E   K+CKV ++   
Sbjct: 73  NGKKCLSHKFPISLMDTISFPLANKHYRVLLSKAGKLTVYEINQNEKDLKICKVIKIINA 132

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKVK 509
                 ++T D R ++     IKV+
Sbjct: 133 SSKNKIIITDDLRELKINYAKIKVE 157



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/55 (34%), Positives = 35/55 (63%)
 Frame = +2

Query: 506 QDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           +DS+ +     +I+  +KFE G+LC+IT G++LG +  I   R+T  L  ++H++
Sbjct: 157 EDSLLIKTINDEIVYALKFEVGSLCLITRGKHLGTIAVIKEIRKTKSLRKMIHLE 211



 Score = 41.5 bits (93), Expect = 0.018
 Identities = 23/75 (30%), Positives = 38/75 (50%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MA+G KKH KR+++       K  G++  + S+GPH   + + L+  ++     A    E
Sbjct: 1   MAKGIKKHQKRISSNTMIKYKKKLGIFNTKISSGPHSKVKSVSLLNIIKKFFHLADNNQE 60

Query: 220 VLKIVKQRLIKVMGK 264
             K+VK   + V GK
Sbjct: 61  AQKVVKTGFLYVNGK 75


>UniRef50_A3CT09 Cluster: Ribosomal protein S4E, central; n=3;
           Methanomicrobiales|Rep: Ribosomal protein S4E, central -
           Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498
           / JR1)
          Length = 242

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 25/69 (36%), Positives = 39/69 (56%)
 Frame = +1

Query: 58  KHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVK 237
           K+LKRL AP +W + K    +  + + GPH     LP+ ++LR  +  A   +EV KI+ 
Sbjct: 3   KYLKRLVAPGSWHIPKKVQKFVMKTAPGPHN-AGALPVGVWLREHIGLAQNASEVKKILH 61

Query: 238 QRLIKVMGK 264
           QR + V G+
Sbjct: 62  QRDVLVNGR 70



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVAT 431
           +G+   D     G  D+VSI K  + +R+  DVKG      I  E AK +LCK++   T
Sbjct: 68  NGRACKDSRMGLGVFDIVSIPKLGKHYRIQLDVKGNLVAIEIPAESAKTRLCKIRNKTT 126



 Score = 39.1 bits (87), Expect = 0.098
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 5/53 (9%)
 Frame = +2

Query: 482 LSRPTYQSQDSIQLDIATT-----KIMDFIKFESGNLCMITGGRNLGRVGTIV 625
           L+  TY+++DS+ + + T      +I+D   +  GN+ MI GG++ G+VG IV
Sbjct: 143 LADNTYKAKDSVVVTLGTDGEDRFRIVDHFPYAEGNVAMIVGGKHSGKVGRIV 195


>UniRef50_Q12ZT9 Cluster: Ribosomal protein S4E; n=1;
           Methanococcoides burtonii DSM 6242|Rep: Ribosomal
           protein S4E - Methanococcoides burtonii (strain DSM
           6242)
          Length = 236

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/42 (47%), Positives = 28/42 (66%)
 Frame = +2

Query: 497 YQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTI 622
           Y ++DSI L +   K++  IK+E GNL MI GG + G VG+I
Sbjct: 148 YNTKDSIILSVPDKKVVKHIKYEVGNLAMIVGGSHAGEVGSI 189



 Score = 41.1 bits (92), Expect = 0.024
 Identities = 18/67 (26%), Positives = 32/67 (47%)
 Frame = +1

Query: 61  HLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQ 240
           H KR++ PK+W + K    +      GPH   + +PL + LR+ L       E  +++ +
Sbjct: 4   HQKRISVPKSWQISKKSNKWITSTRPGPHNRLQSIPLAVILRDMLGVVDNRAEAKRVLSE 63

Query: 241 RLIKVMG 261
             + V G
Sbjct: 64  GNVLVDG 70



 Score = 40.7 bits (91), Expect = 0.032
 Identities = 18/55 (32%), Positives = 32/55 (58%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVK 419
           DG  R D  +P G MD+++I   N  +R++ D K R  ++++    A  KLC+++
Sbjct: 69  DGVARKDLRFPVGLMDIITIPLNNVEYRVMLDGKSRLVLNKLDGTGAD-KLCRIE 122


>UniRef50_P22510 Cluster: 30S ribosomal protein S4E; n=6;
           Halobacteriaceae|Rep: 30S ribosomal protein S4E -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 234

 Score = 39.1 bits (87), Expect = 0.098
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +1

Query: 61  HLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQ 240
           H KRL+ P +W +++    +  +   GPH     +PL+I LR+ L YA    E    + +
Sbjct: 4   HQKRLSVPNSWPVERKTATFTVKAGAGPHG-ESGVPLLIVLRDVLGYADNRKEARYALNE 62

Query: 241 RLIKVMGK 264
             + + GK
Sbjct: 63  DNVLINGK 70



 Score = 39.1 bits (87), Expect = 0.098
 Identities = 22/79 (27%), Positives = 35/79 (44%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           +GK  +D   P G  D+++  +  E +R+     GR  +  I P+ A+ KL K+      
Sbjct: 68  NGKAISDEERPVGMFDILAFTEREEYYRVFPGEGGRLALTAIDPDAAQSKLGKIVTKTHV 127

Query: 435 PKNVPYLVTHDGRTIRYPD 491
                 L  HDG T+   D
Sbjct: 128 SGGDVQLGLHDGETLIVED 146


>UniRef50_Q6L1B5 Cluster: 30S ribosomal protein S4e; n=1;
           Picrophilus torridus|Rep: 30S ribosomal protein S4e -
           Picrophilus torridus
          Length = 234

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 17/45 (37%), Positives = 27/45 (60%)
 Frame = +2

Query: 488 RPTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTI 622
           R   ++ DS+ + I   +I+D +KF  GN   ITGG ++G + TI
Sbjct: 145 RKDIKNGDSVLVKIPKKEIVDVLKFAPGNRVFITGGSHVGEIATI 189



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +1

Query: 67  KRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQRL 246
           K + AP+   + +    +A     G HK    +PL+I LR+ LK      E+ +I+   L
Sbjct: 6   KIMMAPRKLKIARKSRFWAVNSLPGSHKKDSSIPLLIALRDYLKLGDKEREITRILTNSL 65

Query: 247 IKVMGK 264
           + V GK
Sbjct: 66  VMVDGK 71


>UniRef50_Q7U147 Cluster: PROBABLE OXIDASE; n=7; Mycobacterium
           tuberculosis complex|Rep: PROBABLE OXIDASE -
           Mycobacterium bovis
          Length = 504

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 20/49 (40%), Positives = 26/49 (53%)
 Frame = -3

Query: 172 PGASTRATCGDRLTVSVHTHRQVCPTSMLWERLSASNAS*GLAPCWTSI 26
           PG   RAT GD + VSV T+R   PTS+ W  ++  N   G  P   +I
Sbjct: 93  PGPLIRATVGDEIVVSV-TNRLGDPTSVHWHGIALRNDMDGTEPATANI 140


>UniRef50_Q890E3 Cluster: Acetyltransferase (GNAT) family; n=1;
           Lactobacillus plantarum|Rep: Acetyltransferase (GNAT)
           family - Lactobacillus plantarum
          Length = 163

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = +1

Query: 418 SVWRPDLRMFRTW*RMMAAPSAIQTHLSKSRFHPVRHCNYEDYG-LHQV*VRELVYDHG 591
           + WRP+    R W  M+ A +A    +    F P RH NYE +G L+ + V    + HG
Sbjct: 46  ATWRPE----RRWQNMLLAMTADGEVVGVCTFGPARHANYEGWGELYSLYVHPNYHHHG 100


>UniRef50_Q293C6 Cluster: GA20855-PA; n=1; Drosophila
           pseudoobscura|Rep: GA20855-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 1177

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 22/63 (34%), Positives = 30/63 (47%)
 Frame = +3

Query: 75  KRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCFDRKRSPENCETTPHKG 254
           K  QS+D  +    +   T +   Q  + L  G+  EE  +V FDRK SP   ET P K 
Sbjct: 594 KVHQSLDESKMLALIEGATESTIVQSVQKLTAGEDSEEDDDV-FDRKDSPRFLETNPFKD 652

Query: 255 DGK 263
           D +
Sbjct: 653 DAQ 655


>UniRef50_Q5UP36 Cluster: Cysteinyl-tRNA synthetase; n=1;
           Acanthamoeba polyphaga mimivirus|Rep: Cysteinyl-tRNA
           synthetase - Mimivirus
          Length = 509

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 14/57 (24%), Positives = 34/57 (59%)
 Frame = +1

Query: 94  MLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQRLIKVMGK 264
           +LDKLG +Y    S+  HK+++ + ++I  R++L+      ++   +K++L  ++ +
Sbjct: 421 LLDKLGFIYRVGNSSSSHKIKDLMNILIETRSQLRQLTRNPDLSPGIKKQLFDILDR 477


>UniRef50_A6E8K7 Cluster: Putative uncharacterized protein; n=1;
           Pedobacter sp. BAL39|Rep: Putative uncharacterized
           protein - Pedobacter sp. BAL39
          Length = 195

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 3/67 (4%)
 Frame = -2

Query: 227 FRTSFPVKAYFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAFKRFK---CF 57
           F   F  KA FR+ +RK+  G+H+      +D   A+T PSL   H     KR++    F
Sbjct: 11  FLGRFFFKARFRKLIRKL--GRHTEVYLVDIDNTLAHTWPSLQQRHYSAENKRYRSLPIF 68

Query: 56  LGPRAML 36
           +G R+ L
Sbjct: 69  IGMRSYL 75


>UniRef50_Q00TF1 Cluster: Chromosome 17 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 17 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 197

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 20/67 (29%), Positives = 35/67 (52%)
 Frame = -2

Query: 500 DKWVWIADGAAIMRYQVRNILRSGRHTLDFTQLVLSLLRGDTVDCESALNIID*TKQFIS 321
           D  + + +GAA+++   R+ L          QLVL     D V  ES+L ++D  + FI+
Sbjct: 127 DHGIRVTNGAAVVQTDARHALVPELLAPHLAQLVLRFDSLDAVHNESSLGVVDEPEVFIA 186

Query: 320 LLN*DNI 300
           L + D++
Sbjct: 187 LFDGDDV 193


>UniRef50_Q57WH1 Cluster: Putative uncharacterized protein; n=6;
            Trypanosoma|Rep: Putative uncharacterized protein -
            Trypanosoma brucei
          Length = 1760

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 15/63 (23%), Positives = 34/63 (53%)
 Frame = +3

Query: 240  TPHKGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVK 419
            T  +G+  +RTDP+Y +    V+ +++   L  +I++++  F+   +   + K +LC   
Sbjct: 1046 TRRRGECILRTDPSYHSAPSAVIKLQQLIRLEEIIFNMRNNFSNELLKLRDEKERLCGTL 1105

Query: 420  RVA 428
             V+
Sbjct: 1106 NVS 1108


>UniRef50_A0HHE0 Cluster: Putative uncharacterized protein
           precursor; n=1; Comamonas testosteroni KF-1|Rep:
           Putative uncharacterized protein precursor - Comamonas
           testosteroni KF-1
          Length = 222

 Score = 32.7 bits (71), Expect = 8.5
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = -1

Query: 681 PVESLMCTMSKSRDVSRGNTMVPTRPKL 598
           PVESLM T+ K+R  S+  T+  T+PKL
Sbjct: 103 PVESLMSTVQKARQQSQCKTVSATKPKL 130


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 758,337,346
Number of Sequences: 1657284
Number of extensions: 16383468
Number of successful extensions: 45549
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 43671
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45522
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52892566912
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -