SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20062
         (635 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4SP18 Cluster: Chromosome 15 SCAF14542, whole genome s...   163   2e-39
UniRef50_Q4RZU4 Cluster: Chromosome 18 SCAF14786, whole genome s...   158   9e-38
UniRef50_Q59G96 Cluster: Dynamin 2 isoform 4 variant; n=20; Euka...   158   9e-38
UniRef50_P50570 Cluster: Dynamin-2; n=210; Bilateria|Rep: Dynami...   158   9e-38
UniRef50_Q4TBL8 Cluster: Chromosome undetermined SCAF7117, whole...   151   1e-35
UniRef50_A2FH85 Cluster: Dynamin central region family protein; ...   130   4e-29
UniRef50_A4RRG7 Cluster: Predicted protein; n=3; Viridiplantae|R...   129   6e-29
UniRef50_Q8S944 Cluster: Dynamin-related protein 3A; n=11; Magno...   129   6e-29
UniRef50_A2E540 Cluster: Dynamin central region family protein; ...   126   3e-28
UniRef50_Q54YU0 Cluster: Dynamin like protein; n=3; Eukaryota|Re...   126   6e-28
UniRef50_A2ET21 Cluster: Dynamin central region family protein; ...   124   2e-27
UniRef50_A7QM20 Cluster: Chromosome undetermined scaffold_123, w...   123   3e-27
UniRef50_A2XSM8 Cluster: Putative uncharacterized protein; n=2; ...   123   3e-27
UniRef50_P54861 Cluster: Dynamin-related protein DNM1; n=5; Sacc...   123   3e-27
UniRef50_Q84Y91 Cluster: Dynamin; n=1; Cyanidioschyzon merolae|R...   120   2e-26
UniRef50_A7SN34 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...   120   2e-26
UniRef50_Q5KKV8 Cluster: Dynamin protein dnm1, putative; n=14; D...   118   9e-26
UniRef50_P21576 Cluster: Vacuolar protein sorting-associated pro...   118   1e-25
UniRef50_O00429 Cluster: Dynamin-1-like protein; n=68; Coelomata...   117   2e-25
UniRef50_A7TFM3 Cluster: Putative uncharacterized protein; n=1; ...   116   5e-25
UniRef50_Q09748 Cluster: Dynamin-like protein C12C2.08; n=2; Asc...   115   1e-24
UniRef50_UPI0000498C03 Cluster: dynamin-like protein; n=3; Entam...   113   3e-24
UniRef50_A3LNY6 Cluster: Predicted protein; n=7; Ascomycota|Rep:...   113   3e-24
UniRef50_A4I4S9 Cluster: GTP-binding protein, putative; n=7; Try...   113   4e-24
UniRef50_Q1E570 Cluster: Dynamin-related protein; n=3; Pezizomyc...   111   1e-23
UniRef50_Q9FNX5 Cluster: Dynamin-related protein 1E; n=47; Magno...   111   2e-23
UniRef50_Q4UDK3 Cluster: Dynamin-like protein, putative; n=3; Pi...   109   4e-23
UniRef50_Q54XV5 Cluster: Dynamin B; n=2; Dictyostelium discoideu...   109   5e-23
UniRef50_A7E8I0 Cluster: Putative uncharacterized protein; n=1; ...   109   5e-23
UniRef50_Q8ITV0 Cluster: Dynamin-related protein; n=1; Trypanoso...   109   7e-23
UniRef50_A2FR27 Cluster: Dynamin central region family protein; ...   109   7e-23
UniRef50_UPI00015B42FC Cluster: PREDICTED: similar to dynamin; n...   107   2e-22
UniRef50_UPI0000E4A0DD Cluster: PREDICTED: similar to Dynamin 2,...   107   3e-22
UniRef50_Q4RHK0 Cluster: Chromosome 19 SCAF15045, whole genome s...   106   4e-22
UniRef50_Q8WQC9 Cluster: Dynamin related protein protein 1, isof...   105   7e-22
UniRef50_UPI0000499BF9 Cluster: dynamin-like protein; n=1; Entam...   105   1e-21
UniRef50_Q3SEL2 Cluster: Dynamin-related protein,putative; n=4; ...   101   1e-20
UniRef50_A3FQ98 Cluster: Dynamin-related protein, putative; n=3;...   101   1e-20
UniRef50_Q675Z6 Cluster: Dynamin-related protein 1; n=1; Oikople...   101   1e-20
UniRef50_Q38KF4 Cluster: Drp7p; n=2; Tetrahymena thermophila|Rep...    99   4e-20
UniRef50_Q9BJC6 Cluster: Dynamin-like protein; n=3; Plasmodium|R...    99   1e-19
UniRef50_Q4N2Q1 Cluster: Dynamin, putative; n=3; Piroplasmida|Re...    96   7e-19
UniRef50_Q8SR00 Cluster: DYNAMIN-LIKE VACUOLAR PROTEIN SORTING P...    95   1e-18
UniRef50_Q38KF7 Cluster: Drp1p; n=5; Oligohymenophorea|Rep: Drp1...    95   1e-18
UniRef50_Q0ZIJ3 Cluster: Interferon-induced Mx protein; n=4; Per...    94   3e-18
UniRef50_Q4SCL2 Cluster: Chromosome 12 SCAF14652, whole genome s...    93   4e-18
UniRef50_Q1JSC9 Cluster: DyNamin-like protein, putative; n=11; A...    93   7e-18
UniRef50_Q3SEK6 Cluster: Dynamin-related protein, putative; n=3;...    92   1e-17
UniRef50_Q8SSJ7 Cluster: DYNAMIN-RELATED PROTEIN; n=1; Encephali...    92   1e-17
UniRef50_Q6KF55 Cluster: Dynamin homologue; n=9; Plasmodium|Rep:...    87   3e-16
UniRef50_UPI00006CCFE0 Cluster: Dynamin central region family pr...    87   4e-16
UniRef50_A0D4X4 Cluster: Chromosome undetermined scaffold_38, wh...    87   4e-16
UniRef50_Q3M0W5 Cluster: Dynamin-related protein, putative; n=3;...    86   6e-16
UniRef50_A1Y011 Cluster: Dynamin-like protein; n=3; Hexamitidae|...    85   1e-15
UniRef50_P20592 Cluster: Interferon-induced GTP-binding protein ...    85   2e-15
UniRef50_Q75BV7 Cluster: ACR164Cp; n=3; Saccharomycetales|Rep: A...    84   3e-15
UniRef50_P32266 Cluster: Dynamin-like GTPase MGM1, mitochondrial...    83   5e-15
UniRef50_Q22W33 Cluster: Dynamin central region family protein; ...    82   1e-14
UniRef50_P20591 Cluster: Interferon-induced GTP-binding protein ...    82   1e-14
UniRef50_UPI00015A455B Cluster: UPI00015A455B related cluster; n...    81   3e-14
UniRef50_Q22AJ9 Cluster: Dynamin central region family protein; ...    80   4e-14
UniRef50_Q0GBY9 Cluster: Dynamin-like protein 1; n=1; Bigelowiel...    79   7e-14
UniRef50_Q2HB39 Cluster: Putative uncharacterized protein; n=1; ...    79   7e-14
UniRef50_Q800G4 Cluster: MxF protein; n=4; Danio rerio|Rep: MxF ...    78   2e-13
UniRef50_Q871Z1 Cluster: Related to dynamin-like protein; n=19; ...    78   2e-13
UniRef50_A5E440 Cluster: Protein MGM1, mitochondrial; n=6; Sacch...    77   4e-13
UniRef50_Q4U4N4 Cluster: Interferon-induced GTP-binding protein ...    77   4e-13
UniRef50_Q22AJ4 Cluster: Dynamin central region family protein; ...    76   8e-13
UniRef50_P87320 Cluster: Protein msp1, mitochondrial precursor; ...    76   8e-13
UniRef50_Q7T2M4 Cluster: Mx3 protein; n=7; Euteleostomi|Rep: Mx3...    75   1e-12
UniRef50_A6MD73 Cluster: Mx; n=1; Haliotis discus discus|Rep: Mx...    74   3e-12
UniRef50_Q5KJX1 Cluster: Dynamin GTPase, putative; n=3; Basidiom...    71   2e-11
UniRef50_UPI000023E784 Cluster: hypothetical protein FG05660.1; ...    70   4e-11
UniRef50_Q2UIL8 Cluster: Vacuolar sorting protein VPS1; n=1; Asp...    70   4e-11
UniRef50_A2QJR3 Cluster: Function: Mx proteins have antiviral ac...    67   4e-10
UniRef50_Q2UI57 Cluster: Vacuolar sorting protein VPS1; n=3; Tri...    66   7e-10
UniRef50_A4QZU8 Cluster: Putative uncharacterized protein; n=1; ...    64   3e-09
UniRef50_A4R024 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_Q0UEN8 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_Q9ZP55 Cluster: F8A5.5 protein; n=2; Arabidopsis thalia...    61   3e-08
UniRef50_Q7SBP5 Cluster: Putative uncharacterized protein NCU056...    59   8e-08
UniRef50_Q5BDS1 Cluster: Putative uncharacterized protein; n=1; ...    59   8e-08
UniRef50_Q2HD72 Cluster: Putative uncharacterized protein; n=5; ...    59   8e-08
UniRef50_Q0ULI1 Cluster: Putative uncharacterized protein; n=1; ...    59   1e-07
UniRef50_Q9ZP56 Cluster: F8A5.7 protein; n=12; Eukaryota|Rep: F8...    58   1e-07
UniRef50_Q5BCT2 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q1DMD9 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q3UD61 Cluster: Bone marrow macrophage cDNA, RIKEN full...    58   2e-07
UniRef50_Q0ULM2 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q1DIT9 Cluster: Putative uncharacterized protein; n=2; ...    57   4e-07
UniRef50_Q0UUL9 Cluster: Putative uncharacterized protein; n=1; ...    57   4e-07
UniRef50_Q4WYM5 Cluster: Dynamin GTPase, putative; n=3; Aspergil...    54   2e-06
UniRef50_A1Z9N0 Cluster: CG8479-PA, isoform A; n=6; Endopterygot...    54   3e-06
UniRef50_A6SPB4 Cluster: Putative uncharacterized protein; n=1; ...    54   4e-06
UniRef50_A2QF70 Cluster: Similarity to hypothetical protein Mx -...    54   4e-06
UniRef50_Q2H1N2 Cluster: Putative uncharacterized protein; n=1; ...    53   7e-06
UniRef50_Q2UH68 Cluster: Vacuolar sorting protein VPS1; n=1; Asp...    52   1e-05
UniRef50_Q0CEV2 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q4WH72 Cluster: Dynamin GTPase, putative; n=1; Aspergil...    52   2e-05
UniRef50_Q2U0L0 Cluster: Vacuolar sorting protein VPS1; n=5; Pez...    52   2e-05
UniRef50_A4RCA8 Cluster: Putative uncharacterized protein; n=2; ...    52   2e-05
UniRef50_Q0J5L5 Cluster: Os08g0425100 protein; n=2; Oryza sativa...    51   2e-05
UniRef50_Q1DV48 Cluster: Putative uncharacterized protein; n=1; ...    51   3e-05
UniRef50_A6SAY7 Cluster: Putative uncharacterized protein; n=2; ...    50   5e-05
UniRef50_Q7SAH6 Cluster: Putative uncharacterized protein NCU069...    50   6e-05
UniRef50_Q9ZP57 Cluster: F8A5.6 protein; n=2; Arabidopsis thalia...    49   8e-05
UniRef50_Q18965 Cluster: Putative uncharacterized protein eat-3;...    48   1e-04
UniRef50_A1DMG3 Cluster: Dynamin family protein; n=8; Eurotiomyc...    48   1e-04
UniRef50_UPI000023E2CA Cluster: hypothetical protein FG00202.1; ...    48   2e-04
UniRef50_A2QVR7 Cluster: Contig An11c0080, complete genome; n=1;...    48   2e-04
UniRef50_Q5U3A7 Cluster: Dynamin-like 120 kDa protein, mitochond...    48   2e-04
UniRef50_Q9LQ55 Cluster: Dynamin-2B; n=25; Magnoliophyta|Rep: Dy...    48   2e-04
UniRef50_Q1DI47 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_A2QTG5 Cluster: Function: the molecular function of MxA...    47   3e-04
UniRef50_O60313 Cluster: Dynamin-like 120 kDa protein, mitochond...    47   4e-04
UniRef50_Q2GM17 Cluster: Putative uncharacterized protein; n=1; ...    46   6e-04
UniRef50_A1DNM1 Cluster: Dynamin family protein; n=4; Trichocoma...    45   0.001
UniRef50_A4QQ56 Cluster: Putative uncharacterized protein; n=4; ...    45   0.002
UniRef50_UPI0000E49010 Cluster: PREDICTED: similar to Optic atro...    44   0.002
UniRef50_Q7S2E2 Cluster: Putative uncharacterized protein NCU059...    44   0.002
UniRef50_A0DHB8 Cluster: Chromosome undetermined scaffold_50, wh...    44   0.003
UniRef50_A6R9S4 Cluster: Predicted protein; n=1; Ajellomyces cap...    44   0.003
UniRef50_Q1E807 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_A5B0G4 Cluster: Putative uncharacterized protein; n=1; ...    43   0.005
UniRef50_A1CSA1 Cluster: Putative uncharacterized protein; n=1; ...    43   0.005
UniRef50_A5ABD6 Cluster: Function: Mx proteins have antiviral ac...    42   0.009
UniRef50_Q0U4S4 Cluster: Putative uncharacterized protein; n=1; ...    42   0.012
UniRef50_A4UCB5 Cluster: Putative uncharacterized protein; n=1; ...    42   0.012
UniRef50_A2PZB9 Cluster: Dynamin related protein; n=1; Chlamydom...    42   0.016
UniRef50_UPI000023EFD2 Cluster: hypothetical protein FG05351.1; ...    40   0.038
UniRef50_A2QLV0 Cluster: Similarity to hypothetical protein Mx h...    40   0.038
UniRef50_Q2GQG0 Cluster: Putative uncharacterized protein; n=1; ...    40   0.050
UniRef50_A1D567 Cluster: Putative uncharacterized protein; n=1; ...    40   0.050
UniRef50_A5APF0 Cluster: Putative uncharacterized protein; n=1; ...    40   0.066
UniRef50_Q9LKV0 Cluster: F21B23.2 protein; n=2; Arabidopsis thal...    35   0.074
UniRef50_A4QWP1 Cluster: Putative uncharacterized protein; n=1; ...    39   0.088
UniRef50_UPI0000499FD7 Cluster: dynamin-like protein; n=2; Entam...    38   0.15 
UniRef50_Q800G3 Cluster: MxG protein; n=8; Danio rerio|Rep: MxG ...    38   0.20 
UniRef50_A4S2I7 Cluster: Predicted protein; n=1; Ostreococcus lu...    38   0.27 
UniRef50_Q86JH7 Cluster: Similar to Arabidopsis thaliana (Mouse-...    38   0.27 
UniRef50_Q2U3L9 Cluster: Predicted protein; n=4; Trichocomaceae|...    37   0.47 
UniRef50_A1DA37 Cluster: Putative uncharacterized protein; n=1; ...    36   0.62 
UniRef50_A7HZZ7 Cluster: Flavodoxin; n=1; Campylobacter hominis ...    35   1.9  
UniRef50_A0QQ07 Cluster: Putative uncharacterized protein; n=1; ...    35   1.9  
UniRef50_A5KQM2 Cluster: Putative uncharacterized protein; n=1; ...    34   2.5  
UniRef50_A7EI57 Cluster: Putative uncharacterized protein; n=1; ...    33   4.4  
UniRef50_Q3LHM9 Cluster: Putative uncharacterized protein PpCpDn...    33   5.8  
UniRef50_Q7MQU0 Cluster: UPF0090 protein WS2018; n=1; Wolinella ...    33   5.8  
UniRef50_Q84KL1 Cluster: Dynamin related protein involved in chl...    33   7.6  
UniRef50_Q00ZF0 Cluster: Mitofusin 1 GTPase, involved in mitocho...    33   7.6  

>UniRef50_Q4SP18 Cluster: Chromosome 15 SCAF14542, whole genome
           shotgun sequence; n=4; Clupeocephala|Rep: Chromosome 15
           SCAF14542, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 892

 Score =  163 bits (397), Expect = 2e-39
 Identities = 79/89 (88%), Positives = 84/89 (94%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQI+ MI QFI RESCLILAVTPANTDLANSDALKLAK+VDPQG+RTIGVITKLDLMDEG
Sbjct: 156 QQIRDMIMQFITRESCLILAVTPANTDLANSDALKLAKDVDPQGMRTIGVITKLDLMDEG 215

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 216 TDARDVLENKLLPLRRGYIGVVNRSQKDI 244



 Score =  153 bits (372), Expect = 3e-36
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLIN   E+AEFLHCKGKKFTDF+EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 74  QLINSTAEWAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLN 133

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 134 LTLIDLPGITKVPVGDQPADI 154



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 29/36 (80%), Positives = 33/36 (91%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AAL AERKFFLSHP YRHLA+++GT
Sbjct: 241 QKDIDGKKDIKAALEAERKFFLSHPGYRHLAEKMGT 276


>UniRef50_Q4RZU4 Cluster: Chromosome 18 SCAF14786, whole genome
           shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 18
           SCAF14786, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 1000

 Score =  158 bits (384), Expect = 9e-38
 Identities = 76/88 (86%), Positives = 82/88 (93%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ M+ QFI +ESCLILAVTPAN DLANSDALK+AKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 180 QIRDMLLQFITKESCLILAVTPANMDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGT 239

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 240 DARDVLENKLLPLRRGYIGVVNRSQKDI 267



 Score =  139 bits (337), Expect = 4e-32
 Identities = 63/74 (85%), Positives = 70/74 (94%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           EYAEFLHCKG+KF DF+EVR EIEAETDR+TGSNKGISP+PINLRVYSP+VLNLTLIDLP
Sbjct: 104 EYAEFLHCKGRKFVDFDEVRLEIEAETDRLTGSNKGISPIPINLRVYSPHVLNLTLIDLP 163

Query: 212 GLTKVPIGDQPIDI 253
           G+TKV +GDQP DI
Sbjct: 164 GMTKVAVGDQPHDI 177



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 31/36 (86%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AALAAERKFFLSHPSYRH+A+R+GT
Sbjct: 264 QKDIDGKKDIRAALAAERKFFLSHPSYRHMAERMGT 299


>UniRef50_Q59G96 Cluster: Dynamin 2 isoform 4 variant; n=20;
           Eukaryota|Rep: Dynamin 2 isoform 4 variant - Homo
           sapiens (Human)
          Length = 487

 Score =  158 bits (384), Expect = 9e-38
 Identities = 79/88 (89%), Positives = 81/88 (92%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK MI QFI RES LILAVTPAN DLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 144 QIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 203

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 204 DARDVLENKLLPLRRGYIGVVNRSQKDI 231



 Score =  149 bits (360), Expect = 7e-35
 Identities = 69/81 (85%), Positives = 75/81 (92%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLI   TE+AEFLHCK KKFTDF+EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 61  QLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 120

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 121 LTLIDLPGITKVPVGDQPPDI 141



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 30/36 (83%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+G+KDI AALAAERKFFLSHP+YRH+ADR+GT
Sbjct: 228 QKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGT 263


>UniRef50_P50570 Cluster: Dynamin-2; n=210; Bilateria|Rep: Dynamin-2
           - Homo sapiens (Human)
          Length = 870

 Score =  158 bits (384), Expect = 9e-38
 Identities = 79/88 (89%), Positives = 81/88 (92%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK MI QFI RES LILAVTPAN DLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT
Sbjct: 155 QIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DARDVLENKLLPLRRGYIGVVNR +K +
Sbjct: 215 DARDVLENKLLPLRRGYIGVVNRSQKDI 242



 Score =  149 bits (360), Expect = 7e-35
 Identities = 69/81 (85%), Positives = 75/81 (92%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QLI   TE+AEFLHCK KKFTDF+EVR EIEAETDRVTG+NKGISPVPINLRVYSP+VLN
Sbjct: 72  QLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLN 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTLIDLPG+TKVP+GDQP DI
Sbjct: 132 LTLIDLPGITKVPVGDQPPDI 152



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 30/36 (83%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+G+KDI AALAAERKFFLSHP+YRH+ADR+GT
Sbjct: 239 QKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGT 274


>UniRef50_Q4TBL8 Cluster: Chromosome undetermined SCAF7117, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF7117,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 675

 Score =  151 bits (367), Expect = 1e-35
 Identities = 73/88 (82%), Positives = 81/88 (92%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI QFI +E+CLILAVTPANTDLANSDALKLAK+VDPQGLRTIGVITKLDLMD GT
Sbjct: 342 QIRDMIMQFICKENCLILAVTPANTDLANSDALKLAKDVDPQGLRTIGVITKLDLMDAGT 401

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DAR +LEN+LLPLRRGYIGVVNR +K +
Sbjct: 402 DARVILENRLLPLRRGYIGVVNRSQKDI 429



 Score =  148 bits (358), Expect = 1e-34
 Identities = 64/81 (79%), Positives = 74/81 (91%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL+N +TEY EFLHCKGKKFTDF E+R EIE ET R+TGSNKGISPVPI+LR+YSP+VLN
Sbjct: 259 QLLNASTEYGEFLHCKGKKFTDFEEIRSEIERETHRLTGSNKGISPVPISLRIYSPHVLN 318

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTL+DLPG+TKVP+GDQP DI
Sbjct: 319 LTLVDLPGITKVPVGDQPADI 339



 Score = 79.0 bits (186), Expect(2) = 8e-15
 Identities = 39/52 (75%), Positives = 45/52 (86%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITK 414
           QI+ MI QFI +E+CLILAVTPANTDLANSDALKLAK+VDPQG   IGV+ +
Sbjct: 125 QIRDMIMQFICKENCLILAVTPANTDLANSDALKLAKDVDPQGY--IGVVNR 174



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 26/36 (72%), Positives = 33/36 (91%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AAL  E+KFFL+HP+YRH+A+R+GT
Sbjct: 176 QKDIDGKKDIKAALLEEQKFFLAHPAYRHMAERMGT 211



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 26/36 (72%), Positives = 33/36 (91%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDIDG+KDI AAL  E+KFFL+HP+YRH+A+R+GT
Sbjct: 426 QKDIDGKKDIKAALLEEQKFFLAHPAYRHMAERMGT 461



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 21/27 (77%), Positives = 24/27 (88%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVR 91
           QL+N +TEY EFLHCKGKKFTDF E+R
Sbjct: 72  QLLNASTEYGEFLHCKGKKFTDFEEIR 98



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = +2

Query: 182 VLNLTLIDLPGLTKVPIGDQPIDI 253
           +LNLTL+DLPG+TKVP+GDQP DI
Sbjct: 99  MLNLTLVDLPGITKVPVGDQPADI 122



 Score = 23.8 bits (49), Expect(2) = 8e-15
 Identities = 9/14 (64%), Positives = 12/14 (85%)
 Frame = +1

Query: 481 RGYIGVVNRCRKTL 522
           +GYIGVVNR +K +
Sbjct: 166 QGYIGVVNRSQKDI 179


>UniRef50_A2FH85 Cluster: Dynamin central region family protein;
           n=2; Trichomonas vaginalis G3|Rep: Dynamin central
           region family protein - Trichomonas vaginalis G3
          Length = 597

 Score =  130 bits (313), Expect = 4e-29
 Identities = 59/89 (66%), Positives = 76/89 (85%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQI+ M+  +I +E+ +ILA+TPANTDLANSD+L +A+EVDP+G RTIGVITKLD+MD+G
Sbjct: 153 QQIRNMVMSYITKENAIILAITPANTDLANSDSLLIAREVDPKGTRTIGVITKLDIMDKG 212

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           T+ARDVL NK+ PL  GYIGVVNR +K +
Sbjct: 213 TNARDVLLNKVYPLNLGYIGVVNRSQKDI 241



 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 46/74 (62%), Positives = 57/74 (77%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+A F H   + FT+F++VR EIE ETDR+ GSNKG++  PINLRV SPNVLNLTL+DLP
Sbjct: 78  EFAVFNHKPDEIFTNFDKVRQEIEDETDRLCGSNKGVTDAPINLRVTSPNVLNLTLVDLP 137

Query: 212 GLTKVPIGDQPIDI 253
           GLTKV +  Q  D+
Sbjct: 138 GLTKVAVEGQAADL 151



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 16/35 (45%), Positives = 22/35 (62%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           QKDID  K +   + +E +FFL+ P YR LA+  G
Sbjct: 238 QKDIDDGKPMEKVIESEHRFFLTTPEYRDLAETCG 272


>UniRef50_A4RRG7 Cluster: Predicted protein; n=3; Viridiplantae|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 703

 Score =  129 bits (311), Expect = 6e-29
 Identities = 58/93 (62%), Positives = 77/93 (82%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI  +I++E+CLILAVTPAN+DLANSDAL L+K+VDP+G RT+GVITKLD+MD GT
Sbjct: 169 QIRNMILSYIKKETCLILAVTPANSDLANSDALTLSKQVDPEGKRTLGVITKLDIMDRGT 228

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           +A   L+ +++PLR GY+GVVNRC+  +   RT
Sbjct: 229 NAVKYLKGEVVPLRLGYVGVVNRCQADIAERRT 261



 Score =  104 bits (250), Expect = 2e-21
 Identities = 45/74 (60%), Positives = 59/74 (79%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EFLH  G+ +TDF E+R EI+AETDR TG+NKG+S   I L++ SPNVL +TL+DLP
Sbjct: 93  EWGEFLHQPGRTYTDFEEIREEIQAETDRTTGNNKGVSNKQIRLKICSPNVLTMTLVDLP 152

Query: 212 GLTKVPIGDQPIDI 253
           G+T+V +GDQP DI
Sbjct: 153 GITRVAVGDQPEDI 166


>UniRef50_Q8S944 Cluster: Dynamin-related protein 3A; n=11;
           Magnoliophyta|Rep: Dynamin-related protein 3A -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 808

 Score =  129 bits (311), Expect = 6e-29
 Identities = 59/93 (63%), Positives = 78/93 (83%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +I+ MI  +I++++CLILAVTPANTDLANSDAL++A  VDP G RTIGVITKLD+MD+GT
Sbjct: 191 RIRTMILSYIKQDTCLILAVTPANTDLANSDALQIASIVDPDGHRTIGVITKLDIMDKGT 250

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           DAR +L   ++PLR GY+GVVNRC++ + + RT
Sbjct: 251 DARKLLLGNVVPLRLGYVGVVNRCQEDILLNRT 283



 Score =  104 bits (250), Expect = 2e-21
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +2

Query: 5   TRQLINGNT--EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSP 178
           T+   NG +  E+ EF H    +F DF+E+R EIEAET+R+ G NKG++   I L++ SP
Sbjct: 104 TKSRANGGSDDEWGEFRHLPETRFYDFSEIRREIEAETNRLVGENKGVADTQIRLKISSP 163

Query: 179 NVLNLTLIDLPGLTKVPIGDQPIDI 253
           NVLN+TL+DLPG+TKVP+GDQP DI
Sbjct: 164 NVLNITLVDLPGITKVPVGDQPSDI 188



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 20/35 (57%), Positives = 23/35 (65%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           Q+DI   + +  AL AE KFF SHP Y  LADRLG
Sbjct: 275 QEDILLNRTVKEALLAEEKFFRSHPVYHGLADRLG 309


>UniRef50_A2E540 Cluster: Dynamin central region family protein;
           n=3; Trichomonas vaginalis G3|Rep: Dynamin central
           region family protein - Trichomonas vaginalis G3
          Length = 639

 Score =  126 bits (305), Expect = 3e-28
 Identities = 57/89 (64%), Positives = 75/89 (84%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q+I  M+ +F+ +  CLILAV+PAN+DLANSDAL+LA++VDP+G RT+GVITK+DLMD G
Sbjct: 156 QEIYDMVKEFVDKPECLILAVSPANSDLANSDALRLARDVDPKGDRTVGVITKIDLMDAG 215

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TD RDVLEN++ PL+ GYIGVVNR +  +
Sbjct: 216 TDCRDVLENRVYPLKLGYIGVVNRSQAAI 244



 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 44/74 (59%), Positives = 54/74 (72%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           EY EF H  GK FTDF ++  EI AETDRVTG+ + +S  PI L+++SPNVLNLTL+DLP
Sbjct: 81  EYGEFAHKPGKIFTDFQKINDEIIAETDRVTGTGRNVSKEPIRLKLWSPNVLNLTLVDLP 140

Query: 212 GLTKVPIGDQPIDI 253
           GLTK  +  QP  I
Sbjct: 141 GLTKNAVEGQPKSI 154


>UniRef50_Q54YU0 Cluster: Dynamin like protein; n=3; Eukaryota|Rep:
           Dynamin like protein - Dictyostelium discoideum AX4
          Length = 853

 Score =  126 bits (303), Expect = 6e-28
 Identities = 56/94 (59%), Positives = 79/94 (84%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQI+ M+  +I++++ +I+AVTPANTDLANSDAL+LAKEVDP+G RTIGVITKLDLMD+G
Sbjct: 156 QQIRRMVMAYIKKQNAIIVAVTPANTDLANSDALQLAKEVDPEGKRTIGVITKLDLMDKG 215

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           TDA +VL  +++PL  G+IGV+NR ++ +   ++
Sbjct: 216 TDAMEVLTGRVIPLTLGFIGVINRSQEDIIAKKS 249



 Score =  109 bits (263), Expect = 4e-23
 Identities = 48/74 (64%), Positives = 60/74 (81%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EFLH     F DF+E+R EI  +TDR+TG NKGIS  PINL++YSP+V+NLTL+DLP
Sbjct: 81  EWGEFLHKPNDMFYDFSEIREEIIRDTDRMTGKNKGISAQPINLKIYSPHVVNLTLVDLP 140

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 141 GITKVPVGDQPTDI 154



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 15/36 (41%), Positives = 24/36 (66%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI  +K I  +L +E  +F +HP Y+ +A+R GT
Sbjct: 241 QEDIIAKKSIRESLKSEILYFKNHPIYKSIANRSGT 276


>UniRef50_A2ET21 Cluster: Dynamin central region family protein;
           n=1; Trichomonas vaginalis G3|Rep: Dynamin central
           region family protein - Trichomonas vaginalis G3
          Length = 594

 Score =  124 bits (298), Expect = 2e-27
 Identities = 55/104 (52%), Positives = 79/104 (75%)
 Frame = +1

Query: 211 GSDKSANR*SAYRYRQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGL 390
           G  K A     +   Q+I+ M+ ++I+ E+ +ILA+TPAN DLANSD+L +A+EVDP G 
Sbjct: 137 GLTKVATEGQPHDLPQKIRAMVMKYIQPENSIILAITPANMDLANSDSLVIAREVDPSGQ 196

Query: 391 RTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           RTIGV+TK+D+MD+GTD  D+L+NK+ PL+ GYIGV+NR +K +
Sbjct: 197 RTIGVLTKIDIMDQGTDCMDILQNKVYPLKLGYIGVINRSQKDI 240



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 40/74 (54%), Positives = 50/74 (67%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           EY  FLH    K+T F+E+  EI AET+R+ G N GIS   I L++YSP V +LTL+DLP
Sbjct: 78  EYGVFLHKPDVKYTLFDEISKEIVAETERLCGEN-GISDDAIGLKIYSPTVPDLTLVDLP 136

Query: 212 GLTKVPIGDQPIDI 253
           GLTKV    QP D+
Sbjct: 137 GLTKVATEGQPHDL 150



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           QKDI+  K +   + +ER+FF++ P YR +A+  G
Sbjct: 237 QKDINDHKPMEKVIESERRFFVTSPIYRDIAEYCG 271


>UniRef50_A7QM20 Cluster: Chromosome undetermined scaffold_123,
           whole genome shotgun sequence; n=3; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_123, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 828

 Score =  123 bits (297), Expect = 3e-27
 Identities = 58/93 (62%), Positives = 75/93 (80%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +I+ MI  +I+  SCLILAVTPAN+DLANSDAL++A   DP G RTIGVITKLD+MD GT
Sbjct: 177 RIRTMIMSYIKLPSCLILAVTPANSDLANSDALQIAGNADPDGYRTIGVITKLDIMDRGT 236

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           DAR++L  K++PLR GYIGVVNR ++ + + R+
Sbjct: 237 DARNLLLGKVIPLRLGYIGVVNRSQEDIIMNRS 269



 Score =  114 bits (274), Expect = 2e-24
 Identities = 49/74 (66%), Positives = 61/74 (82%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           EY EFLH  GKKF DF+E+R EI+AETDR  G NKG+S   I L+++SPNVL++TL+DLP
Sbjct: 101 EYGEFLHLPGKKFFDFSEIRREIQAETDREAGENKGVSDKQIRLKIFSPNVLDITLVDLP 160

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 161 GITKVPVGDQPSDI 174



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           Q+DI   + +  AL AE KFF S P Y  LADR G
Sbjct: 261 QEDIIMNRSVKDALVAEEKFFRSRPVYNGLADRCG 295


>UniRef50_A2XSM8 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 692

 Score =  123 bits (297), Expect = 3e-27
 Identities = 57/93 (61%), Positives = 73/93 (78%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +I+ MI Q+I+  SC+ILAVTPAN DLANSDAL+LAK  DP G RTIGVITKLD+MD GT
Sbjct: 143 RIRSMIMQYIKHPSCIILAVTPANADLANSDALQLAKLADPDGSRTIGVITKLDIMDRGT 202

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           DAR+ L   ++PL+ GY+GVVNR ++ +   R+
Sbjct: 203 DARNFLLGNVIPLKLGYVGVVNRSQEDINFKRS 235



 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 30/49 (61%), Positives = 41/49 (83%)
 Frame = +2

Query: 107 ETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           ETD+  G NKG+S   I L+++SPNVL++TL+DLPG+T+VP+GDQP DI
Sbjct: 92  ETDKEAGGNKGVSEKQIRLKIFSPNVLDITLVDLPGITRVPVGDQPSDI 140


>UniRef50_P54861 Cluster: Dynamin-related protein DNM1; n=5;
           Saccharomycetales|Rep: Dynamin-related protein DNM1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 757

 Score =  123 bits (297), Expect = 3e-27
 Identities = 56/94 (59%), Positives = 75/94 (79%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QIK +I  +I   +CLILAV+PAN DL NS++LKLA+EVDPQG RTIGVITKLDLMD G
Sbjct: 193 KQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSG 252

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           T+A D+L  K+ PL+ G++GVVNR ++ + + +T
Sbjct: 253 TNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKT 286



 Score =  112 bits (269), Expect = 8e-24
 Identities = 49/78 (62%), Positives = 64/78 (82%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           N   E+ EFLH  GK+F DF++++ EIE ET R+ G +KGIS +PINL+V+SP+VLNLTL
Sbjct: 114 NHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTL 173

Query: 200 IDLPGLTKVPIGDQPIDI 253
           +DLPG+TKVPIG+QP DI
Sbjct: 174 VDLPGITKVPIGEQPPDI 191


>UniRef50_Q84Y91 Cluster: Dynamin; n=1; Cyanidioschyzon merolae|Rep:
           Dynamin - Cyanidioschyzon merolae (Red alga)
          Length = 768

 Score =  120 bits (290), Expect = 2e-26
 Identities = 55/76 (72%), Positives = 64/76 (84%)
 Frame = +2

Query: 26  NTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLID 205
           N  YAEFLH  G +F +F++VR EIE ETDRVTG NKGISP  INLRVYSP+V+NLT++D
Sbjct: 111 NQAYAEFLHKPGVRFYNFDDVRAEIERETDRVTGKNKGISPKAINLRVYSPHVVNLTVVD 170

Query: 206 LPGLTKVPIGDQPIDI 253
           LPGLTKVP+GDQP DI
Sbjct: 171 LPGLTKVPVGDQPSDI 186



 Score =  105 bits (253), Expect = 7e-22
 Identities = 47/82 (57%), Positives = 65/82 (79%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           I+ M+  +I R + +ILAV PA  DLA SDAL++A++ DP+G RT+GVITKLDLMD+GTD
Sbjct: 190 IRAMVLSYIERPNAIILAVHPATMDLATSDALQIARQADPEGRRTLGVITKLDLMDKGTD 249

Query: 442 ARDVLENKLLPLRRGYIGVVNR 507
           A ++L  K++PL+ GYIGV+ R
Sbjct: 250 AMEMLTGKVIPLKLGYIGVICR 271



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 18/38 (47%), Positives = 21/38 (55%)
 Frame = +3

Query: 516 DIDGRKDIAAALAAERKFFLSHPSYRHLADRLGTLTTA 629
           D+   K I  A   E +FF SHP YR L  +LGT T A
Sbjct: 275 DLRAGKSIQQAREDEIRFFRSHPVYRRLLPQLGTNTLA 312


>UniRef50_A7SN34 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 718

 Score =  120 bits (290), Expect = 2e-26
 Identities = 54/74 (72%), Positives = 63/74 (85%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K F DFN +R EIE ETDRVTGSNKGIS  PINL++YSP VLNLTL+DLP
Sbjct: 98  EWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLP 157

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP+DI
Sbjct: 158 GVTKVPVGDQPLDI 171



 Score =  110 bits (264), Expect = 3e-23
 Identities = 52/84 (61%), Positives = 66/84 (78%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQI+ +I Q+I   + +ILAVTPAN DLA S+ALK+A+EVDP G RT+ V TKLDLMD G
Sbjct: 173 QQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHG 232

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           TDA DVL  +++P++ G IGVVNR
Sbjct: 233 TDAMDVLYGRVIPVKLGIIGVVNR 256


>UniRef50_Q5KKV8 Cluster: Dynamin protein dnm1, putative; n=14;
           Dikarya|Rep: Dynamin protein dnm1, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 832

 Score =  118 bits (285), Expect = 9e-26
 Identities = 56/85 (65%), Positives = 66/85 (77%), Gaps = 1/85 (1%)
 Frame = +2

Query: 2   GTRQLINGN-TEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSP 178
           G R +  G   EYAEFLH   ++FTDF E+R EIEAET RV G NKG+S +PINL++Y P
Sbjct: 107 GGRSMGEGTGAEYAEFLHIN-RRFTDFEEIRKEIEAETFRVAGQNKGVSKLPINLKIYGP 165

Query: 179 NVLNLTLIDLPGLTKVPIGDQPIDI 253
            VLNLTL+DLPGLTKVP+GDQP DI
Sbjct: 166 GVLNLTLVDLPGLTKVPVGDQPTDI 190



 Score =  116 bits (278), Expect = 6e-25
 Identities = 51/89 (57%), Positives = 72/89 (80%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QIK ++  +I + + +ILAV+PAN DLANSDALKLA+ VDP+GLRT+GV+TKLDLMD G
Sbjct: 192 RQIKNLVLDYISKPNAVILAVSPANVDLANSDALKLARSVDPRGLRTLGVLTKLDLMDAG 251

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           T+A D+L  +  PL+ G++GVVNR ++ +
Sbjct: 252 TNALDILTGRTYPLKLGFVGVVNRSQQDI 280



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 16/36 (44%), Positives = 23/36 (63%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI+    +  A A E +FF +HP YR++A R GT
Sbjct: 277 QQDINENLPMEDARAKEEEFFRTHPVYRNIAHRCGT 312


>UniRef50_P21576 Cluster: Vacuolar protein sorting-associated
           protein 1; n=34; Dikarya|Rep: Vacuolar protein
           sorting-associated protein 1 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 704

 Score =  118 bits (284), Expect = 1e-25
 Identities = 53/74 (71%), Positives = 63/74 (85%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EFLH  GKKF +F+E+R EI  ETD+VTG+N GIS VPINLR+YSP+VL LTL+DLP
Sbjct: 121 EWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLP 180

Query: 212 GLTKVPIGDQPIDI 253
           GLTKVP+GDQP DI
Sbjct: 181 GLTKVPVGDQPPDI 194



 Score =  117 bits (281), Expect = 3e-25
 Identities = 53/94 (56%), Positives = 74/94 (78%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QIK M+ ++I + + +IL+V  ANTDLANSD LKLA+EVDP+G RTIGV+TK+DLMD+G
Sbjct: 196 RQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQG 255

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           TD  D+L  +++PLR GYI V+NR +K +   +T
Sbjct: 256 TDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKT 289



 Score = 40.7 bits (91), Expect = 0.029
 Identities = 20/36 (55%), Positives = 23/36 (63%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           QKDI+ +K I  AL  ERKFF +HPSY   A   GT
Sbjct: 281 QKDIEHKKTIREALENERKFFENHPSYSSKAHYCGT 316


>UniRef50_O00429 Cluster: Dynamin-1-like protein; n=68;
           Coelomata|Rep: Dynamin-1-like protein - Homo sapiens
           (Human)
          Length = 736

 Score =  117 bits (282), Expect = 2e-25
 Identities = 48/74 (64%), Positives = 66/74 (89%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K +TDF+E+R EIE ET+R++G+NKG+SP PI+L+++SPNV+NLTL+DLP
Sbjct: 89  EWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLP 148

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 149 GMTKVPVGDQPKDI 162



 Score =  107 bits (256), Expect = 3e-22
 Identities = 50/83 (60%), Positives = 66/83 (79%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ +I +FI   + +ILAVT ANTD+A S+ALK+++EVDP G RT+ VITKLDLMD GT
Sbjct: 165 QIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGT 224

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA DVL  +++P++ G IGVVNR
Sbjct: 225 DAMDVLMGRVIPVKLGIIGVVNR 247


>UniRef50_A7TFM3 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 797

 Score =  116 bits (279), Expect = 5e-25
 Identities = 53/94 (56%), Positives = 73/94 (77%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI+ +I  +I   +C+ILAV+PAN DL NS++LKLA+EVDP G RTIGVITKLDLMD G
Sbjct: 225 KQIRNLILDYIATPNCIILAVSPANIDLVNSESLKLAREVDPIGKRTIGVITKLDLMDSG 284

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           T A D+L  KL PL+ G++GVVNR ++ + + ++
Sbjct: 285 THALDILSGKLYPLKLGFVGVVNRSQQDIQLNKS 318



 Score =  113 bits (271), Expect = 4e-24
 Identities = 48/74 (64%), Positives = 62/74 (83%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EFLH  GK++ DF  ++ EIE ET+R+ G NKGIS +PINL++YSP+VLNLTL+DLP
Sbjct: 150 EWGEFLHKPGKRYYDFKAIKREIENETERIAGKNKGISKIPINLKIYSPHVLNLTLVDLP 209

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVPIG+QP DI
Sbjct: 210 GITKVPIGEQPPDI 223


>UniRef50_Q09748 Cluster: Dynamin-like protein C12C2.08; n=2;
           Ascomycota|Rep: Dynamin-like protein C12C2.08 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 781

 Score =  115 bits (276), Expect = 1e-24
 Identities = 52/74 (70%), Positives = 61/74 (82%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           +YAEFLH    KFTD N+VR EIE ET RV G+NKGI+ +PINL++YS  VLNLTLIDLP
Sbjct: 113 DYAEFLHIPDTKFTDMNKVRAEIENETLRVAGANKGINKLPINLKIYSTRVLNLTLIDLP 172

Query: 212 GLTKVPIGDQPIDI 253
           GLTK+P+GDQP DI
Sbjct: 173 GLTKIPVGDQPTDI 186



 Score =  105 bits (251), Expect = 1e-21
 Identities = 45/88 (51%), Positives = 67/88 (76%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           Q + +I ++I R + +ILAV+PAN D+ NS+ LKLA+ VDP+G RTIGV+TKLDLMD+GT
Sbjct: 189 QTRSLIMEYISRPNSIILAVSPANFDIVNSEGLKLARSVDPKGKRTIGVLTKLDLMDQGT 248

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           +A D+L  ++ PL+ G++  VNR +  +
Sbjct: 249 NAMDILSGRVYPLKLGFVATVNRSQSDI 276



 Score = 39.9 bits (89), Expect = 0.050
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI   K +  AL +ER FF  HP+YR + DR GT
Sbjct: 273 QSDIVSHKSMRDALQSERSFFEHHPAYRTIKDRCGT 308


>UniRef50_UPI0000498C03 Cluster: dynamin-like protein; n=3;
           Entamoeba histolytica HM-1:IMSS|Rep: dynamin-like
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 671

 Score =  113 bits (272), Expect = 3e-24
 Identities = 52/83 (62%), Positives = 67/83 (80%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           Q+K M+ +FI R + +ILAVT AN DLA SDAL +A+EVDP G RTIGV+TK+D+MD+GT
Sbjct: 142 QLKQMVLKFIERPNAIILAVTSANVDLATSDALSIAREVDPDGDRTIGVLTKMDIMDKGT 201

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA DVL  ++ PL+ GYIGV+NR
Sbjct: 202 DAMDVLYGRVYPLKLGYIGVLNR 224



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 33/74 (44%), Positives = 45/74 (60%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EF H  G  + DF E++ EIE ET            + I L++YSP V++LTL+DLP
Sbjct: 77  EWGEFAHKPGIVYRDFEEIKKEIENETI-----------LAIRLKIYSPYVVDLTLVDLP 125

Query: 212 GLTKVPIGDQPIDI 253
           GLTK+ +G Q  DI
Sbjct: 126 GLTKISVGSQEKDI 139



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 17/35 (48%), Positives = 22/35 (62%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           Q DID    I  AL  E+++F +HP Y  +ADRLG
Sbjct: 226 QHDIDTNVPIKTALTKEKEWFSNHPIYSKIADRLG 260


>UniRef50_A3LNY6 Cluster: Predicted protein; n=7; Ascomycota|Rep:
           Predicted protein - Pichia stipitis (Yeast)
          Length = 822

 Score =  113 bits (272), Expect = 3e-24
 Identities = 46/90 (51%), Positives = 74/90 (82%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +Q + +I +++ + +C+ILAV+PAN DL NS++LKLA++VDP G RT+GV+TKLDLMD+G
Sbjct: 197 KQTRNLILEYVSKPNCIILAVSPANVDLVNSESLKLARQVDPTGKRTVGVLTKLDLMDQG 256

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLT 525
           T+A D+L+  + PL+ G+IG+VNR ++ ++
Sbjct: 257 TNALDILKGNVYPLKLGFIGIVNRSQQDIS 286



 Score =  112 bits (270), Expect = 6e-24
 Identities = 49/74 (66%), Positives = 61/74 (82%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EFLH   K+F +F+++R EIE ET R+ G NKGIS +PINL++YSP VLNLTL+DLP
Sbjct: 122 EWGEFLHIPHKRFYNFSDIRREIENETHRIAGQNKGISRLPINLKIYSPRVLNLTLVDLP 181

Query: 212 GLTKVPIGDQPIDI 253
           GLTK+PIGDQP DI
Sbjct: 182 GLTKIPIGDQPTDI 195



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 13/36 (36%), Positives = 24/36 (66%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI   K +  +L +E++FF +H +YR ++ + GT
Sbjct: 282 QQDISDNKSLDDSLFSEQQFFQNHTAYRSMSSKCGT 317


>UniRef50_A4I4S9 Cluster: GTP-binding protein, putative; n=7;
           Trypanosomatidae|Rep: GTP-binding protein, putative -
           Leishmania infantum
          Length = 700

 Score =  113 bits (271), Expect = 4e-24
 Identities = 48/89 (53%), Positives = 75/89 (84%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QIK M+ +++  ++ +ILA++PANTDLA S +L+LAK++DP+G+RT+GV+TK+DLMD+G
Sbjct: 152 RQIKDMVTRYVSPKNTIILAISPANTDLATSQSLRLAKQLDPEGVRTVGVLTKIDLMDKG 211

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TD  DVL+NK+L LR G++GVV R ++ +
Sbjct: 212 TDCFDVLQNKVLQLRHGFVGVVCRSQQDI 240



 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 40/74 (54%), Positives = 50/74 (67%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EFLH   KKF DFNE++ EI   T  + G +  I+  PI+L+VYS  VLNLTL+DLP
Sbjct: 78  EWGEFLHIPNKKFYDFNEIQNEITRRTIEMAGPS-AITDKPISLKVYSNTVLNLTLVDLP 136

Query: 212 GLTKVPIGDQPIDI 253
           GL    +GDQP DI
Sbjct: 137 GLVMNAVGDQPKDI 150



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI+ RK + AA  +E +FF + P Y  +A+  GT
Sbjct: 237 QQDINDRKSMEAARRSEYEFFANSPIYSPIAEEAGT 272


>UniRef50_Q1E570 Cluster: Dynamin-related protein; n=3;
           Pezizomycotina|Rep: Dynamin-related protein -
           Coccidioides immitis
          Length = 791

 Score =  111 bits (268), Expect = 1e-23
 Identities = 51/83 (61%), Positives = 65/83 (78%)
 Frame = +2

Query: 5   TRQLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNV 184
           T   + G  E+AEF H  G+K+ DF +V+ EIE ET R+ G+NKGI+  PINL+++SP+V
Sbjct: 93  TAASVAGQGEWAEFHHQPGRKYEDFAQVKQEIENETARIAGNNKGINRQPINLKIFSPHV 152

Query: 185 LNLTLIDLPGLTKVPIGDQPIDI 253
           LNLTL+DLPGLTKVPIGDQP DI
Sbjct: 153 LNLTLVDLPGLTKVPIGDQPSDI 175



 Score =  109 bits (261), Expect = 7e-23
 Identities = 49/89 (55%), Positives = 70/89 (78%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +Q + +I ++I + + +ILAV+PAN DL NS+ALKLA+ VDP G RTIGV+TKLDLMD G
Sbjct: 177 KQTRNLISEYIAKPNSIILAVSPANVDLVNSEALKLARHVDPVGKRTIGVLTKLDLMDHG 236

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           T+A D+L  ++ PL+ G+IGVVNR ++ +
Sbjct: 237 TNAMDILTGRVYPLKLGFIGVVNRSQQDI 265



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 20/36 (55%), Positives = 26/36 (72%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI G K +A AL AE +FF  HP+YR++A R GT
Sbjct: 262 QQDIQGGKPLADALKAEAEFFRHHPAYRNMAIRCGT 297


>UniRef50_Q9FNX5 Cluster: Dynamin-related protein 1E; n=47;
           Magnoliophyta|Rep: Dynamin-related protein 1E -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 624

 Score =  111 bits (266), Expect = 2e-23
 Identities = 52/75 (69%), Positives = 60/75 (80%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           +G  EYAEFLH   K+FTDF  VR EI+ ETDR+TG NK ISPVPI+L +YSPNV+NLTL
Sbjct: 87  DGTEEYAEFLHLPKKQFTDFALVRREIQDETDRITGKNKQISPVPIHLSIYSPNVVNLTL 146

Query: 200 IDLPGLTKVPIGDQP 244
           IDLPGLTKV +  QP
Sbjct: 147 IDLPGLTKVAVEGQP 161



 Score =  101 bits (243), Expect = 1e-20
 Identities = 44/84 (52%), Positives = 66/84 (78%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           + I+ M+  ++ + +C+ILA++PAN D+A SDA+KLAK+VDP G RT GV+TKLDLMD+G
Sbjct: 166 EDIESMVRTYVDKPNCIILAISPANQDIATSDAIKLAKDVDPTGERTFGVLTKLDLMDKG 225

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           T+A +VLE +   L+  ++G+VNR
Sbjct: 226 TNALEVLEGRSYRLQHPWVGIVNR 249



 Score = 32.7 bits (71), Expect = 7.6
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI+   D+  A   ER++F + P Y HLA ++G+
Sbjct: 251 QADINKNVDMMLARRKEREYFDTSPDYGHLASKMGS 286


>UniRef50_Q4UDK3 Cluster: Dynamin-like protein, putative; n=3;
           Piroplasmida|Rep: Dynamin-like protein, putative -
           Theileria annulata
          Length = 705

 Score =  109 bits (263), Expect = 4e-23
 Identities = 48/83 (57%), Positives = 69/83 (83%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ MI ++I + +C+ILA++ ANTD+A SD+LK+A+EVDP GLRTIGVITK D++D+G 
Sbjct: 151 QIRQMILEYITKPTCIILALSAANTDIATSDSLKMAREVDPSGLRTIGVITKCDMLDKGV 210

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DA ++L+ K+  LR+GY+GVV R
Sbjct: 211 DAIELLQGKIYKLRKGYVGVVCR 233



 Score =  104 bits (249), Expect = 2e-21
 Identities = 44/78 (56%), Positives = 62/78 (79%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           NG+++Y EF H +G  + DF +++ EI+ ET+R+TGS K +SPVPI L++ SP V++LTL
Sbjct: 71  NGSSDYGEFAHKRGTIYDDFQKIKEEIKLETERITGSTKNVSPVPIFLKITSPKVIDLTL 130

Query: 200 IDLPGLTKVPIGDQPIDI 253
           IDLPG+TKVP+GDQ  DI
Sbjct: 131 IDLPGITKVPVGDQTNDI 148


>UniRef50_Q54XV5 Cluster: Dynamin B; n=2; Dictyostelium
           discoideum|Rep: Dynamin B - Dictyostelium discoideum AX4
          Length = 920

 Score =  109 bits (262), Expect = 5e-23
 Identities = 50/89 (56%), Positives = 68/89 (76%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           ++IK MI  +I   + +ILA+TPAN D+  SDALKLA++VDP G RTIGV+TKLDLMD+G
Sbjct: 308 EKIKSMIIDYISNPNSIILAITPANQDIVTSDALKLAQQVDPLGKRTIGVLTKLDLMDKG 367

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDA D+L    +PL  G++GVVNR ++ +
Sbjct: 368 TDAIDILLGNSIPLSLGFVGVVNRSQQDI 396



 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 42/78 (53%), Positives = 54/78 (69%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           N   E+ EF H    +F +F E++ EIE ET+R+ G NK IS  PI L++YSP V+ LTL
Sbjct: 230 NSLEEWGEFGHTGTNRF-NFQEIKEEIERETERIAGPNKDISSEPIVLKIYSPKVVPLTL 288

Query: 200 IDLPGLTKVPIGDQPIDI 253
           +DLPGLT+V I DQP DI
Sbjct: 289 VDLPGLTRVAIEDQPPDI 306



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI+ RK I   LA E K+F  HP Y  + ++LGT
Sbjct: 393 QQDINNRKPIEQMLADEWKWFDQHPVYHRITNQLGT 428


>UniRef50_A7E8I0 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 812

 Score =  109 bits (262), Expect = 5e-23
 Identities = 48/74 (64%), Positives = 62/74 (83%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+AEF H   ++FT+F +V+ EIE ET R+ G+NKGI+  PINL++YSP+VL+LTL+DLP
Sbjct: 96  EWAEFHHIPNRRFTEFQDVKREIENETARIAGNNKGINRSPINLKIYSPHVLSLTLVDLP 155

Query: 212 GLTKVPIGDQPIDI 253
           GLTKVPIGDQP DI
Sbjct: 156 GLTKVPIGDQPTDI 169



 Score =  108 bits (259), Expect = 1e-22
 Identities = 48/94 (51%), Positives = 72/94 (76%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +Q + +I ++I + + +ILAV+PAN D+ NS+ALKLA+ VDP G RTIGV+TK+DLMD G
Sbjct: 171 KQTRNLISEYIAKPNSIILAVSPANVDIVNSEALKLARHVDPLGRRTIGVLTKIDLMDHG 230

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           T+A D+L  ++ PL+ G+IGVVNR ++ +   +T
Sbjct: 231 TNAMDILSGRVYPLKLGFIGVVNRSQQDIQGNKT 264



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 18/36 (50%), Positives = 26/36 (72%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI G K ++ AL +E  FF  HP+YR++A+R GT
Sbjct: 256 QQDIQGNKTLSEALKSEADFFKHHPAYRNMANRCGT 291


>UniRef50_Q8ITV0 Cluster: Dynamin-related protein; n=1; Trypanosoma
           brucei|Rep: Dynamin-related protein - Trypanosoma brucei
          Length = 659

 Score =  109 bits (261), Expect = 7e-23
 Identities = 51/111 (45%), Positives = 76/111 (68%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QIK M+ ++I   + +ILA++PAN DLA S +L++AK++DP+G RTI V+TKLDLMD G
Sbjct: 152 RQIKSMVTRYISPSNTIILAISPANADLATSSSLQIAKQLDPEGERTIAVLTKLDLMDRG 211

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLTVART*PLHLRLRENSSLATRH 588
           TDA D+L  K L LR G++GVV R +  +  ++     + ++ N    TRH
Sbjct: 212 TDAYDILTGKGLSLRHGFVGVVTRSQHDINTSKGCKRLVTMKRNFFATTRH 262



 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 40/74 (54%), Positives = 51/74 (68%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EFLH   KKF DF+E+  EI+  T  V G +  I+  PINL++YS +VLNLTL+DLP
Sbjct: 78  EWGEFLHRPNKKFFDFSEINEEIQNRTTEVAG-HSAITDKPINLKIYSSHVLNLTLVDLP 136

Query: 212 GLTKVPIGDQPIDI 253
           GL    +GDQP DI
Sbjct: 137 GLVMNAVGDQPKDI 150


>UniRef50_A2FR27 Cluster: Dynamin central region family protein;
           n=2; Trichomonas vaginalis G3|Rep: Dynamin central
           region family protein - Trichomonas vaginalis G3
          Length = 611

 Score =  109 bits (261), Expect = 7e-23
 Identities = 52/89 (58%), Positives = 66/89 (74%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           + I GM+ QF  + S LILAVTPAN DLANSD+L LA +VDP G RTIGV+TK+DLMD G
Sbjct: 151 EMIHGMVMQFAMKPSSLILAVTPANQDLANSDSLLLASQVDPAGDRTIGVLTKVDLMDAG 210

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TD   +L  ++ PL+ GYI VVNR ++ +
Sbjct: 211 TDCGAILRGEVKPLKLGYIAVVNRSQRDI 239



 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 42/70 (60%), Positives = 54/70 (77%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           +Y EFLH  GKKF +F+++R EI+AETDR TGSNK +S  PINL +   +V NLT++DLP
Sbjct: 76  QYGEFLHLPGKKFKNFSDIRTEIQAETDRSTGSNKNVSSQPINLCIRDSSVPNLTMVDLP 135

Query: 212 GLTKVPIGDQ 241
           GLTKV + DQ
Sbjct: 136 GLTKVAVADQ 145



 Score = 36.3 bits (80), Expect = 0.62
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGTLTTAS 632
           Q+DID  + +  A  AE +FF  HP Y+H+ ++  T   A+
Sbjct: 236 QRDIDNNRPMKDAQRAELEFFEKHPVYKHMTEKCTTKVLAN 276


>UniRef50_UPI00015B42FC Cluster: PREDICTED: similar to dynamin; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to dynamin -
           Nasonia vitripennis
          Length = 684

 Score =  107 bits (258), Expect = 2e-22
 Identities = 46/74 (62%), Positives = 62/74 (83%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+  FLH K + + DF+++R EIE+ETDR+ G+NKGI P PINL+++S +V+NLTLIDLP
Sbjct: 89  EWGTFLHQKNRIYKDFDQIRQEIESETDRMAGANKGICPEPINLKIFSKSVVNLTLIDLP 148

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 149 GITKVPVGDQPEDI 162



 Score =  101 bits (242), Expect = 1e-20
 Identities = 46/93 (49%), Positives = 70/93 (75%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ ++ ++I   + +ILAV  ANTD+A S++LKL+K+VDP G RT+ V+TKLDLMD GT
Sbjct: 165 QIRQLVLKYICNPNSIILAVVTANTDMATSESLKLSKDVDPDGRRTLAVVTKLDLMDAGT 224

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           DA D+L  +++P++ G IGVVNR ++ +   +T
Sbjct: 225 DAIDILCGRVIPVKLGIIGVVNRSQQDIMNKKT 257


>UniRef50_UPI0000E4A0DD Cluster: PREDICTED: similar to Dynamin 2,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Dynamin 2, partial -
           Strongylocentrotus purpuratus
          Length = 510

 Score =  107 bits (256), Expect = 3e-22
 Identities = 49/57 (85%), Positives = 51/57 (89%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPN 181
           QL N  TEY EFLHCKGKKFTDF+E+R EIEAETDRVTGSNKGIS VPINLRVYSPN
Sbjct: 72  QLNNSKTEYGEFLHCKGKKFTDFDEIRKEIEAETDRVTGSNKGISNVPINLRVYSPN 128



 Score = 86.6 bits (205), Expect = 4e-16
 Identities = 42/69 (60%), Positives = 55/69 (79%)
 Frame = +1

Query: 316 VTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIG 495
           VT +N  ++N   + L +   P G+RTIGVITKLDLMD+GTDA+D+LENKLLPLRRGY+G
Sbjct: 108 VTGSNKGISNVP-INL-RVYSPNGVRTIGVITKLDLMDDGTDAKDILENKLLPLRRGYVG 165

Query: 496 VVNRCRKTL 522
           VVNR ++ +
Sbjct: 166 VVNRSQRDI 174



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 29/36 (80%), Positives = 35/36 (97%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI+G+KDI AALAAERKFFLSHPSYRH+AD++GT
Sbjct: 171 QRDIEGKKDIKAALAAERKFFLSHPSYRHIADKMGT 206


>UniRef50_Q4RHK0 Cluster: Chromosome 19 SCAF15045, whole genome
            shotgun sequence; n=3; Tetraodon nigroviridis|Rep:
            Chromosome 19 SCAF15045, whole genome shotgun sequence -
            Tetraodon nigroviridis (Green puffer)
          Length = 1807

 Score =  106 bits (255), Expect = 4e-22
 Identities = 47/83 (56%), Positives = 65/83 (78%)
 Frame = +1

Query: 259  QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
            Q++ +I + I   +C+ILAVT ANTD+A S+ALK+A+EVDP G RT+ V+TKLDLMD GT
Sbjct: 1117 QVRDLILKHISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGT 1176

Query: 439  DARDVLENKLLPLRRGYIGVVNR 507
            DA D L  +++P++ G +GVVNR
Sbjct: 1177 DATDALTGRVVPVKLGLVGVVNR 1199



 Score =  101 bits (243), Expect = 1e-20
 Identities = 42/62 (67%), Positives = 58/62 (93%)
 Frame = +2

Query: 68   FTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPI 247
            FTDFN++R EIE+ET+R++G+NKGIS  PI+L+++SP+V+NLTL+DLPG+TKVP+GDQP 
Sbjct: 1053 FTDFNDIRQEIESETERLSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPK 1112

Query: 248  DI 253
            DI
Sbjct: 1113 DI 1114


>UniRef50_Q8WQC9 Cluster: Dynamin related protein protein 1, isoform
           b; n=3; Caenorhabditis|Rep: Dynamin related protein
           protein 1, isoform b - Caenorhabditis elegans
          Length = 712

 Score =  105 bits (253), Expect = 7e-22
 Identities = 50/89 (56%), Positives = 67/89 (75%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI+ MI  +I   S +ILAVTPAN D A S+ +KLA+EVD  G RT+ V+TKLDLMD+G
Sbjct: 166 EQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQG 225

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDA DVL  K++P++ G IGVVNR ++ +
Sbjct: 226 TDAMDVLMGKVIPVKLGIIGVVNRSQQNI 254



 Score =  102 bits (244), Expect = 8e-21
 Identities = 45/74 (60%), Positives = 61/74 (82%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           ++A F H   K FTDF+ VR EIE ETDRVTG NKGIS +PI+L++YS  V++L+L+DLP
Sbjct: 91  DWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLP 150

Query: 212 GLTKVPIGDQPIDI 253
           G+TK+P+GDQP++I
Sbjct: 151 GITKIPVGDQPVNI 164


>UniRef50_UPI0000499BF9 Cluster: dynamin-like protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: dynamin-like
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 663

 Score =  105 bits (251), Expect = 1e-21
 Identities = 47/89 (52%), Positives = 69/89 (77%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           + ++ M++++    + LILAVT  N D+ANSDAL++AK+VDP G RTIGV+TKLDL D+G
Sbjct: 150 KNLRDMVYEYASPSNALILAVTAGNIDIANSDALQVAKDVDPDGERTIGVLTKLDLEDKG 209

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           T++ DVL  ++ PL+ GYIGVVNR ++ +
Sbjct: 210 TNSMDVLMGRVYPLKLGYIGVVNRSQQDI 238



 Score = 79.0 bits (186), Expect = 9e-14
 Identities = 37/74 (50%), Positives = 51/74 (68%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           +Y +F H   +KFTDF E+R EI  ET+R T   + +S VPI LR+YS +V++LTL+DLP
Sbjct: 76  DYGQFEHTGDRKFTDFGEIRNEITRETER-TCPGRNVSSVPIRLRIYSSSVVDLTLVDLP 134

Query: 212 GLTKVPIGDQPIDI 253
           GL KV I  Q  ++
Sbjct: 135 GLVKVNINGQTAEM 148



 Score = 37.5 bits (83), Expect = 0.27
 Identities = 15/36 (41%), Positives = 25/36 (69%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI+   D+  +L  E++FF +HP Y  +A+R+GT
Sbjct: 235 QQDINNGVDVKTSLRHEKEFFENHPVYCSIAERMGT 270


>UniRef50_Q3SEL2 Cluster: Dynamin-related protein,putative; n=4;
           Paramecium|Rep: Dynamin-related protein,putative -
           Paramecium tetraurelia
          Length = 713

 Score =  101 bits (243), Expect = 1e-20
 Identities = 49/94 (52%), Positives = 69/94 (73%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q++  ++  FI  ++ LILAV+ A+ DLA SD LKLA+ VDP G+RTIGVIT+LDLMDEG
Sbjct: 152 QKVLDIVMPFINNQNSLILAVSKASDDLATSDGLKLARSVDPNGVRTIGVITQLDLMDEG 211

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           +DA + L N+  PL+ GY+GV+ R +K +   +T
Sbjct: 212 SDALNDLLNQTYPLQLGYVGVIMRGQKDIQKNKT 245



 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 40/81 (49%), Positives = 60/81 (74%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           Q+++    + EF+  KG+K  +  ++R  IE+ETD+V G NKGISP PI ++ +S ++L+
Sbjct: 70  QVLDAELGWFEFMDKKGEKIFESEDIRKLIESETDKVAGKNKGISPAPIKVKYFSKDILD 129

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           L LIDLPG+TK P+GDQP+DI
Sbjct: 130 LQLIDLPGITKNPVGDQPLDI 150


>UniRef50_A3FQ98 Cluster: Dynamin-related protein, putative; n=3;
           Cryptosporidium|Rep: Dynamin-related protein, putative -
           Cryptosporidium parvum Iowa II
          Length = 784

 Score =  101 bits (243), Expect = 1e-20
 Identities = 47/74 (63%), Positives = 57/74 (77%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           +YAEF H KG KFTDF +V+ EI  ET+R+ G NK +S VPI LR++S   +NLTL+DLP
Sbjct: 87  DYAEFGHKKGLKFTDFEKVKEEILIETNRLIGENKNVSEVPILLRIFSKKAINLTLVDLP 146

Query: 212 GLTKVPIGDQPIDI 253
           GLTKVPI DQP DI
Sbjct: 147 GLTKVPIEDQPFDI 160



 Score =  101 bits (243), Expect = 1e-20
 Identities = 45/83 (54%), Positives = 64/83 (77%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ ++  +IRR SCLILA+T ANTD+ANSD+L +A+EVDP+G+RTIGV++KLD ++  +
Sbjct: 163 QIRKIVLSYIRRPSCLILAITAANTDIANSDSLNIAREVDPEGIRTIGVLSKLDTVENYS 222

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
               VL N+  PL RGY+ V+ R
Sbjct: 223 TTLQVLSNQSYPLNRGYVAVMCR 245


>UniRef50_Q675Z6 Cluster: Dynamin-related protein 1; n=1; Oikopleura
           dioica|Rep: Dynamin-related protein 1 - Oikopleura
           dioica (Tunicate)
          Length = 665

 Score =  101 bits (242), Expect = 1e-20
 Identities = 46/83 (55%), Positives = 65/83 (78%), Gaps = 2/83 (2%)
 Frame = +2

Query: 11  QLINGNT--EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNV 184
           ++++G T  E+A F H  G+ F D+ EV+ EIE ET+R  GSNK +S  PI+L+ YSPNV
Sbjct: 75  EVVDGETHSEWAVFHHKPGEIFVDWEEVKKEIEDETERECGSNKAVSRKPISLKFYSPNV 134

Query: 185 LNLTLIDLPGLTKVPIGDQPIDI 253
           L+LT++DLPG+T+VP+GDQP+DI
Sbjct: 135 LSLTIVDLPGVTRVPVGDQPLDI 157



 Score =   99 bits (238), Expect = 4e-20
 Identities = 53/110 (48%), Positives = 70/110 (63%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +Q+  MI  +I + + LILAVTPANTD A SDA+ LA+ VDP+G RT+ VITKLDLMD G
Sbjct: 159 KQLTDMIMHYIEKPNTLILAVTPANTDFATSDAINLARVVDPEGHRTLAVITKLDLMDGG 218

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLTVART*PLHLRLRENSSLATR 585
           TDA D+L  ++  +  G IGVV  CR    +    PL   L++  +   R
Sbjct: 219 TDAMDILCGRVFSVSLGIIGVV--CRSQADLNSKKPLEKALQKERAFFQR 266


>UniRef50_Q38KF4 Cluster: Drp7p; n=2; Tetrahymena thermophila|Rep:
           Drp7p - Tetrahymena thermophila
          Length = 788

 Score =   99 bits (238), Expect = 4e-20
 Identities = 45/91 (49%), Positives = 69/91 (75%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQI  +I  +I+  + +I+AV+  + DLANS++LKL++++DPQG RTIGVIT+LDL+DEG
Sbjct: 152 QQILNLIEPYIKNPNSIIMAVSKGSDDLANSESLKLSRKIDPQGNRTIGVITQLDLIDEG 211

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTLTV 528
            D  + L+NK  PL+ GY+GV+ R +K + +
Sbjct: 212 ADVLNDLQNKTYPLKLGYVGVIMRGQKDIKI 242



 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 39/78 (50%), Positives = 56/78 (71%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           N   +Y EF   +G+K TD ++VR  I+ +T+++ G NK IS VP+ L+ YS NV++L L
Sbjct: 73  NAEQDYVEFSERRGEKITDMDQVRKMIDEDTEKIAGKNKAISNVPLRLKFYSKNVVDLIL 132

Query: 200 IDLPGLTKVPIGDQPIDI 253
           +DLPG+TK P+GDQP DI
Sbjct: 133 VDLPGMTKNPVGDQPQDI 150


>UniRef50_Q9BJC6 Cluster: Dynamin-like protein; n=3; Plasmodium|Rep:
           Dynamin-like protein - Plasmodium falciparum
          Length = 837

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 49/110 (44%), Positives = 72/110 (65%)
 Frame = +1

Query: 265 KGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDA 444
           + M  ++++    +ILAV PAN D++ SDAL++A++VDP+GLRTIGVITK+DLMD+G DA
Sbjct: 163 RDMALRYVKDPRTIILAVLPANADMSTSDALQIARKVDPKGLRTIGVITKIDLMDKGADA 222

Query: 445 RDVLENKLLPLRRGYIGVVNRCRKTLTVART*PLHLRLRENSSLATRHTV 594
             +L N  + LR GY GVVNR    +   +T  +   L++      +H V
Sbjct: 223 SKMLLNDEINLRLGYTGVVNRSTADIKKGKT--ISQALKDELEFFQKHPV 270



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 39/75 (52%), Positives = 50/75 (66%), Gaps = 2/75 (2%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPG 214
           +A F + K KK+TDFNEVR +I   TD + G NKGI   PI L +YS    +L+LIDLPG
Sbjct: 84  WAVFENEKNKKYTDFNEVREQINRLTDEIAGKNKGIIDEPIVLNIYSIKCPDLSLIDLPG 143

Query: 215 LTKVPI--GDQPIDI 253
           +T+VP+   DQ  DI
Sbjct: 144 ITRVPLKNSDQTDDI 158


>UniRef50_Q4N2Q1 Cluster: Dynamin, putative; n=3; Piroplasmida|Rep:
           Dynamin, putative - Theileria parva
          Length = 780

 Score = 95.9 bits (228), Expect = 7e-19
 Identities = 45/87 (51%), Positives = 62/87 (71%)
 Frame = +1

Query: 265 KGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDA 444
           K MI ++      +ILAV  AN D++ SDAL+LAK  DP G+RT+GVITK+DLMD+G+ A
Sbjct: 165 KDMIMRYASDPRTIILAVVAANVDMSTSDALQLAKRADPLGVRTLGVITKIDLMDQGSSA 224

Query: 445 RDVLENKLLPLRRGYIGVVNRCRKTLT 525
             +L+N  +PLR GY GV NR +K ++
Sbjct: 225 LSMLQNDEVPLRLGYTGVKNRSQKDIS 251



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 30/66 (45%), Positives = 42/66 (63%), Gaps = 2/66 (3%)
 Frame = +2

Query: 62  KKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPI--G 235
           ++F DF + R  I+  T+   G  KGI   PI L V+SP+  +L+LIDLPG+T+VP+   
Sbjct: 95  ERFYDFEKARNHIQKLTNERAGEKKGIVDDPIVLSVFSPDCPDLSLIDLPGVTRVPLKNS 154

Query: 236 DQPIDI 253
           DQ  DI
Sbjct: 155 DQTDDI 160


>UniRef50_Q8SR00 Cluster: DYNAMIN-LIKE VACUOLAR PROTEIN SORTING
           PROTEIN; n=1; Encephalitozoon cuniculi|Rep: DYNAMIN-LIKE
           VACUOLAR PROTEIN SORTING PROTEIN - Encephalitozoon
           cuniculi
          Length = 628

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 47/110 (42%), Positives = 76/110 (69%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +I  M  +++  ++ LILAV+ ANTD++NSDAL+LA+EVD    RTIGV+TK+DLMD GT
Sbjct: 151 KITEMCRKYVSNKNALILAVSSANTDISNSDALQLAREVDHNYERTIGVLTKVDLMDSGT 210

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTLTVART*PLHLRLRENSSLATRH 588
           D  DVL  +++ L+ G++ VVNR ++ +   ++  +H  L++  +  + H
Sbjct: 211 DVVDVLAGRIICLKLGFVPVVNRGQQDIEKGKS--IHQALKDEEAFFSSH 258



 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 44/82 (53%), Positives = 54/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  QLINGNTE-YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVL 187
           QLI+   E YA F H    ++TDF EVR EI  ET++V  S   +SP+PI L+ YS  VL
Sbjct: 67  QLIHSKGEDYAVFNHLPEARYTDFGEVRKEIIKETNKVLKSKNDVSPLPITLKYYSSKVL 126

Query: 188 NLTLIDLPGLTKVPIGDQPIDI 253
            LTL+DLPGL +VP  DQP DI
Sbjct: 127 TLTLVDLPGLVRVPTNDQPRDI 148



 Score = 33.1 bits (72), Expect = 5.8
 Identities = 18/37 (48%), Positives = 20/37 (54%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGTL 620
           Q+DI+  K I  AL  E  FF SH SYR      GTL
Sbjct: 235 QQDIEKGKSIHQALKDEEAFFSSHESYRRNKAYCGTL 271


>UniRef50_Q38KF7 Cluster: Drp1p; n=5; Oligohymenophorea|Rep: Drp1p -
           Tetrahymena thermophila
          Length = 645

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 43/86 (50%), Positives = 61/86 (70%)
 Frame = +1

Query: 265 KGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDA 444
           K M + +I+ E  +IL V P N D++NSD L+LA+EVD +G RTIGV+TKLD+MD  TDA
Sbjct: 172 KDMAYSYIKDERTIILCVVPGNQDISNSDGLQLAREVDREGNRTIGVVTKLDIMDADTDA 231

Query: 445 RDVLENKLLPLRRGYIGVVNRCRKTL 522
           R ++    +PL+ GY+GV  R +K +
Sbjct: 232 RKMIMGLEIPLKLGYVGVKGRSQKDI 257



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 32/68 (47%), Positives = 48/68 (70%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPG 214
           YA F   K KK+ +F++VR +I+  TD+V G  K I   PI L +YS +V++LT+IDLPG
Sbjct: 93  YAIFDVDKSKKWENFDQVRQQIDFLTDQVAGKRKKIINDPIVLTIYSNDVIDLTIIDLPG 152

Query: 215 LTKVPIGD 238
           +T++P+ D
Sbjct: 153 ITRIPLKD 160


>UniRef50_Q0ZIJ3 Cluster: Interferon-induced Mx protein; n=4;
           Percomorpha|Rep: Interferon-induced Mx protein -
           Epinephelus coioides (Orange-spotted grouper)
          Length = 644

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 42/87 (48%), Positives = 66/87 (75%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK +I ++I R+  +IL V P N D+A ++ALK+A+EVDP G RT+G++TK DL+DEGT
Sbjct: 180 QIKQLIHKYITRQETIILVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDEGT 239

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCR 513
           + +  D++ N+++PL+ GY  ++ RCR
Sbjct: 240 EEKVVDIVHNEIIPLKMGY--MIVRCR 264



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 23/63 (36%), Positives = 37/63 (58%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           K  D  +V   I    D++ G   GIS   I++++ SP+V +L LIDLPG+++V +  Q 
Sbjct: 115 KIEDPEDVEEMIREAQDKLAGDGLGISNDLISVKITSPDVPDLMLIDLPGISRVALQGQD 174

Query: 245 IDI 253
            +I
Sbjct: 175 ENI 177


>UniRef50_Q4SCL2 Cluster: Chromosome 12 SCAF14652, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 12 SCAF14652, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 412

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 42/66 (63%), Positives = 52/66 (78%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+  FLHCK + FTDF E+R EIEAET+R +G  KGIS  PI L+++SP VLNLTL+DLP
Sbjct: 87  EWGVFLHCKNQIFTDFLEIRQEIEAETERGSGDKKGISSEPIYLKIFSPKVLNLTLVDLP 146

Query: 212 GLTKVP 229
           G+TK P
Sbjct: 147 GITKGP 152


>UniRef50_Q1JSC9 Cluster: DyNamin-like protein, putative; n=11;
           Apicomplexa|Rep: DyNamin-like protein, putative -
           Toxoplasma gondii
          Length = 835

 Score = 92.7 bits (220), Expect = 7e-18
 Identities = 43/79 (54%), Positives = 58/79 (73%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARD 450
           M  ++      +ILAV PAN D++ SDAL++++ VDP+G+RTIGVITK+DLMD GTDA  
Sbjct: 173 MALRYASDPRTIILAVIPANVDMSTSDALQMSRRVDPRGVRTIGVITKIDLMDRGTDAAK 232

Query: 451 VLENKLLPLRRGYIGVVNR 507
           +L  + +PLR GY GV NR
Sbjct: 233 MLMGEEIPLRLGYTGVRNR 251



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 38/78 (48%), Positives = 50/78 (64%), Gaps = 2/78 (2%)
 Frame = +2

Query: 26  NTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLID 205
           N  YA F + K +K  DF +VR EI+  TD+V G NKGI   PI L +Y+    +L+LID
Sbjct: 89  NEAYAVFENDKERKIRDFEQVRQEIDRLTDQVAGKNKGIIDSPIVLTIYATQCPDLSLID 148

Query: 206 LPGLTKVPI--GDQPIDI 253
           LPG+T+VP+   DQ  DI
Sbjct: 149 LPGITRVPLKGSDQCEDI 166


>UniRef50_Q3SEK6 Cluster: Dynamin-related protein, putative; n=3;
           Paramecium tetraurelia|Rep: Dynamin-related protein,
           putative - Paramecium tetraurelia
          Length = 691

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 42/84 (50%), Positives = 61/84 (72%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARD 450
           M   + + E  +ILAV PAN DL+ SD L+LA ++DP G RT+GVITK+D+MD+GTD R 
Sbjct: 169 MATHYCQDERTIILAVCPANQDLSTSDGLQLAIKLDPTGSRTLGVITKIDIMDQGTDCRK 228

Query: 451 VLENKLLPLRRGYIGVVNRCRKTL 522
            L  +++PL+ G++GV NR +K +
Sbjct: 229 ELLGQIIPLKLGFVGVKNRNQKDI 252



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 34/73 (46%), Positives = 48/73 (65%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPG 214
           +A F  CK +KF DF +VR  I   TD+ TG++K + P PI + VYS +  +LT+IDLPG
Sbjct: 90  WAVFDVCKDQKFFDFEKVREYIVELTDKATGNSKDVVPDPIVMTVYSRDCPDLTVIDLPG 149

Query: 215 LTKVPIGDQPIDI 253
           +T++ I  Q  DI
Sbjct: 150 ITRIAIKGQREDI 162


>UniRef50_Q8SSJ7 Cluster: DYNAMIN-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: DYNAMIN-RELATED PROTEIN -
           Encephalitozoon cuniculi
          Length = 588

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 41/83 (49%), Positives = 60/83 (72%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ M+  +  +ES +ILA+  AN D+A ++ALK+A++ DPQ  RT+GV+TK+DLMD GT
Sbjct: 149 QIENMVLGYAAKESSIILALINANADIATNEALKIARKADPQLKRTLGVVTKIDLMDSGT 208

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           D   +L NK   L  GY+GV+N+
Sbjct: 209 DCMSILLNKSPRLSLGYVGVINK 231



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 30/60 (50%), Positives = 36/60 (60%)
 Frame = +2

Query: 74  DFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           DF  V   I    + + G NKGIS  PI   V   + L +TL+DLPGL KVPIG+QP DI
Sbjct: 87  DFTAVSSIITKRMEEICGLNKGISSRPITAFVNIKDTLEMTLVDLPGLIKVPIGEQPEDI 146


>UniRef50_Q6KF55 Cluster: Dynamin homologue; n=9; Plasmodium|Rep:
           Dynamin homologue - Plasmodium falciparum
          Length = 709

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 39/87 (44%), Positives = 64/87 (73%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI  ++ ++I+  +C+ILAV+ AN DLANSD+LK+A+ VDP+  RTIGVITK D++++ 
Sbjct: 157 EQIVNLVNKYIKNPNCIILAVSSANIDLANSDSLKMARNVDPKHERTIGVITKCDMVEKP 216

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRK 516
              + ++   L PL++G++ VV R +K
Sbjct: 217 EIWKKMISGSLYPLKKGFVAVVCRSQK 243



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 31/74 (41%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAE-TDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           Y ++ + + +K  D   +  EI  + T+ +TG NK I   PI + ++  +VL+LTLIDLP
Sbjct: 82  YCDYDNNRVEKHIDDFSILNEILIDVTEEITGGNKCIKETPIIIEIHKNDVLDLTLIDLP 141

Query: 212 GLTKVPIGDQPIDI 253
           GLTKVP+G+QP ++
Sbjct: 142 GLTKVPVGNQPQNV 155


>UniRef50_UPI00006CCFE0 Cluster: Dynamin central region family
           protein; n=1; Tetrahymena thermophila SB210|Rep: Dynamin
           central region family protein - Tetrahymena thermophila
           SB210
          Length = 985

 Score = 86.6 bits (205), Expect = 4e-16
 Identities = 38/78 (48%), Positives = 56/78 (71%)
 Frame = +1

Query: 304 LILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRR 483
           +IL V PAN D+  SD L +A+++DPQG RTIG ITK+D+MD+GTDAR +L  + + L+ 
Sbjct: 244 IILCVIPANADITTSDGLMMARQLDPQGSRTIGCITKIDIMDKGTDARRLLTGEDVGLKL 303

Query: 484 GYIGVVNRCRKTLTVART 537
           GY+G+ NR +  +   +T
Sbjct: 304 GYVGIKNRSQADINEKKT 321



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 36/75 (48%), Positives = 47/75 (62%), Gaps = 2/75 (2%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPG 214
           Y  F    G+KFTDF  V+  I+  T+ V G+NKGI   PI L +YS    +LT++DLPG
Sbjct: 131 YGVFEEIPGQKFTDFQMVKQNIDKLTNNVAGANKGIVDKPIVLTIYSSTCPDLTIVDLPG 190

Query: 215 LTKVPI--GDQPIDI 253
           +TK+PI   DQ  DI
Sbjct: 191 ITKIPIRGTDQTQDI 205


>UniRef50_A0D4X4 Cluster: Chromosome undetermined scaffold_38, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_38,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 566

 Score = 86.6 bits (205), Expect = 4e-16
 Identities = 41/84 (48%), Positives = 59/84 (70%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARD 450
           M  ++   E  +IL V PA+ D+    +LKLA+++DP G+RTIGVITK+D+M EG+DA  
Sbjct: 155 MCKRYCEDERTIILCVMPASQDITTQRSLKLARQLDPDGIRTIGVITKIDIMGEGSDASK 214

Query: 451 VLENKLLPLRRGYIGVVNRCRKTL 522
           VL N+ + LR GYIGV NR ++ +
Sbjct: 215 VLLNEEVKLRLGYIGVKNRSQQDI 238



 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 2/75 (2%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPG 214
           +A F     KKFTDF +VR EI+  TD   G  K I P PI L ++SP+  +LT+IDLPG
Sbjct: 74  WAIFKEVPEKKFTDFTKVREEIDRLTDAKAGQKKNILPDPIELTIWSPDCPDLTIIDLPG 133

Query: 215 LTKVPI--GDQPIDI 253
           +T +P+   DQP +I
Sbjct: 134 ITLIPLRDSDQPHNI 148


>UniRef50_Q3M0W5 Cluster: Dynamin-related protein, putative; n=3;
           Paramecium tetraurelia|Rep: Dynamin-related protein,
           putative - Paramecium tetraurelia
          Length = 871

 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 39/84 (46%), Positives = 61/84 (72%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARD 450
           M  ++   +S +IL V  AN D+  SDAL LAK++DP G+RTIGV+TK+D+MD+GT+A  
Sbjct: 168 MAKRYCEDKSAIILCVVAANADMTTSDALLLAKKLDPDGVRTIGVLTKIDIMDQGTNAFK 227

Query: 451 VLENKLLPLRRGYIGVVNRCRKTL 522
           +L+ + +PL+ GY+GV  R ++ +
Sbjct: 228 MLKGEEVPLKYGYVGVKLRSQQEI 251



 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 40/76 (52%), Positives = 50/76 (65%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  TEYAEFLH-CKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLID 205
           T  AEF+   KGKKFT+F EVR +I   TD+V G  K I   PI L V  PN  +LTL+D
Sbjct: 86  TPTAEFVEEIKGKKFTNFEEVRKQINELTDKVCGQAKNIIDKPIILAVQGPNCPDLTLVD 145

Query: 206 LPGLTKVPIGDQPIDI 253
           LPG+T++PI  QP +I
Sbjct: 146 LPGITRIPIAGQPTNI 161


>UniRef50_A1Y011 Cluster: Dynamin-like protein; n=3;
           Hexamitidae|Rep: Dynamin-like protein - Spironucleus
           barkhanus
          Length = 746

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 38/74 (51%), Positives = 53/74 (71%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EFLH   KKF  + ++  E+  ETDRVTG+NK +S VPI L+++SP+++ LTL+DLP
Sbjct: 90  EWGEFLHTGDKKFIHYEDICKEVVEETDRVTGANKNVSSVPIRLKLFSPSMIPLTLVDLP 149

Query: 212 GLTKVPIGDQPIDI 253
           GL K  +  QP DI
Sbjct: 150 GLVKNALPGQPPDI 163



 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 41/101 (40%), Positives = 66/101 (65%), Gaps = 2/101 (1%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI   + ++I R + +ILAV  AN DLA +DAL  A++VDP G RT+GV+TK+D++D+GT
Sbjct: 166 QISRCVMEYIGRPNAIILAVCAANADLATADALDAARKVDPNGDRTVGVLTKIDIIDKGT 225

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCRKTLTVART*PLHLR 555
           +     +L N+   L+ G++ V NR +K +   ++   HL+
Sbjct: 226 EQNIVKILNNEDYHLKLGWVAVQNRSQKDIDNNKSISKHLK 266


>UniRef50_P20592 Cluster: Interferon-induced GTP-binding protein
           Mx2; n=83; Euteleostomi|Rep: Interferon-induced
           GTP-binding protein Mx2 - Homo sapiens (Human)
          Length = 715

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 41/91 (45%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QIK +I ++I+R+  + L V P N D+A ++AL +A EVDP+G RTIG++TK DLMD GT
Sbjct: 244 QIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGT 303

Query: 439 D--ARDVLENKLLPLRRGYIGVVNRCRKTLT 525
           +    +V+ N   PL++GY+ V  R ++ +T
Sbjct: 304 EKSVMNVVRNLTYPLKKGYMIVKCRGQQEIT 334



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 26/60 (43%), Positives = 39/60 (65%)
 Frame = +2

Query: 74  DFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           D  +V  EI    + + G+ +GIS   I+L + SP V +LT+IDLPG+T+V + +QP DI
Sbjct: 182 DPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDI 241


>UniRef50_Q75BV7 Cluster: ACR164Cp; n=3; Saccharomycetales|Rep:
           ACR164Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 868

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 42/71 (59%), Positives = 55/71 (77%)
 Frame = +1

Query: 295 ESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLP 474
           E  +ILA++ A+ DLANS AL+ +K  DPQGLRTIGVITKLDL+ E + ARD+L NK  P
Sbjct: 345 EPNIILAISAADVDLANSAALRASKLADPQGLRTIGVITKLDLV-EPSAARDLLMNKKYP 403

Query: 475 LRRGYIGVVNR 507
           L+ GY+GV+ +
Sbjct: 404 LKMGYVGVITK 414



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 27/78 (34%), Positives = 44/78 (56%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           +G+   A+F   +     DF EV+  I  E +    +++ IS  PI L + SP V +L+L
Sbjct: 255 SGSETTADFPTHRIYNLKDFREVK-RILMELNLTVPTHEAISEDPIQLTIKSPRVPDLSL 313

Query: 200 IDLPGLTKVPIGDQPIDI 253
           +DLPG  +V   DQP+++
Sbjct: 314 VDLPGYIQVEAADQPMEL 331


>UniRef50_P32266 Cluster: Dynamin-like GTPase MGM1, mitochondrial
           precursor (Mitochondrial genome maintenance protein 1)
           (Mitochondrial division and morphology protein 17)
           [Contains: Dynamin-like GTPase MGM1 large isoform (l-
           MGM1); Dynamin-like GTPase MGM1 small isoform (s-MGM1)];
           n=3; Saccharomycetaceae|Rep: Dynamin-like GTPase MGM1,
           mitochondrial precursor (Mitochondrial genome
           maintenance protein 1) (Mitochondrial division and
           morphology protein 17) [Contains: Dynamin-like GTPase
           MGM1 large isoform (l- MGM1); Dynamin-like GTPase MGM1
           small isoform (s-MGM1)] - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 881

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 40/68 (58%), Positives = 51/68 (75%)
 Frame = +1

Query: 304 LILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRR 483
           +ILA++ A+ DLANS ALK +K  DP+GLRTIGVITKLDL+D    AR +L NK  PL  
Sbjct: 350 IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDP-EKARSILNNKKYPLSM 408

Query: 484 GYIGVVNR 507
           GY+GV+ +
Sbjct: 409 GYVGVITK 416



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 26/78 (33%), Positives = 42/78 (53%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           N N   A+F   +     DF EV+  +  E +    +++ +S  PI L + S  V +L+L
Sbjct: 257 NSNNVTADFPSMRLYNIKDFKEVKRML-MELNMAVPTSEAVSEEPIQLTIKSSRVPDLSL 315

Query: 200 IDLPGLTKVPIGDQPIDI 253
           +DLPG  +V   DQPI++
Sbjct: 316 VDLPGYIQVEAADQPIEL 333


>UniRef50_Q22W33 Cluster: Dynamin central region family protein;
           n=1; Tetrahymena thermophila SB210|Rep: Dynamin central
           region family protein - Tetrahymena thermophila SB210
          Length = 744

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 42/88 (47%), Positives = 55/88 (62%), Gaps = 9/88 (10%)
 Frame = +2

Query: 17  INGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLT 196
           I+   EYAE L  KG+K TD   +   IE ET++V G  KG+S VP+ +R YS NV++L 
Sbjct: 71  ISSGEEYAEILDRKGEKVTDMEVLTKIIEDETEKVAGKQKGVSGVPLKIRFYSKNVVDLL 130

Query: 197 LIDLPGLTKV---------PIGDQPIDI 253
           L+DLPG+TK          P+GDQP DI
Sbjct: 131 LVDLPGITKYFKCIKMKQNPVGDQPADI 158



 Score = 79.0 bits (186), Expect = 9e-14
 Identities = 41/90 (45%), Positives = 60/90 (66%), Gaps = 1/90 (1%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMD-E 432
           Q++  ++  +I   + +ILA++    DLANS++LKLA+E D  G RTIGVIT++DL D E
Sbjct: 160 QKLLEIVNPYIANPNSIILAISKGTDDLANSESLKLAREFDINGQRTIGVITQIDLQDFE 219

Query: 433 GTDARDVLENKLLPLRRGYIGVVNRCRKTL 522
             +A + + NK  PLR GY+GVV R +  L
Sbjct: 220 SENALNDITNKTYPLRLGYVGVVMRGQNQL 249


>UniRef50_P20591 Cluster: Interferon-induced GTP-binding protein
           Mx1; n=43; Euteleostomi|Rep: Interferon-induced
           GTP-binding protein Mx1 - Homo sapiens (Human)
          Length = 662

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 38/87 (43%), Positives = 65/87 (74%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +IK +I ++I+R+  + L V P+N D+A ++AL +A+EVDP+G RTIG++TK DL+D+GT
Sbjct: 197 KIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGT 256

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCR 513
           + +  DV+ N +  L++GY  ++ +CR
Sbjct: 257 EDKVVDVVRNLVFHLKKGY--MIVKCR 281



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 28/63 (44%), Positives = 40/63 (63%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           + +D +EV  EI    + + G   GIS   I L + S +V +LTLIDLPG+T+V +G+QP
Sbjct: 132 EISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQP 191

Query: 245 IDI 253
            DI
Sbjct: 192 ADI 194


>UniRef50_UPI00015A455B Cluster: UPI00015A455B related cluster; n=3;
           Danio rerio|Rep: UPI00015A455B UniRef100 entry - Danio
           rerio
          Length = 650

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 40/112 (35%), Positives = 67/112 (59%), Gaps = 2/112 (1%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ +I +FI ++  + L V P N D+A ++AL++A+ VDP G RT+ ++TK DL+D+G 
Sbjct: 164 QIRRLILKFIAKKETINLVVVPCNVDIATTEALRMAQGVDPDGSRTLAILTKPDLVDKGA 223

Query: 439 DA--RDVLENKLLPLRRGYIGVVNRCRKTLTVART*PLHLRLRENSSLATRH 588
           +A    VL+ K++PL++GY   + RCR    +     L    R+     + H
Sbjct: 224 EADILQVLQGKVVPLKKGY--TIVRCRGQSDINENVSLSEATRQEKEFFSNH 273



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 24/57 (42%), Positives = 35/57 (61%)
 Frame = +2

Query: 83  EVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           +V   +    + + G   GI    I+L + SP+V +LTLIDLPG+T+VP+  QP DI
Sbjct: 105 QVESFVRKAQNMLAGDGVGICDDLISLEITSPDVCDLTLIDLPGITRVPVKGQPEDI 161


>UniRef50_Q22AJ9 Cluster: Dynamin central region family protein;
           n=6; Tetrahymena thermophila|Rep: Dynamin central region
           family protein - Tetrahymena thermophila SB210
          Length = 718

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 38/79 (48%), Positives = 53/79 (67%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARD 450
           M  ++I+ E+ +IL V P N DL NS ALKLA+ VD  G RTIGV+T +D+M+ GT+   
Sbjct: 168 MTLKYIKEETTIILCVIPINQDLENSLALKLARNVDKTGSRTIGVLTMIDIMNPGTNCEK 227

Query: 451 VLENKLLPLRRGYIGVVNR 507
           VL N+ +PL+  Y G+  R
Sbjct: 228 VLRNQQIPLKHRYYGMKPR 246



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 28/73 (38%), Positives = 37/73 (50%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPG 214
           YA F   + K + +F EV+  IE  T    G  K I    I L ++      LTLIDLPG
Sbjct: 90  YAYFFEERSKTYENFEEVKKRIETITKEQAGVGKKIVDQAITLTIFQTKCPTLTLIDLPG 149

Query: 215 LTKVPIGDQPIDI 253
           +T   I DQ +D+
Sbjct: 150 MTLNSIEDQ-VDV 161


>UniRef50_Q0GBY9 Cluster: Dynamin-like protein 1; n=1; Bigelowiella
           natans|Rep: Dynamin-like protein 1 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 767

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 39/94 (41%), Positives = 62/94 (65%), Gaps = 2/94 (2%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT- 438
           I+ M+ ++   +  +ILA+  A+ D++NS AL +A++ D +G RT+GV+TK+DL++E T 
Sbjct: 167 IEKMVSRYAEDKRTVILAIMEAHRDISNSRALAMAEKADEKGERTVGVLTKMDLVEEATE 226

Query: 439 -DARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
            D  +VL N   PL  GY  VVNR +KTL   ++
Sbjct: 227 DDVLNVLNNSRKPLYHGYFAVVNRAQKTLNEGKS 260


>UniRef50_Q2HB39 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 882

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 39/85 (45%), Positives = 64/85 (75%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           +++I  +  ++IR  + +ILA++ A+TDLANS AL+ ++ VDP+G RTIGVITK+DL++ 
Sbjct: 367 KRKISELCDKYIRGPN-IILAISAADTDLANSTALQASRRVDPRGERTIGVITKMDLVEP 425

Query: 433 GTDARDVLENKLLPLRRGYIGVVNR 507
              A D+L ++  PLR GY+GV+++
Sbjct: 426 DKGA-DILSDRKYPLRLGYVGVISK 449



 Score = 40.7 bits (91), Expect = 0.029
 Identities = 22/74 (29%), Positives = 42/74 (56%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           +Y EF      + TDF+ ++  +  E ++    +  ++  PI L ++SP + +L+LIDLP
Sbjct: 294 DYGEFPDLGLTRVTDFSLIQKTL-TELNQSVPESLCVTDDPIRLTIHSPGIPDLSLIDLP 352

Query: 212 GLTKVPIGDQPIDI 253
           G  +V   +QP ++
Sbjct: 353 GYIQVAGENQPREL 366


>UniRef50_Q800G4 Cluster: MxF protein; n=4; Danio rerio|Rep: MxF
           protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 138

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 37/111 (33%), Positives = 65/111 (58%), Gaps = 2/111 (1%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT- 438
           I+ +I +FI ++  + L V P N D+A ++AL++A+ VDP G RT+ ++TK DL+D G  
Sbjct: 1   IRRLILKFIAKKETINLVVVPCNVDIATTEALRMAQGVDPDGSRTLAILTKPDLIDRGAE 60

Query: 439 -DARDVLENKLLPLRRGYIGVVNRCRKTLTVART*PLHLRLRENSSLATRH 588
            D  ++++ K++PL +GYI  + RCR    +    P    + +  +    H
Sbjct: 61  IDVLNIVQGKVIPLSKGYI--IVRCRGQSDINNRVPFEKAMEDEQNFFRSH 109


>UniRef50_Q871Z1 Cluster: Related to dynamin-like protein; n=19;
           Ascomycota|Rep: Related to dynamin-like protein -
           Neurospora crassa
          Length = 939

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 40/85 (47%), Positives = 62/85 (72%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           +++I  +  ++IR  + +ILA++ A+ DLANS AL+ ++ VDP+G RTIGVITK+DL+D 
Sbjct: 366 KRKISELCDKYIRGPN-IILAISAADVDLANSTALQASRRVDPRGERTIGVITKMDLVDP 424

Query: 433 GTDARDVLENKLLPLRRGYIGVVNR 507
              A  +L +K  PLR GY+GV++R
Sbjct: 425 EKGAA-ILSDKQYPLRLGYVGVISR 448



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 24/76 (31%), Positives = 43/76 (56%)
 Frame = +2

Query: 26  NTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLID 205
           + +Y EF      + TDF+ ++  +  E ++     + +S  PI L ++SP V +L+LID
Sbjct: 291 SADYGEFPDLGLHRITDFSLIQKNL-TELNQSVPERECVSDDPIRLTIHSPRVPDLSLID 349

Query: 206 LPGLTKVPIGDQPIDI 253
           LPG  +V   +QP ++
Sbjct: 350 LPGYIQVAGENQPREL 365


>UniRef50_A5E440 Cluster: Protein MGM1, mitochondrial; n=6;
           Saccharomycetales|Rep: Protein MGM1, mitochondrial -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 923

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 38/85 (44%), Positives = 61/85 (71%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           +++I+ + F+++   + +ILA++ A+ DLANS AL+ ++  DP+G RTIGVITK+DL+  
Sbjct: 356 KRKIRELCFKYLEPPN-VILAISAADVDLANSAALRASRLADPRGERTIGVITKIDLVSP 414

Query: 433 GTDARDVLENKLLPLRRGYIGVVNR 507
              AR +L NK  PLR GY+GV+ +
Sbjct: 415 KV-ARKILTNKKYPLRLGYVGVITK 438



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = +2

Query: 38  AEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGL 217
           AE    K    TDF +++ +I  + +      + IS  PI + + SP V +L+L+DLPG 
Sbjct: 285 AELPALKMNNITDFTQLQ-KILYDLNMAVSEAECISNDPIQVTIRSPKVPDLSLVDLPGY 343

Query: 218 TKVPIGDQPIDI 253
            +V   DQP ++
Sbjct: 344 IQVEAADQPTEL 355


>UniRef50_Q4U4N4 Cluster: Interferon-induced GTP-binding protein
           Mx2; n=7; Clupeocephala|Rep: Interferon-induced
           GTP-binding protein Mx2 - Ictalurus punctatus (Channel
           catfish)
          Length = 625

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 38/87 (43%), Positives = 59/87 (67%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           Q K +I +FI ++  + L V P N D+A ++ALK+A EVDP G RT GV+TK DL+D+G+
Sbjct: 159 QSKRLIKKFITKQETINLVVVPCNVDIATTEALKMALEVDPNGERTFGVLTKPDLVDKGS 218

Query: 439 DAR--DVLENKLLPLRRGYIGVVNRCR 513
           +     ++ N+++ L +GYI  + RCR
Sbjct: 219 EETVVSIINNEIVYLNKGYI--IVRCR 243



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 7/79 (8%)
 Frame = +2

Query: 38  AEFLHCKGKKFTDFNE-------VRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLT 196
           A+F H K  K+ D+ E       V   I    + + G+  GIS   I+L V S NV +LT
Sbjct: 79  ADFWHGK-IKYEDYEEEIEDPADVEQMIRKAQNEIAGTGMGISDKLISLEVTSSNVPDLT 137

Query: 197 LIDLPGLTKVPIGDQPIDI 253
           +IDLPG+T+V + DQP +I
Sbjct: 138 VIDLPGITRVAVKDQPENI 156


>UniRef50_Q22AJ4 Cluster: Dynamin central region family protein;
           n=1; Tetrahymena thermophila SB210|Rep: Dynamin central
           region family protein - Tetrahymena thermophila SB210
          Length = 686

 Score = 75.8 bits (178), Expect = 8e-13
 Identities = 37/84 (44%), Positives = 55/84 (65%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARD 450
           M  ++I  ++ +IL V P N DL NS AL LA+ VD  G RTIGV+T +D+M+ GT+  +
Sbjct: 169 MTKKYIIEKTTIILCVIPINQDLENSLALNLARSVDENGERTIGVLTMIDIMNPGTNCEN 228

Query: 451 VLENKLLPLRRGYIGVVNRCRKTL 522
           VL+N+ +PL   Y G+  R +K +
Sbjct: 229 VLKNRQIPLLHRYYGMKPRSQKDI 252



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 29/69 (42%), Positives = 36/69 (52%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPG 214
           YA F   + K F DF  V+ EI+  T+   G  K I    I L +Y      LTLIDLPG
Sbjct: 91  YAYFFEERQKIFHDFELVKKEIQKITNDFAGPGKKIVDKVITLTIYQAQCPTLTLIDLPG 150

Query: 215 LTKVPIGDQ 241
           +T   +GDQ
Sbjct: 151 MTLNSVGDQ 159


>UniRef50_P87320 Cluster: Protein msp1, mitochondrial precursor;
           n=1; Schizosaccharomyces pombe|Rep: Protein msp1,
           mitochondrial precursor - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 903

 Score = 75.8 bits (178), Expect = 8e-13
 Identities = 39/72 (54%), Positives = 51/72 (70%)
 Frame = +1

Query: 292 RESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLL 471
           RE  +ILAV  A+ DLANS AL+ ++ VDP GLRTIGV+TK+DL+   + A  +L N   
Sbjct: 399 REPNIILAVCAADVDLANSAALRASRRVDPLGLRTIGVVTKMDLVPP-SKAISILHNNNY 457

Query: 472 PLRRGYIGVVNR 507
           PL  GYIGV++R
Sbjct: 458 PLHYGYIGVISR 469



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPG 214
           Y EF   +  K TDF++++  I  + +    S++G+   PI L +Y+ ++ NL+LIDLPG
Sbjct: 315 YGEFSGVQLGKITDFSKIQ-HILTDLNMAVPSSQGVDDNPIRLTIYASHIPNLSLIDLPG 373

Query: 215 LTKVPIGDQPIDI 253
             ++   DQP D+
Sbjct: 374 YIQIHSEDQPADL 386


>UniRef50_Q7T2M4 Cluster: Mx3 protein; n=7; Euteleostomi|Rep: Mx3
           protein - Carassius auratus (Goldfish)
          Length = 627

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 35/88 (39%), Positives = 63/88 (71%), Gaps = 2/88 (2%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QIK +I ++I+R+  + L V PAN D+A ++AL++A +VD  G RT+G++TK DL+D+G
Sbjct: 172 KQIKDLIEKYIKRQETISLVVVPANIDIATTEALQMASKVDSTGQRTLGILTKPDLVDKG 231

Query: 436 TDARDV--LENKLLPLRRGYIGVVNRCR 513
            +   V  + N+++ L++GY  ++ +CR
Sbjct: 232 MEETVVRTVNNQVIQLKKGY--MIVKCR 257



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 26/64 (40%), Positives = 37/64 (57%)
 Frame = +2

Query: 62  KKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQ 241
           KK  D  E+   +      + G+ +GIS   I L + S +V +LTLIDLPG+ +V  G+Q
Sbjct: 107 KKLKDPAEIENAVLKAQTVLAGTGEGISHEMITLEIQSSDVPDLTLIDLPGIARVATGNQ 166

Query: 242 PIDI 253
           P DI
Sbjct: 167 PKDI 170


>UniRef50_A6MD73 Cluster: Mx; n=1; Haliotis discus discus|Rep: Mx -
           Haliotis discus discus
          Length = 511

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 40/87 (45%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG- 435
           +IK MI ++I R+  +ILAV   N D+A  +ALK+AKE D +G RT+GV+TK DL+D+G 
Sbjct: 197 RIKNMIRRYIGRQETIILAVLQCNVDIATCEALKMAKEFDAEGGRTLGVLTKPDLLDKGA 256

Query: 436 -TDARDVLENKLLPLRRGYIGVVNRCR 513
            T    +L N    L +GYI  +  CR
Sbjct: 257 ETGVVRILNNMEFTLSKGYI--IATCR 281



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 22/45 (48%), Positives = 29/45 (64%)
 Frame = +2

Query: 119 VTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           +T S KGIS   I L V S +V +LT+IDLPG+ +  +  QP DI
Sbjct: 150 MTDSAKGISDELITLEVTSSDVPDLTVIDLPGIARNAVEGQPFDI 194


>UniRef50_Q5KJX1 Cluster: Dynamin GTPase, putative; n=3;
           Basidiomycota|Rep: Dynamin GTPase, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 933

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 40/95 (42%), Positives = 58/95 (61%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           + +I  +  ++IR E  +ILAV  A+ DLANS AL+ ++ VDP G RTIGV+TK+DL+  
Sbjct: 368 KDKISNLCDKYIR-EPNIILAVCAADVDLANSPALRASRRVDPLGTRTIGVVTKMDLVPP 426

Query: 433 GTDARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
              A  ++     PL  GY+GVV +   T  V R+
Sbjct: 427 EQGAA-IIRGDRYPLHLGYVGVVCKAPPTAGVIRS 460



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EYAEFLHCKGK-KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDL 208
           EY  F +  G  K T F  ++  +  + +        +S  PI+L+++SP+V +LTLIDL
Sbjct: 294 EYGVFPNMPGMGKITSFATIQKTL-TDLNLSVPPELAVSDDPIHLQIHSPHVPDLTLIDL 352

Query: 209 PGLTKVPIGDQPIDI 253
           PG  ++   +QP ++
Sbjct: 353 PGYIQISSMNQPEEL 367


>UniRef50_UPI000023E784 Cluster: hypothetical protein FG05660.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG05660.1 - Gibberella zeae PH-1
          Length = 739

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 39/86 (45%), Positives = 55/86 (63%), Gaps = 4/86 (4%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           +KGM+ ++I+    +ILAV P N D+AN   L  AKEVDP+G RT+GV+TK DL+ E  +
Sbjct: 182 VKGMVQKYIKESRTIILAVVPCNGDIANQKILTYAKEVDPEGKRTLGVLTKPDLVTENAN 241

Query: 442 ARDVLENKLLPLRR----GYIGVVNR 507
            ++V+ N +   RR    GY  V NR
Sbjct: 242 -KEVVLNLVRGGRRDLELGYCIVKNR 266


>UniRef50_Q2UIL8 Cluster: Vacuolar sorting protein VPS1; n=1;
           Aspergillus oryzae|Rep: Vacuolar sorting protein VPS1 -
           Aspergillus oryzae
          Length = 763

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 35/94 (37%), Positives = 55/94 (58%), Gaps = 4/94 (4%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           R  I+G+I ++I  +  +ILAV  A  +LAN +   +A+  DPQG RT+G+ITK D + E
Sbjct: 191 RAIIRGLIEKYITDKRTIILAVMDARNNLANQEVFNMARSADPQGSRTVGIITKCDAVQE 250

Query: 433 GTDARD----VLENKLLPLRRGYIGVVNRCRKTL 522
           G +  D    + +N++  L  G+  V NR  K +
Sbjct: 251 GDEENDKVIRIAQNEVEKLHHGWFAVRNRSTKEI 284


>UniRef50_A2QJR3 Cluster: Function: Mx proteins have antiviral
           activities; n=1; Aspergillus niger|Rep: Function: Mx
           proteins have antiviral activities - Aspergillus niger
          Length = 628

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 28/73 (38%), Positives = 51/73 (69%), Gaps = 2/73 (2%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           ++ ++ M+  +++    ++L V PAN D+A  + +++A+E DP G RTIGVITK DL+++
Sbjct: 157 KEMVREMVESYMKNPRSIMLTVVPANVDIATQEIIEMAREQDPHGERTIGVITKPDLVEK 216

Query: 433 GTDAR--DVLENK 465
           G +++  D+LE K
Sbjct: 217 GAESKVIDILEGK 229


>UniRef50_Q2UI57 Cluster: Vacuolar sorting protein VPS1; n=3;
           Trichocomaceae|Rep: Vacuolar sorting protein VPS1 -
           Aspergillus oryzae
          Length = 716

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 33/94 (35%), Positives = 58/94 (61%), Gaps = 2/94 (2%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ M+  +++    ++L V PAN D+A  + +++A+E D +G R+IGV+TK DL+D G +
Sbjct: 184 VRDMVETYMKNPRSIMLTVVPANVDIATQEIIEMAREYDAEGERSIGVLTKPDLVDRGAE 243

Query: 442 AR--DVLENKLLPLRRGYIGVVNRCRKTLTVART 537
            +  D++    L LR G+I V N  ++ LT   T
Sbjct: 244 DKVLDLVAGNKLFLRHGWIVVRNLNQQELTDRET 277


>UniRef50_A4QZU8 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 628

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 26/63 (41%), Positives = 45/63 (71%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q +K M+  +++    ++LAV  A  D+AN   ++LA++ DP+G RT+G+ITK DL++EG
Sbjct: 166 QLVKDMVKGYVQSSRTIVLAVVQATNDIANQVIIQLARQYDPEGQRTVGIITKADLINEG 225

Query: 436 TDA 444
           ++A
Sbjct: 226 SEA 228


>UniRef50_A4R024 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 812

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 36/85 (42%), Positives = 49/85 (57%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT- 438
           ++ M+  ++R    +ILA+ PAN D A  + L+LAK+VDP   RT+GV+TK DL  E T 
Sbjct: 194 VRNMVMTYMRDPRTIILAIVPANVDPATQEILRLAKQVDPDMKRTMGVLTKPDLAVEATI 253

Query: 439 --DARDVLENKLLPLRRGYIGVVNR 507
              A D +  K   L  GY  V NR
Sbjct: 254 KQIAIDHVTRKRGELTLGYYIVKNR 278


>UniRef50_Q0UEN8 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 635

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/75 (37%), Positives = 49/75 (65%), Gaps = 2/75 (2%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAR- 447
           M+  ++     ++L V P N D+A  + L+ A+++DP+G+RT+GV+TK DL+D+G +   
Sbjct: 170 MVHGYMSNPRSVMLIVVPCNVDIATQEILERAEDLDPEGIRTLGVLTKPDLIDQGGEGAV 229

Query: 448 -DVLENKLLPLRRGY 489
            D+LE +   LR G+
Sbjct: 230 VDLLEERKHRLRLGW 244


>UniRef50_Q9ZP55 Cluster: F8A5.5 protein; n=2; Arabidopsis
           thaliana|Rep: F8A5.5 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 669

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 27/61 (44%), Positives = 38/61 (62%)
 Frame = +2

Query: 71  TDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPID 250
           TD   +   I A TD + GS KG+S  P+ L V    V +LT++DLPG+T+VP+  QP +
Sbjct: 127 TDEEHIAEAIRAATDVIAGSGKGVSDAPLTLHVKKAGVPDLTMVDLPGITRVPVNGQPEN 186

Query: 251 I 253
           I
Sbjct: 187 I 187



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 28/84 (33%), Positives = 49/84 (58%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI GMI ++I  +  +IL V  A  D    ++++++++VD  G RT+ V+TK D+  EG
Sbjct: 189 EQISGMIMEYIEPQESIILNVLSATVDFTTCESIRMSRKVDKTGQRTLAVVTKADMAPEG 248

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
              +   ++  + L  GY+ V NR
Sbjct: 249 LLQKVTADDVSIVL--GYVCVRNR 270


>UniRef50_Q7SBP5 Cluster: Putative uncharacterized protein
           NCU05693.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU05693.1 - Neurospora crassa
          Length = 727

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 33/88 (37%), Positives = 51/88 (57%), Gaps = 3/88 (3%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           R  ++ M+  FI+ +  +ILAV PAN D+   + L LA++ DP G RT+GV+TK DL+ E
Sbjct: 178 RNLVRDMVTGFIKDKRTIILAVLPANVDVMTQEILALAEQYDPDGERTLGVLTKPDLVIE 237

Query: 433 GTDAR---DVLENKLLPLRRGYIGVVNR 507
            +      +++  +   L  GY  V NR
Sbjct: 238 RSAKEAVCNLVTGRKKALNLGYYLVKNR 265


>UniRef50_Q5BDS1 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 717

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 29/84 (34%), Positives = 53/84 (63%), Gaps = 3/84 (3%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           +  M+  +++    +ILAV  A  D AN + ++LA++ D  G RT+G+ITK DL+++GT+
Sbjct: 173 VHNMVATYLQSSRTIILAVVQATNDFANQEIIRLARKYDHDGQRTVGIITKPDLINKGTE 232

Query: 442 AR--DVLENK-LLPLRRGYIGVVN 504
           A+   + +N+  + L+ GY  + N
Sbjct: 233 AKVARIAKNQDTIKLKLGYFLLKN 256


>UniRef50_Q2HD72 Cluster: Putative uncharacterized protein; n=5;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Chaetomium globosum (Soil fungus)
          Length = 1555

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ M+  +I+    +ILAV P+N D+AN + L +A+E DP G RT+G++TK DL+ E + 
Sbjct: 236 VRNMVRWYIQDSRTVILAVLPSNIDIANQEILTMAEEYDPNGERTLGILTKPDLVPEQSA 295

Query: 442 AR---DVLENKLLPLRRGYIGVVNR 507
                +++  K   L  GY  V +R
Sbjct: 296 QAAVCNIVRGKKKQLTLGYYVVRSR 320


>UniRef50_Q0ULI1 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 770

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 35/97 (36%), Positives = 55/97 (56%), Gaps = 2/97 (2%)
 Frame = +1

Query: 223 SANR*SAYRYRQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIG 402
           SA + S    +  I G++ ++++    +ILAV     D AN   L L K++DP+G RT+G
Sbjct: 188 SATKASTEADKDLIFGLVQEYMQNPRTIILAVVSVKNDAANQIILSLFKKMDPKGSRTLG 247

Query: 403 VITKLDLM--DEGTDARDVLENKLLPLRRGYIGVVNR 507
           +ITK D +  D+     D+  NK + L+RG+  V NR
Sbjct: 248 IITKPDCLSADDEQSWLDLAMNKEVFLQRGWHVVKNR 284


>UniRef50_Q9ZP56 Cluster: F8A5.7 protein; n=12; Eukaryota|Rep:
           F8A5.7 protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 301

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/61 (44%), Positives = 39/61 (63%)
 Frame = +2

Query: 71  TDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPID 250
           TD   V   I A TD + G+ +G+S  P+ L V   NV +LT++DLPG+T+VP+  QP +
Sbjct: 124 TDEEHVAEAICAATDVIAGTGEGVSDTPLTLSVKKNNVPDLTMVDLPGITRVPVNGQPEN 183

Query: 251 I 253
           I
Sbjct: 184 I 184



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 28/84 (33%), Positives = 48/84 (57%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI  MI ++I  +  +IL V  A  D    ++++++++VD  G RT+ V+TK D+  EG
Sbjct: 186 EQISRMIMKYIEPQESIILNVLSATVDFTTCESIRMSRQVDKTGERTLAVVTKADMAPEG 245

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
              +   ++  + L  GYI V NR
Sbjct: 246 LLQKVTADDVSIGL--GYICVRNR 267


>UniRef50_Q5BCT2 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 417

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 34/80 (42%), Positives = 45/80 (56%), Gaps = 3/80 (3%)
 Frame = +1

Query: 277 FQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD---AR 447
           F  + +  C ILAV P N D+   + LKLA+E DP G+RT+GV+TK D   E      A 
Sbjct: 11  FLLLYKVDC-ILAVMPCNVDITTQEILKLAEEADPSGIRTMGVLTKPDFATEKATQDVAM 69

Query: 448 DVLENKLLPLRRGYIGVVNR 507
           D+L  +   L+ GY  V NR
Sbjct: 70  DLLLGRRNVLKLGYHVVKNR 89


>UniRef50_Q1DMD9 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 726

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 32/90 (35%), Positives = 51/90 (56%), Gaps = 4/90 (4%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           I  ++  +++    +ILAV  A  DLAN    KLA+  DP+GLRT+G+ITK D +  G++
Sbjct: 180 ISSLVNSYMKNRRSIILAVVSAKNDLANQIITKLARNHDPKGLRTLGIITKPDTLHRGSE 239

Query: 442 AR----DVLENKLLPLRRGYIGVVNRCRKT 519
                 D+  N+ +  R G+  + NR  +T
Sbjct: 240 NEKSFVDLASNEDIVFRLGWHVLRNRDYQT 269


>UniRef50_Q3UD61 Cluster: Bone marrow macrophage cDNA, RIKEN
           full-length enriched library, clone:G530147B09
           product:myxovirus (influenza virus) resistance 1, full
           insert sequence (Bone marrow macrophage cDNA, RIKEN
           full-length enriched library, clone:G530121G17
           product:myxovirus (influenza virus) resistance 1, full
           insert sequence); n=2; Mus musculus|Rep: Bone marrow
           macrophage cDNA, RIKEN full-length enriched library,
           clone:G530147B09 product:myxovirus (influenza virus)
           resistance 1, full insert sequence (Bone marrow
           macrophage cDNA, RIKEN full-length enriched library,
           clone:G530121G17 product:myxovirus (influenza virus)
           resistance 1, full insert sequence) - Mus musculus
           (Mouse)
          Length = 397

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 30/63 (47%), Positives = 41/63 (65%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           + +D +EV   I    + + G   GIS   I+L V SPNV +LTLIDLPG+T+V +G+QP
Sbjct: 98  ELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQP 157

Query: 245 IDI 253
            DI
Sbjct: 158 ADI 160



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/51 (43%), Positives = 38/51 (74%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVI 408
           +QIK +I  +I+++  + L V P+N D+A ++AL +A+EVDP+G RTI ++
Sbjct: 162 RQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIEMV 212


>UniRef50_Q0ULM2 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 752

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 32/95 (33%), Positives = 53/95 (55%), Gaps = 4/95 (4%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           ++ I  ++ Q++     +ILAV  A  D AN   L   +++D +G RT+G+ITK D + E
Sbjct: 193 KELILNLVKQYMTNSRTIILAVVSAKNDYANQIILDHCRKIDEKGRRTLGIITKPDFLRE 252

Query: 433 GTDAR----DVLENKLLPLRRGYIGVVNRCRKTLT 525
           G+D      D+ +NK + L RG+  + NR    +T
Sbjct: 253 GSDNEKSWIDLAQNKDIYLERGWHMLKNRGDNQMT 287


>UniRef50_Q1DIT9 Cluster: Putative uncharacterized protein; n=2;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Coccidioides immitis
          Length = 1012

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 34/99 (34%), Positives = 55/99 (55%), Gaps = 4/99 (4%)
 Frame = +1

Query: 223 SANR*SAYRYRQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIG 402
           SAN+  +    + IK ++  +I ++  +ILAV  A  D AN   LK+ +  DP+G RT+G
Sbjct: 449 SANKSQSEGDVELIKSLVEDYISQKRTIILAVISAKNDYANQVILKICRRFDPKGARTLG 508

Query: 403 VITKLDLMDEGTDAR----DVLENKLLPLRRGYIGVVNR 507
           VITK D +  G++      D+ +N+ +    G+  V NR
Sbjct: 509 VITKPDFLLPGSENERVWLDLAQNRDIYFELGWHLVKNR 547


>UniRef50_Q0UUL9 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 745

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +I  ++  ++ +   +ILAV  A  D  N    K  ++ DP+  RT+GVITK D +D+G+
Sbjct: 183 KIADLVASYMSKPKSIILAVVMAGNDPENQKPFKYIRKYDPERSRTLGVITKPDKVDQGS 242

Query: 439 DA-RDVL---ENKLLPLRRGYIGVVNRCRKT 519
           ++ +D+L    N+   L  G+  V NRC  T
Sbjct: 243 ESEKDLLRLARNEKCKLTHGWFAVRNRCFNT 273


>UniRef50_Q4WYM5 Cluster: Dynamin GTPase, putative; n=3;
           Aspergillus|Rep: Dynamin GTPase, putative - Aspergillus
           fumigatus (Sartorya fumigata)
          Length = 712

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 22/64 (34%), Positives = 40/64 (62%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q +  ++  ++     +ILAV PA++D+     ++ A+  D  G RT+G+ITK DL+++G
Sbjct: 191 QLVGDLVNSYLENSRSIILAVVPASSDVDTQSIIQRARRFDKDGFRTVGIITKPDLINDG 250

Query: 436 TDAR 447
           T+ R
Sbjct: 251 TEGR 254


>UniRef50_A1Z9N0 Cluster: CG8479-PA, isoform A; n=6;
           Endopterygota|Rep: CG8479-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 972

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 39/122 (31%), Positives = 57/122 (46%), Gaps = 5/122 (4%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           +  I  M   ++   + +IL +   + D   S+   L  + DP G RTI V+TK+DL +E
Sbjct: 426 KDSIHQMTKHYMSNPNAIILCIQDGSVDAERSNVTDLVMQCDPLGRRTIFVLTKVDLAEE 485

Query: 433 GTD---ARDVLENKLLPLRR-GYIGVV-NRCRKTLTVART*PLHLRLRENSSLATRHTVI 597
             D    R +L  KL P++  GY  VV  R RK  ++           +NS L  R  VI
Sbjct: 486 LADPDRIRKILSGKLFPMKALGYYAVVTGRGRKDDSIDAIRQYEEDFFKNSKLFHRRGVI 545

Query: 598 WP 603
            P
Sbjct: 546 MP 547


>UniRef50_A6SPB4 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 667

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 4/86 (4%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           +  +++ ++RR   +ILAV  A  D A    LK  K VDP G RT+G+ITK D + E +D
Sbjct: 180 VSELVYSYMRRPRTIILAVVSALNDRALQAVLKQVKGVDPHGRRTMGLITKPDTLFEDSD 239

Query: 442 A-RDVLE---NKLLPLRRGYIGVVNR 507
           + +D ++   N++  LR G+  + NR
Sbjct: 240 SEKDFVKLALNEVTHLRLGWHVLRNR 265


>UniRef50_A2QF70 Cluster: Similarity to hypothetical protein Mx -
           Anas platyrhynchos; n=1; Aspergillus niger|Rep:
           Similarity to hypothetical protein Mx - Anas
           platyrhynchos - Aspergillus niger
          Length = 709

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 4/72 (5%)
 Frame = +1

Query: 304 LILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLL---- 471
           +ILAV P+N DLA  + LKLAK+ D  G RT+GV+TK DL+ E   A+  L + +L    
Sbjct: 162 VILAVLPSNVDLATQEILKLAKDYDENGERTLGVLTKPDLVIE-QSAKAALCSLVLGHKR 220

Query: 472 PLRRGYIGVVNR 507
           PL  GY  V N+
Sbjct: 221 PLTLGYYLVRNQ 232


>UniRef50_Q2H1N2 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 683

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 22/66 (33%), Positives = 39/66 (59%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           +  ++  +++    +ILAV  A  D A       A+ +DP G+RT+G+ITK D +D+G+D
Sbjct: 155 VNNLVLSYMKNPRTIILAVVSAKNDFALQQVTLHARALDPNGIRTLGLITKPDTLDQGSD 214

Query: 442 ARDVLE 459
           +   L+
Sbjct: 215 SERCLK 220


>UniRef50_Q2UH68 Cluster: Vacuolar sorting protein VPS1; n=1;
           Aspergillus oryzae|Rep: Vacuolar sorting protein VPS1 -
           Aspergillus oryzae
          Length = 786

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/61 (39%), Positives = 39/61 (63%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ ++  +++    +ILAV  A  D AN   L+LA+E D  G RT+GVITK D + EG++
Sbjct: 181 VQDVVQSYMKEPRSIILAVVSAKNDFANQIVLRLAREADSFGHRTLGVITKPDTLVEGSE 240

Query: 442 A 444
           +
Sbjct: 241 S 241


>UniRef50_Q0CEV2 Cluster: Putative uncharacterized protein; n=1;
           Aspergillus terreus NIH2624|Rep: Putative
           uncharacterized protein - Aspergillus terreus (strain
           NIH 2624)
          Length = 492

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/64 (34%), Positives = 41/64 (64%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q +  ++  ++     +ILAV PA++D+     ++ A+  D  G RT+G+ITK DL+++G
Sbjct: 168 QLVHDLVDTYLESSRTIILAVVPASSDVDTQGIIQRARRFDRDGDRTVGIITKPDLINQG 227

Query: 436 TDAR 447
           T++R
Sbjct: 228 TESR 231


>UniRef50_Q4WH72 Cluster: Dynamin GTPase, putative; n=1; Aspergillus
           fumigatus|Rep: Dynamin GTPase, putative - Aspergillus
           fumigatus (Sartorya fumigata)
          Length = 737

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q +  +I  ++     +ILAV  A+ D+ N + ++ A+  D  G RT+G+ITK DL+++G
Sbjct: 198 QLVNTLIDSYLANTRSIILAVVQASNDIQNQNIIQRARRFDKLGERTVGIITKPDLVNKG 257

Query: 436 TDARDV-LENKL 468
           T++  V L N L
Sbjct: 258 TESHIVRLANNL 269


>UniRef50_Q2U0L0 Cluster: Vacuolar sorting protein VPS1; n=5;
           Pezizomycotina|Rep: Vacuolar sorting protein VPS1 -
           Aspergillus oryzae
          Length = 738

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ ++  ++R    +ILAV  A  D AN   L LA+E D  G RT+GVITK D +  G++
Sbjct: 181 VQDVVQSYMREPRSIILAVVSAKNDFANQIVLTLAREADRTGSRTLGVITKPDTLTPGSE 240

Query: 442 AR----DVLENKLLPLRRGY 489
                  + +N+ +  R G+
Sbjct: 241 TEAMFVSLAKNQQVSFRHGW 260


>UniRef50_A4RCA8 Cluster: Putative uncharacterized protein; n=2;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 742

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 22/61 (36%), Positives = 42/61 (68%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           +  M+ + + R   +ILAV  A+ +  N +  +LA+++DPQ +RT+G+ITK D ++EG++
Sbjct: 175 VGNMVRKAMSRPRSVILAVVSASNEFNNQEVTELARKMDPQRVRTLGLITKPDKLEEGSE 234

Query: 442 A 444
           +
Sbjct: 235 S 235


>UniRef50_Q0J5L5 Cluster: Os08g0425100 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0425100 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 766

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 2/80 (2%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPA--NTDLANSDALKLAKEVDPQGLRTIGVITKLDLM 426
           R   + MI  +  R   ++L + PA    D+A+S AL++A+E+D +G RTIGV++K+D +
Sbjct: 153 RSMDESMIGNYAARNDAILLVIVPALQAPDVASSRALRIARELDSEGSRTIGVVSKVDQV 212

Query: 427 DEGTDARDVLENKLLPLRRG 486
            E  D R +L  + L + +G
Sbjct: 213 AE--DQRALLAVQALLVNQG 230


>UniRef50_Q1DV48 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 674

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ ++  +++    +ILAV  A  D+A    ++ A+  D  G RT+G+ITK DL+++GT+
Sbjct: 186 VEDLVDSYLQSSRTIILAVVQATNDIATQPIIQRARHFDRAGERTVGIITKPDLINKGTE 245

Query: 442 ARDVL 456
            R  L
Sbjct: 246 GRIAL 250


>UniRef50_A6SAY7 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 747

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 4/79 (5%)
 Frame = +1

Query: 283 FIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAR----D 450
           +I++   + LAV  A  D+AN   LK  +  DP G RT+G+ITK D +D+G+        
Sbjct: 220 YIKQPRTICLAVISAKNDIANQQILKRVRAHDPHGDRTLGIITKPDTLDKGSGNEKAFIS 279

Query: 451 VLENKLLPLRRGYIGVVNR 507
           + +N+ +  R G+  V NR
Sbjct: 280 LAKNENVRFRLGWHVVKNR 298


>UniRef50_Q7SAH6 Cluster: Putative uncharacterized protein
           NCU06973.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU06973.1 - Neurospora crassa
          Length = 767

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 1/66 (1%)
 Frame = +1

Query: 313 AVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLEN-KLLPLRRGY 489
           AV P  +D A    L++AKE DP G+RTIGV+TK DL+ E     ++L+  +   L+ GY
Sbjct: 244 AVVPCLSDPATERILQMAKEADPAGVRTIGVLTKADLVYEKAVLSNLLKQVQSGTLKLGY 303

Query: 490 IGVVNR 507
             V NR
Sbjct: 304 FIVRNR 309


>UniRef50_Q9ZP57 Cluster: F8A5.6 protein; n=2; Arabidopsis
           thaliana|Rep: F8A5.6 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 676

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +2

Query: 71  TDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPID 250
           +D   +   I +  + + GS KG+S  P+ L V   +V +LTL+DLP +T+VP+  Q  +
Sbjct: 601 SDEEHIAEAISSAAEAIAGSGKGVSYTPLTLHVKKADVPDLTLVDLPEITRVPVNGQTQN 660

Query: 251 I 253
           I
Sbjct: 661 I 661


>UniRef50_Q18965 Cluster: Putative uncharacterized protein eat-3;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein eat-3 - Caenorhabditis elegans
          Length = 934

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 5/73 (6%)
 Frame = +1

Query: 298 SCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARD----VLENK 465
           + +IL +   + D   S+   L   +DP G RTI V+TK+D+ ++     D    +LE K
Sbjct: 429 NAIILCIQDGSVDAERSNVTDLVSSIDPSGKRTILVLTKVDMAEKNLANPDRIKKILEGK 488

Query: 466 LLPLRR-GYIGVV 501
           L P++  GY GVV
Sbjct: 489 LFPMKALGYFGVV 501



 Score = 37.5 bits (83), Expect = 0.27
 Identities = 19/58 (32%), Positives = 27/58 (46%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGD 238
           K TD  ++R E E          K +S   I+L V  PN+  + L+DLPG+      D
Sbjct: 351 KETDLQQLRNETEVRMRNSVRDGKTVSNEVISLTVKGPNLPRMVLVDLPGVISTVTAD 408


>UniRef50_A1DMG3 Cluster: Dynamin family protein; n=8;
           Eurotiomycetidae|Rep: Dynamin family protein -
           Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 833

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 3/79 (3%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ ++ ++I +E+C++L   P   D  NS A K+ ++V     RT+GV+TK D +  G  
Sbjct: 220 VENLVREYISQENCIVLLALPMTDDATNSSAAKIMRDVRGAKERTLGVLTKPDRIQTGES 279

Query: 442 AR---DVLENKLLPLRRGY 489
                ++LE     L  GY
Sbjct: 280 YDQWVEILEGDKFALGHGY 298


>UniRef50_UPI000023E2CA Cluster: hypothetical protein FG00202.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG00202.1 - Gibberella zeae PH-1
          Length = 948

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/53 (43%), Positives = 38/53 (71%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLD 420
           ++ ++  ++++++ +IL V  AN +LA+  AL+ AK +DPQG RTI VITK D
Sbjct: 242 VEELVESYMQQKNSIILVVISANINLASHLALEKAKVIDPQGQRTIRVITKPD 294


>UniRef50_A2QVR7 Cluster: Contig An11c0080, complete genome; n=1;
           Aspergillus niger|Rep: Contig An11c0080, complete genome
           - Aspergillus niger
          Length = 686

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 3/84 (3%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ ++  +I ++ C++L   P   D  NS A ++ +E+     RT+GV+TK D +  G  
Sbjct: 167 VENLVKHYILQQHCIVLLTLPMTNDATNSSAARIMQEIRGANARTMGVLTKPDRVQTGES 226

Query: 442 AR---DVLENKLLPLRRGYIGVVN 504
                ++LE     L  GY  V N
Sbjct: 227 FAQWVEILEGDKFSLGHGYFVVRN 250


>UniRef50_Q5U3A7 Cluster: Dynamin-like 120 kDa protein,
           mitochondrial precursor; n=5; Coelomata|Rep:
           Dynamin-like 120 kDa protein, mitochondrial precursor -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 966

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 5/78 (6%)
 Frame = +1

Query: 283 FIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG----TDARD 450
           +++  + +IL +   + D   S    L  ++DPQG RTI V+TK+DL ++     +  + 
Sbjct: 431 YMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPQGKRTIFVLTKVDLAEKNLASPSRIQQ 490

Query: 451 VLENKLLPLRR-GYIGVV 501
           ++E KL P++  GY  VV
Sbjct: 491 IVEGKLFPMKALGYFAVV 508



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGL 217
           K  D   +R EIE    +     + +SP  I+L V  P +  + L+DLPG+
Sbjct: 358 KEEDLAALRHEIELRMRKSVKEGQTVSPETISLSVKGPGIQRMVLVDLPGV 408


>UniRef50_Q9LQ55 Cluster: Dynamin-2B; n=25; Magnoliophyta|Rep:
           Dynamin-2B - Arabidopsis thaliana (Mouse-ear cress)
          Length = 920

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/52 (40%), Positives = 37/52 (71%), Gaps = 2/52 (3%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPAN--TDLANSDALKLAKEVDPQGLRTIGVITKLD 420
           MI +  +    ++L V PA+  +++++S ALK+AKE DP+  RT+G+I+K+D
Sbjct: 156 MIGEHAQHNDAILLVVVPASQASEISSSRALKIAKEYDPESTRTVGIISKID 207


>UniRef50_Q1DI47 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 841

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 24/86 (27%), Positives = 49/86 (56%), Gaps = 4/86 (4%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ ++  ++  +  LILAV  A  +  N + L LA++ D +  RT+ +ITK D + +G++
Sbjct: 184 VRNLVKSYMSNQRSLILAVISAKNEYNNQEVLDLAEKYDKKRERTLAIITKPDTLPKGSE 243

Query: 442 AR----DVLENKLLPLRRGYIGVVNR 507
                 D++ N+ + L+ G+  + NR
Sbjct: 244 EEQMYIDLVNNERIKLQLGWHALRNR 269


>UniRef50_A2QTG5 Cluster: Function: the molecular function of MxA
           remains elusive; n=2; Aspergillus|Rep: Function: the
           molecular function of MxA remains elusive - Aspergillus
           niger
          Length = 788

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLM 426
           Q ++ ++  +++    +ILAV  A  D AN   L+LA++ D  G RT+GVITK D +
Sbjct: 164 QLVQNVVQSYMKEPRSVILAVISAKNDYANQIVLRLARDADKSGDRTLGVITKPDTL 220


>UniRef50_O60313 Cluster: Dynamin-like 120 kDa protein,
           mitochondrial precursor (Optic atrophy protein 1)
           [Contains: Dynamin-like 120 kDa protein, form S1]; n=47;
           Eumetazoa|Rep: Dynamin-like 120 kDa protein,
           mitochondrial precursor (Optic atrophy protein 1)
           [Contains: Dynamin-like 120 kDa protein, form S1] - Homo
           sapiens (Human)
          Length = 960

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)
 Frame = +1

Query: 283 FIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDA----RD 450
           +++  + +IL +   + D   S    L  ++DP G RTI V+TK+DL ++   +    + 
Sbjct: 425 YMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQ 484

Query: 451 VLENKLLPLRR-GYIGVV 501
           ++E KL P++  GY  VV
Sbjct: 485 IIEGKLFPMKALGYFAVV 502



 Score = 32.7 bits (71), Expect = 7.6
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGL 217
           K  D   +R EIE    +       +SP  I+L V  P +  + L+DLPG+
Sbjct: 352 KEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGV 402


>UniRef50_Q2GM17 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 1052

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 24/57 (42%), Positives = 32/57 (56%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDL 423
           R+ + G+I  ++ +   +IL V  AN  LAN   L  A   DP   RTIGVITK D+
Sbjct: 190 REIVNGLIESYMEQAKSIILLVVAANQPLANQAVLSTAARHDPDRERTIGVITKPDM 246


>UniRef50_A1DNM1 Cluster: Dynamin family protein; n=4;
           Trichocomaceae|Rep: Dynamin family protein - Neosartorya
           fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 852

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 24/94 (25%), Positives = 52/94 (55%), Gaps = 4/94 (4%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ +  +++     +ILAV  A TD    + L +A+  DP+  RT+G+IT+ D+++  ++
Sbjct: 183 VRKLTERYMNNPRSIILAVISAKTDYHLQEVLNIAERFDPKRERTLGIITQPDILEANSE 242

Query: 442 ARDV----LENKLLPLRRGYIGVVNRCRKTLTVA 531
             D     ++N+ + L  G+  + NR  +T  ++
Sbjct: 243 EEDTYLHFIKNEKIHLDLGWHVLRNRSFETRAIS 276


>UniRef50_A4QQ56 Cluster: Putative uncharacterized protein; n=4;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 871

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 3/88 (3%)
 Frame = +1

Query: 211 GSDKSANR*SAYRYRQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGL 390
           G  ++AN   +    + I+ +  ++++    +ILAV   N+D   +  L   ++ DP G 
Sbjct: 164 GLVRNANNDQSLEDIRTIEALSDRYMKSSRTIILAVVGGNSDYVQAPILTKVRQFDPNGN 223

Query: 391 RTIGVITKLDLMDE-GTDAR--DVLENK 465
           RT+GV+TK DL +  G + +  D++ NK
Sbjct: 224 RTLGVLTKPDLTESIGLEDKFIDLVSNK 251


>UniRef50_UPI0000E49010 Cluster: PREDICTED: similar to Optic atrophy
           1 (human); n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Optic atrophy 1 (human) -
           Strongylocentrotus purpuratus
          Length = 686

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 5/73 (6%)
 Frame = +1

Query: 298 SCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG----TDARDVLENK 465
           + +IL +     D   S    L  E+DP G RTI V+TK+DL ++        R +L+ +
Sbjct: 388 NAIILCIQDGAIDAERSIVTDLVNEIDPTGKRTIFVLTKVDLAEKNHLNPNRIRQILDGR 447

Query: 466 LLPLRR-GYIGVV 501
           L P++  GY  VV
Sbjct: 448 LFPMKALGYFAVV 460



 Score = 36.3 bits (80), Expect = 0.62
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = +2

Query: 65  KFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGL 217
           K ++   +R EIEA         + ISP  I+L V  P +  + L+DLPG+
Sbjct: 335 KESELKALRQEIEARMKGSVKEGQTISPEVISLSVRGPGIQRMVLVDLPGM 385


>UniRef50_Q7S2E2 Cluster: Putative uncharacterized protein
           NCU05936.1; n=2; Sordariales|Rep: Putative
           uncharacterized protein NCU05936.1 - Neurospora crassa
          Length = 979

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 21/60 (35%), Positives = 37/60 (61%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ +  ++I R++ +IL   P N D  NS A KL +E++ +  R +GV+TK DL+   T+
Sbjct: 342 VRNLTCEYISRQNAIILWAVPMNQDAENSFAFKLIQEMNAED-RCVGVMTKADLLPRETN 400


>UniRef50_A0DHB8 Cluster: Chromosome undetermined scaffold_50, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_50,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 216

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 22/47 (46%), Positives = 27/47 (57%)
 Frame = +2

Query: 35  YAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYS 175
           +A F     KKFTDF +VR EI+  TD   G  K I P PI L ++S
Sbjct: 82  WAIFKEVPEKKFTDFTKVREEIDRLTDAKAGQKKNILPDPIELTIWS 128


>UniRef50_A6R9S4 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 807

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG-- 435
           ++ ++ Q+I   SC +L   P   D  NS A ++ +EV     RT+GV+TK D +  G  
Sbjct: 239 VENLVKQYISTSSCTVLLTLPMTDDATNSSAARIIREVGATA-RTLGVLTKPDRVGYGEG 297

Query: 436 -TDARDVLENKLLPLRRGYIGVVN 504
                ++L  +   +  GY  V N
Sbjct: 298 YNQWEEILRGEKFTVGHGYYVVHN 321


>UniRef50_Q1E807 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 775

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ +  ++I+ ++ ++L   P   D  NS A ++ +EV     RT+GV+TK D +D G +
Sbjct: 200 VENLAKEYIKADNTIVLLTMPMTDDATNSSAARIIREVRGARDRTLGVLTKPDRIDAGYE 259

Query: 442 A-RDVLENKLLPLRRGYIGVVN 504
             +++L  +   L   Y  V N
Sbjct: 260 QWQELLSGEKFLLGHEYFVVKN 281


>UniRef50_A5B0G4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 548

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/48 (39%), Positives = 33/48 (68%), Gaps = 2/48 (4%)
 Frame = +1

Query: 283 FIRRESCLILAVTPANT--DLANSDALKLAKEVDPQGLRTIGVITKLD 420
           +++    ++L +TPA    ++++S AL++AKE D    RTIGVI+K+D
Sbjct: 273 YVQHNDAILLVITPAAQAPEISSSRALRIAKEYDADSTRTIGVISKID 320


>UniRef50_A1CSA1 Cluster: Putative uncharacterized protein; n=1;
           Aspergillus clavatus|Rep: Putative uncharacterized
           protein - Aspergillus clavatus
          Length = 686

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 22/62 (35%), Positives = 33/62 (53%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARD 450
           ++  + + E   IL V  A T+    +AL LAK  DP   RTIGV+T L+ ++ G +   
Sbjct: 178 LVEAYWKHEGNSILVVNSATTNFGAKNALDLAKRFDPSYSRTIGVVTYLNALEPGPEREQ 237

Query: 451 VL 456
            L
Sbjct: 238 TL 239


>UniRef50_A5ABD6 Cluster: Function: Mx proteins have antiviral
           activities; n=2; Trichocomaceae|Rep: Function: Mx
           proteins have antiviral activities - Aspergillus niger
          Length = 802

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 23/90 (25%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           ++ +  ++++    +ILAV  A TD    + L +A+  DP+  RT+G+IT+ D ++  ++
Sbjct: 182 VRTLTEKYMKNARSIILAVISAKTDYHLQEVLNIAERFDPRRERTLGIITQPDTLEPNSE 241

Query: 442 AR----DVLENKLLPLRRGYIGVVNRCRKT 519
                   + N+ + L+ G+  + NR  +T
Sbjct: 242 EEGTYLQFISNQTIRLQLGWHVLRNRSFET 271


>UniRef50_Q0U4S4 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 893

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 4/85 (4%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           +K ++ ++++    LIL       D+ANS A  +A+ +     R +GV+TK D + E T 
Sbjct: 268 VKNLVSEYVKDPEALILVTCSMENDIANSTAGGIARALKATD-RCVGVLTKPDRLLE-TA 325

Query: 442 ARDVLEN----KLLPLRRGYIGVVN 504
             ++L N    K LPL  GY  V N
Sbjct: 326 CHEILHNVYEKKHLPLGHGYFVVRN 350


>UniRef50_A4UCB5 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 693

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +K +   +I +   + LAV  A  D AN   L+  +  D +G RT+GVITK D ++ G+
Sbjct: 189 VKEITDHYISQPRTICLAVISATNDAANQGILQQVRTFDRKGERTLGVITKPDKLESGS 247


>UniRef50_A2PZB9 Cluster: Dynamin related protein; n=1;
           Chlamydomonas reinhardtii|Rep: Dynamin related protein -
           Chlamydomonas reinhardtii
          Length = 881

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLM--DEG 435
           +K ++  ++     +I+   PA  D      L+ A+E DP+G R+IG+ITK D +  DE 
Sbjct: 289 VKSLVKCYLAPAHHIIVMTLPAGMDAETQAILQFAREADPEGRRSIGIITKPDKIGPDER 348

Query: 436 TD 441
           T+
Sbjct: 349 TE 350


>UniRef50_UPI000023EFD2 Cluster: hypothetical protein FG05351.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG05351.1 - Gibberella zeae PH-1
          Length = 940

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 20/58 (34%), Positives = 32/58 (55%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           ++ +  ++I   S +I+   P N+D  NS    L + +     RTIGV+TK DL+ EG
Sbjct: 326 VRNLSKEYILHPSAIIMCSMPMNSDAENSSTFGLVRRLGALN-RTIGVLTKADLIPEG 382


>UniRef50_A2QLV0 Cluster: Similarity to hypothetical protein Mx
           homolog - Equus caballus; n=1; Aspergillus niger|Rep:
           Similarity to hypothetical protein Mx homolog - Equus
           caballus - Aspergillus niger
          Length = 168

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 4/79 (5%)
 Frame = +1

Query: 283 FIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT---DARDV 453
           F+R  SC   ++     D    + LKLA++ DP+G+RT+GV++K DL  E      A D+
Sbjct: 36  FLRMYSCG-RSLRYMYVDNTTQEILKLAEDADPRGIRTMGVLSKPDLATEKAALDAAMDL 94

Query: 454 L-ENKLLPLRRGYIGVVNR 507
           L E +    + GY  V NR
Sbjct: 95  LQERRRNVFKLGYHVVKNR 113


>UniRef50_Q2GQG0 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 1019

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 21/56 (37%), Positives = 34/56 (60%)
 Frame = +1

Query: 280 QFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAR 447
           +++ +E+ +ILAV  A  DL     L  AK+ DP   RT+G+ITK D +++ +  R
Sbjct: 252 KYMSQENTIILAVFSAQNDLTAQKVLGEAKKYDPGLDRTLGIITKPDEVEDQSTKR 307


>UniRef50_A1D567 Cluster: Putative uncharacterized protein; n=1;
           Neosartorya fischeri NRRL 181|Rep: Putative
           uncharacterized protein - Neosartorya fischeri (strain
           ATCC 1020 / DSM 3700 / NRRL 181)(Aspergillus
           fischerianus (strain ATCC 1020 / DSM 3700 / NRRL 181))
          Length = 527

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +1

Query: 286 IRRESCLILAVTPANTDLANSD-ALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVL 456
           ++ ++ LILAV  A       +  LKLAK  DP   RTIG++T  D +   ++  ++L
Sbjct: 1   MKNKATLILAVISAKIGYQQQEEVLKLAKRFDPTNERTIGIVTHTDTLQRNSEQENIL 58


>UniRef50_A5APF0 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 190

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 18/28 (64%), Positives = 23/28 (82%)
 Frame = +1

Query: 337 LANSDALKLAKEVDPQGLRTIGVITKLD 420
           +A+S ALK+AKE D  G RTIGVI+K+D
Sbjct: 1   MASSRALKIAKEYDGDGTRTIGVISKID 28


>UniRef50_Q9LKV0 Cluster: F21B23.2 protein; n=2; Arabidopsis
           thaliana|Rep: F21B23.2 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 251

 Score = 35.1 bits (77), Expect(2) = 0.074
 Identities = 13/20 (65%), Positives = 19/20 (95%)
 Frame = +2

Query: 182 VLNLTLIDLPGLTKVPIGDQ 241
           ++NLTL+DLPGLTKV +G++
Sbjct: 209 IVNLTLVDLPGLTKVAVGNK 228



 Score = 23.4 bits (48), Expect(2) = 0.074
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 89  RGEIEAETDRVTGSNKGISPVPINLRVYSPN 181
           +G    ET R   S+K +S VP++  ++SPN
Sbjct: 144 QGTNAVETGR---SSKVVSTVPLHRSIFSPN 171


>UniRef50_A4QWP1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 910

 Score = 39.1 bits (87), Expect = 0.088
 Identities = 22/75 (29%), Positives = 39/75 (52%)
 Frame = +1

Query: 211 GSDKSANR*SAYRYRQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGL 390
           G  K+  R   +   + ++ M  ++I   + +I+   P N+D  NS  L + ++   Q  
Sbjct: 276 GLIKATRREEDHYLVKVVENMARKYIADPNAIIMWAVPMNSDPENSSTLAIIRKEAAQN- 334

Query: 391 RTIGVITKLDLMDEG 435
           RT+GV+TK DL+  G
Sbjct: 335 RTVGVLTKADLLPPG 349


>UniRef50_UPI0000499FD7 Cluster: dynamin-like protein; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: dynamin-like
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 790

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLD-LMD 429
           ++ I  M+ + I   + +I+ +  + T+ ANS +  L KEVDP   RT+ + TK D  + 
Sbjct: 274 KEDIDQMVKELITPSNRIIVCLEQSTTEWANSVSRPLVKEVDPNFNRTVLINTKFDNRVK 333

Query: 430 EGTDARDV 453
           E TD + V
Sbjct: 334 ELTDTQTV 341


>UniRef50_Q800G3 Cluster: MxG protein; n=8; Danio rerio|Rep: MxG
           protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 281

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 17/39 (43%), Positives = 30/39 (76%), Gaps = 2/39 (5%)
 Frame = +1

Query: 403 VITKLDLMDEGTDAR--DVLENKLLPLRRGYIGVVNRCR 513
           V+TK D++D+GT+     +++NK++PLR+GY+ V  +CR
Sbjct: 1   VLTKPDIIDKGTEKNILAIVQNKVIPLRKGYVMV--KCR 37


>UniRef50_A4S2I7 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 853

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +2

Query: 83  EVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           +VR  +E       G   G++   I + +YSP  +NL LIDLPG+    I  +P D+
Sbjct: 131 QVRTWMEELVAAANGKVTGVTDDRIIIELYSPLCVNLDLIDLPGIVAGSIPGEPTDM 187


>UniRef50_Q86JH7 Cluster: Similar to Arabidopsis thaliana (Mouse-ear
           cress). F8L10.1 protein; n=2; Dictyostelium
           discoideum|Rep: Similar to Arabidopsis thaliana
           (Mouse-ear cress). F8L10.1 protein - Dictyostelium
           discoideum (Slime mold)
          Length = 908

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 19/58 (32%), Positives = 34/58 (58%)
 Frame = +1

Query: 247 RYRQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLD 420
           R + +I  M+ + I  ++ +I+ +  +N + AN+ +  L K++DP   RTI V TK D
Sbjct: 293 RLKYEISEMVKKLIEPKNRIIVCLEQSNVEWANTISRPLVKKIDPDFSRTILVNTKFD 350



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 71  TDFNEVRGEIEAETDRVTG-SNKGISPVPINLRVYSPNVLNLTLIDLPGLTK 223
           T  NE+  EI   T+  TG +   +S +PI LRV   +  NL + D PG  K
Sbjct: 237 TPVNELTEEIIRRTNERTGRAGDRVSSIPIFLRVEFAHCSNLNIYDTPGFRK 288


>UniRef50_Q2U3L9 Cluster: Predicted protein; n=4;
           Trichocomaceae|Rep: Predicted protein - Aspergillus
           oryzae
          Length = 709

 Score = 36.7 bits (81), Expect = 0.47
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 5/80 (6%)
 Frame = +1

Query: 283 FIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD--ARDVL 456
           ++  E  +IL V   N D+      +L +E+     R IGV+TK D   EG+D     +L
Sbjct: 209 YLNNERNIILVVVD-NVDVERHKTFELIEEIPSLQTRCIGVLTKCDRKQEGSDHWMIKLL 267

Query: 457 ENKL--LP-LRRGYIGVVNR 507
           +N L  +P L  G+ G+ NR
Sbjct: 268 QNDLATVPHLDHGWFGLRNR 287


>UniRef50_A1DA37 Cluster: Putative uncharacterized protein; n=1;
           Neosartorya fischeri NRRL 181|Rep: Putative
           uncharacterized protein - Neosartorya fischeri (strain
           ATCC 1020 / DSM 3700 / NRRL 181)(Aspergillus
           fischerianus (strain ATCC 1020 / DSM 3700 / NRRL 181))
          Length = 637

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
 Frame = +1

Query: 376 DPQGLRTIGVITKLDLMDEGTD--ARDVLENKLLPLRRGYIGVVNRCRKTLTVART-*PL 546
           +PQG RT+G+ITK D ++ G +     +  N++  L  G+  V NR  + +    T    
Sbjct: 177 NPQGARTVGIITKCDALEPGDEDGVLRIARNEVERLNHGWYVVKNRSTREIRDGVTIEER 236

Query: 547 HLRLRE 564
           H+R RE
Sbjct: 237 HIRERE 242


>UniRef50_A7HZZ7 Cluster: Flavodoxin; n=1; Campylobacter hominis
           ATCC BAA-381|Rep: Flavodoxin - Campylobacter hominis
           (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 /CH001A)
          Length = 401

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 5/73 (6%)
 Frame = -2

Query: 205 INQRQVEHIRGINTQVNRYRRYTLVGTSNTI-----CLRLDLSSNFIEVRELLSLAV*EF 41
           IN  + +H   I+  +N + +  LVG S T        +LD+S NFIEV E       +F
Sbjct: 80  INHMEPDHSSSISLLLNVFPKMKLVGNSKTAEFIKGFYKLDISENFIEVGE---GETHKF 136

Query: 40  CIFCISIYKLPRA 2
             F ++ YK P A
Sbjct: 137 GNFALTFYKTPMA 149


>UniRef50_A0QQ07 Cluster: Putative uncharacterized protein; n=1;
           Mycobacterium smegmatis str. MC2 155|Rep: Putative
           uncharacterized protein - Mycobacterium smegmatis
           (strain ATCC 700084 / mc(2)155)
          Length = 490

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +2

Query: 38  AEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPIN-LRVYSPNVLNLTLIDLPG 214
           AEFL C+G   T     RG +E   + +       +   ++ +RV+ P+VL++ L+ LPG
Sbjct: 324 AEFLGCQGVPHTAAGPERGAVEPAGEPLGPLVAVRAAARVDDVRVHRPDVLDVELVLLPG 383

Query: 215 LTKVPIGDQPI 247
           L  V +G++ I
Sbjct: 384 LRHV-VGEEDI 393


>UniRef50_A5KQM2 Cluster: Putative uncharacterized protein; n=1;
            Ruminococcus torques ATCC 27756|Rep: Putative
            uncharacterized protein - Ruminococcus torques ATCC 27756
          Length = 1121

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = +1

Query: 238  SAYRYRQQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKL 417
            SAYR+R+QI  M+ Q    +S   + ++PA  +      + +A+E+D + +   G   ++
Sbjct: 871  SAYRHRRQINKMLSQIRFSDSIYQIDISPAKNENGQFYEMLMAEELDSKVIDHSGFDGQM 930

Query: 418  DLMDE 432
             LM++
Sbjct: 931  SLMED 935


>UniRef50_A7EI57 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 763

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 2/61 (3%)
 Frame = +1

Query: 265 KGMIFQFIRRESCLILAVT-PANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMD-EGT 438
           K ++ ++I     ++LAV  PAN +    D  +L  ++D    R IGVITK D ++ +G 
Sbjct: 245 KSLVDRYINNPRSIVLAVAHPANVE--TQDIFELIAKIDGWKDRVIGVITKCDKIEVDGD 302

Query: 439 D 441
           D
Sbjct: 303 D 303


>UniRef50_Q3LHM9 Cluster: Putative uncharacterized protein PpCpDnm;
           n=2; Physcomitrella patens subsp. patens|Rep: Putative
           uncharacterized protein PpCpDnm - Physcomitrella patens
           subsp. patens
          Length = 839

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 19/58 (32%), Positives = 28/58 (48%)
 Frame = +2

Query: 62  KKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIG 235
           +K    +E++  IE+E  R+ G     S   I L++      NLT+ID PGL     G
Sbjct: 162 EKEQSLDEIQAYIESENKRLEGETCQFSAKEIILKIEYKFCPNLTIIDTPGLISAAPG 219


>UniRef50_Q7MQU0 Cluster: UPF0090 protein WS2018; n=1; Wolinella
           succinogenes|Rep: UPF0090 protein WS2018 - Wolinella
           succinogenes
          Length = 142

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 4/46 (8%)
 Frame = +2

Query: 38  AEFLHCKGK----KFTDFNEVRGEIEAETDRVTGSNKGISPVPINL 163
           A + H  G+    KF D NE+ GEIEA  D  +   KG  P+P +L
Sbjct: 88  AHYQHALGELARIKFADKNEIEGEIEA-ADETSVKLKGEEPIPYSL 132


>UniRef50_Q84KL1 Cluster: Dynamin related protein involved in
           chloroplast division; n=1; Cyanidioschyzon merolae|Rep:
           Dynamin related protein involved in chloroplast division
           - Cyanidioschyzon merolae (Red alga)
          Length = 962

 Score = 32.7 bits (71), Expect = 7.6
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
 Frame = +2

Query: 56  KGKKFTDFNEVRGEIEAETDRV-TGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVP 229
           +G++     E++  IEAE  ++ T   +   P  I +R+      NLTLID PGL   P
Sbjct: 181 QGEEQRSLAEIQAYIEAENLKLETDPFRSFDPEEIIIRIEYKYCPNLTLIDTPGLLSPP 239


>UniRef50_Q00ZF0 Cluster: Mitofusin 1 GTPase, involved in
           mitochondrila biogenesis; n=1; Ostreococcus tauri|Rep:
           Mitofusin 1 GTPase, involved in mitochondrila biogenesis
           - Ostreococcus tauri
          Length = 849

 Score = 32.7 bits (71), Expect = 7.6
 Identities = 19/58 (32%), Positives = 31/58 (53%)
 Frame = +1

Query: 280 QFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDV 453
           +F+ R   LIL V  A+  +  S+ +K    +   G + + V+ K DL++E  D RDV
Sbjct: 407 EFVPRAD-LILFVLSADRPMTESE-VKFLTYIRKWGKKVVFVVNKTDLLEEANDVRDV 462


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 619,479,141
Number of Sequences: 1657284
Number of extensions: 11900205
Number of successful extensions: 31002
Number of sequences better than 10.0: 150
Number of HSP's better than 10.0 without gapping: 30017
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30979
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 47296372782
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -