SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7PZX9 Cluster: ENSANGP00000014054; n=2; Culicidae|Rep:...   110   2e-23
UniRef50_P46778 Cluster: 60S ribosomal protein L21; n=329; Fungi...   109   5e-23
UniRef50_Q02753 Cluster: 60S ribosomal protein L21-A; n=31; Euka...   100   2e-20
UniRef50_UPI0001553B37 Cluster: PREDICTED: similar to ribosomal ...    99   7e-20
UniRef50_Q43291 Cluster: 60S ribosomal protein L21-1; n=24; Euka...    98   1e-19
UniRef50_Q4KTG5 Cluster: L21; n=2; Metazoa|Rep: L21 - Suberites ...    98   1e-19
UniRef50_UPI0000DD8153 Cluster: PREDICTED: similar to ribosomal ...    83   3e-15
UniRef50_UPI0000E24650 Cluster: PREDICTED: similar to Ribosomal ...    79   5e-14
UniRef50_Q23TC8 Cluster: 60S ribosomal protein L21, putative; n=...    79   8e-14
UniRef50_P38653 Cluster: 60S ribosomal protein L21; n=2; Entamoe...    79   8e-14
UniRef50_Q7XYA8 Cluster: 60S ribosome protein L21; n=1; Griffith...    77   3e-13
UniRef50_A2F2S5 Cluster: Ribosomal protein L21e, putative; n=6; ...    76   4e-13
UniRef50_Q4QEX4 Cluster: 60S ribosomal protein l21, putative; n=...    75   1e-12
UniRef50_Q7R5F3 Cluster: GLP_165_41283_41762; n=3; Eukaryota|Rep...    74   2e-12
UniRef50_A6RC90 Cluster: 60s ribosomal protein l21; n=1; Ajellom...    73   3e-12
UniRef50_Q5CX53 Cluster: 60s ribosomal protein L21; n=3; Cryptos...    73   4e-12
UniRef50_Q7REC3 Cluster: Ribosomal protein L21e, putative; n=5; ...    72   7e-12
UniRef50_Q8SRW8 Cluster: 60S ribosomal protein L21; n=1; Encepha...    71   1e-11
UniRef50_Q1KYN7 Cluster: RPL21; n=1; Streblomastix strix|Rep: RP...    69   5e-11
UniRef50_A3E3H5 Cluster: 60S ribosomal protein I21; n=3; Alveola...    68   2e-10
UniRef50_UPI0000DC1311 Cluster: UPI0000DC1311 related cluster; n...    51   1e-05
UniRef50_Q9SHE5 Cluster: T19E23.15; n=1; Arabidopsis thaliana|Re...    51   2e-05
UniRef50_A4D227 Cluster: Similar to 60S RIBOSOMAL PROTEIN L21; n...    51   2e-05
UniRef50_Q9UXE0 Cluster: 50S ribosomal protein L21e; n=6; Thermo...    51   2e-05
UniRef50_Q4JB11 Cluster: 50S ribosomal protein L21e; n=8; Archae...    51   2e-05
UniRef50_UPI0000DA1EED Cluster: PREDICTED: similar to 60S riboso...    50   3e-05
UniRef50_Q9M2R5 Cluster: Putative uncharacterized protein T10K17...    50   3e-05
UniRef50_UPI0000D9A1A6 Cluster: PREDICTED: similar to 60S riboso...    49   6e-05
UniRef50_Q9AW28 Cluster: 60S ribosomal protein L21; n=1; Guillar...    47   3e-04
UniRef50_Q64E17 Cluster: Ribosomal protein L21E; n=3; environmen...    45   0.001
UniRef50_Q42194 Cluster: 60S ribosomal protein L21; n=10; Magnol...    44   0.002
UniRef50_Q75F53 Cluster: AAL125Wp; n=1; Eremothecium gossypii|Re...    38   0.11 
UniRef50_O74001 Cluster: 50S ribosomal protein L21e; n=15; Archa...    38   0.19 
UniRef50_Q8PU21 Cluster: 50S ribosomal protein L21e; n=7; Euryar...    36   0.77 
UniRef50_A5BFS9 Cluster: Putative uncharacterized protein; n=15;...    35   1.3  
UniRef50_O28743 Cluster: 50S ribosomal protein L21e; n=5; Euryar...    35   1.3  
UniRef50_A0BGP7 Cluster: Chromosome undetermined scaffold_106, w...    34   1.8  
UniRef50_Q6L228 Cluster: 50S ribosomal protein L21e; n=2; Thermo...    34   1.8  
UniRef50_A7TAZ0 Cluster: Predicted protein; n=1; Nematostella ve...    34   2.4  
UniRef50_A0LQP4 Cluster: Putative uncharacterized protein; n=1; ...    33   3.1  
UniRef50_Q5H358 Cluster: Citrate-dependent iron transporter; n=6...    33   4.1  
UniRef50_UPI0000E1FC07 Cluster: PREDICTED: hypothetical protein;...    33   5.4  
UniRef50_Q6Q883 Cluster: SirP; n=2; Ascomycota|Rep: SirP - Lepto...    33   5.4  
UniRef50_A0RUT3 Cluster: Ribosomal protein L21E; n=2; Thermoprot...    33   5.4  
UniRef50_Q03214 Cluster: Protein ECM5; n=2; Saccharomyces cerevi...    33   5.4  
UniRef50_O48796 Cluster: F24O1.5; n=6; Arabidopsis thaliana|Rep:...    32   7.2  
UniRef50_Q8UCM9 Cluster: Iron-chelator utilization protein; n=1;...    32   9.5  

>UniRef50_Q7PZX9 Cluster: ENSANGP00000014054; n=2; Culicidae|Rep:
           ENSANGP00000014054 - Anopheles gambiae str. PEST
          Length = 162

 Score =  110 bits (264), Expect = 2e-23
 Identities = 48/59 (81%), Positives = 53/59 (89%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HGTIPLSTYMK+YK GD VDI+G+GAV KGMP+K YHGKTGRVYNV+ HALGVIVN
Sbjct: 19  FRKHGTIPLSTYMKIYKSGDYVDIKGHGAVHKGMPYKAYHGKTGRVYNVSKHALGVIVN 77



 Score =  104 bits (249), Expect = 1e-21
 Identities = 49/85 (57%), Positives = 66/85 (77%), Gaps = 3/85 (3%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKEN--ERL-LKEAKAAGKTVNLKRQPAP 424
           +RVRG+I+PKRIN+RVEHV+ S+CR+DFL+RVKEN  +R+ L+  K  G  V+LKR+P  
Sbjct: 78  KRVRGKILPKRINVRVEHVQPSRCREDFLRRVKENVEKRMALRGKKLPGFKVSLKRKPKQ 137

Query: 425 PKAAHIVSGTEKPVLLAPIPYEFVA 499
           P+ A ++    KP+ LAPIPYEFVA
Sbjct: 138 PRQAQVIKNPPKPIFLAPIPYEFVA 162



 Score = 33.1 bits (72), Expect = 4.1
 Identities = 13/17 (76%), Positives = 15/17 (88%)
 Frame = +1

Query: 25 MTNSKGYXXGTRDLFAR 75
          MTNSKGY  GTRD+F+R
Sbjct: 1  MTNSKGYRRGTRDMFSR 17


>UniRef50_P46778 Cluster: 60S ribosomal protein L21; n=329;
           Fungi/Metazoa group|Rep: 60S ribosomal protein L21 -
           Homo sapiens (Human)
          Length = 160

 Score =  109 bits (261), Expect = 5e-23
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKA 433
           ++V+G+I+ KRIN+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ 
Sbjct: 78  KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPRE 137

Query: 434 AHIV-SGTEKPVLLAPIPYEFVA 499
           AH V +  ++P LL PIPYEF+A
Sbjct: 138 AHFVRTNGKEPELLEPIPYEFMA 160



 Score =  108 bits (259), Expect = 9e-23
 Identities = 44/59 (74%), Positives = 52/59 (88%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VN
Sbjct: 19  FRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVN 77


>UniRef50_Q02753 Cluster: 60S ribosomal protein L21-A; n=31;
           Eukaryota|Rep: 60S ribosomal protein L21-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 160

 Score =  100 bits (240), Expect = 2e-20
 Identities = 44/74 (59%), Positives = 56/74 (75%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           G   R + + +  FR HG + LSTY+KVYKVGDIVDI+ NG++QKGMPHK Y GKTG VY
Sbjct: 6   GYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKGMPHKFYQGKTGVVY 65

Query: 219 NVTAHALGVIVNSV 260
           NVT  ++GVI+N +
Sbjct: 66  NVTKSSVGVIINKM 79



 Score = 91.9 bits (218), Expect = 8e-18
 Identities = 45/78 (57%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +2

Query: 260 VRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAH 439
           V  R + KR+N+RVEH+KHSKCRQ+FL+RVK N     EAKA G  V LKRQPA P+ + 
Sbjct: 80  VGNRYLEKRLNLRVEHIKHSKCRQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESR 139

Query: 440 IVSGT-EKPVLLAPIPYE 490
           IVS     P  LAP+PYE
Sbjct: 140 IVSTEGNVPQTLAPVPYE 157


>UniRef50_UPI0001553B37 Cluster: PREDICTED: similar to ribosomal
           protein L21; n=1; Mus musculus|Rep: PREDICTED: similar
           to ribosomal protein L21 - Mus musculus
          Length = 159

 Score = 98.7 bits (235), Expect = 7e-20
 Identities = 41/53 (77%), Positives = 46/53 (86%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHA 236
           FR HG +PL+TYM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA
Sbjct: 19  FRKHGIVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHA 71


>UniRef50_Q43291 Cluster: 60S ribosomal protein L21-1; n=24;
           Eukaryota|Rep: 60S ribosomal protein L21-1 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 164

 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (0%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           G+  R + L    FR  G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+TGR++
Sbjct: 6   GVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIW 65

Query: 219 NVTAHALGVIVNSVFAEGLYRS-ASISVLSMSSTPSADKTSLRESK 353
           NVT  A+GV VN      + R    + V  +  +  A++  LR+ K
Sbjct: 66  NVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKK 111



 Score = 75.8 bits (178), Expect = 6e-13
 Identities = 36/84 (42%), Positives = 54/84 (64%)
 Frame = +2

Query: 245 DCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAP 424
           +  +++  RII KRI++RVEHV+ S+C ++F  R K+N+ L   AKA G+T++ KRQP  
Sbjct: 75  EVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKG 134

Query: 425 PKAAHIVSGTEKPVLLAPIPYEFV 496
           PK   +V G      + PIPY+ V
Sbjct: 135 PKPGFMVEGMTLET-VTPIPYDVV 157


>UniRef50_Q4KTG5 Cluster: L21; n=2; Metazoa|Rep: L21 - Suberites
           domuncula (Sponge)
          Length = 160

 Score = 97.9 bits (233), Expect = 1e-19
 Identities = 43/64 (67%), Positives = 52/64 (81%)
 Frame = +3

Query: 63  LVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALG 242
           L   +++ +G   LSTYMKVYKVGDIVD++GNGA  KGMP+K YHGKTG+VYNVT  A+G
Sbjct: 14  LFSREYKKNGVQHLSTYMKVYKVGDIVDVKGNGAFHKGMPYKFYHGKTGKVYNVTKRAVG 73

Query: 243 VIVN 254
           VIVN
Sbjct: 74  VIVN 77



 Score = 89.8 bits (213), Expect = 3e-17
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +2

Query: 260 VRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQP-APPKAA 436
           +R +I+ KRIN+R+EHVKHS+CR+DFL RVK NE     A+  G+ V  KR P AP KA+
Sbjct: 80  LRNKILQKRINVRIEHVKHSRCREDFLSRVKLNEEKKHAARERGEKVVCKRMPLAPRKAS 139

Query: 437 HIVSGTEKPVLLAPIPYEFVA 499
            +    ++P L+ PIPYEFVA
Sbjct: 140 FVKMQGKEPELVEPIPYEFVA 160


>UniRef50_UPI0000DD8153 Cluster: PREDICTED: similar to ribosomal
           protein L21; n=1; Homo sapiens|Rep: PREDICTED: similar
           to ribosomal protein L21 - Homo sapiens
          Length = 125

 Score = 83.4 bits (197), Expect = 3e-15
 Identities = 35/59 (59%), Positives = 43/59 (72%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR H  +PL+ YM++ K GDI+DI+G G VQKGMPHK YHGK  RVY V  HA G++ N
Sbjct: 19  FRKHEVVPLAMYMQICKKGDIIDIKGVGTVQKGMPHKCYHGKAERVYLVPQHAAGIVEN 77



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%)
 Frame = +2

Query: 347 VKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPVLLAPIPYEFVA 499
           + EN++  KEAK  G  V LKRQP PP+ A  V +  +KP LL P+PYEF+A
Sbjct: 74  IVENDQKKKEAKENGTWVQLKRQPPPPRKADFVRTNGKKPELLDPLPYEFMA 125


>UniRef50_UPI0000E24650 Cluster: PREDICTED: similar to Ribosomal
           protein L21; n=1; Pan troglodytes|Rep: PREDICTED:
           similar to Ribosomal protein L21 - Pan troglodytes
          Length = 234

 Score = 79.4 bits (187), Expect = 5e-14
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query: 263 RGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHI 442
           +G+ + K++N+ +EH+KHS+    FLK +K N++  K+AK     V LKRQPAPP+ A I
Sbjct: 155 KGKNLVKKMNVLIEHIKHSESWNHFLKHIKINDQKKKDAKEKSMWVQLKRQPAPPREARI 214

Query: 443 VSGTEK-PVLLAPIPYEFVA 499
           V    K   LL P+PYEF+A
Sbjct: 215 VKTNGKASELLEPVPYEFIA 234



 Score = 62.1 bits (144), Expect = 8e-09
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +3

Query: 84  THGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           +HG+IP    + V   GDIVDI+G GAVQKG+PHK +HGKT +       A+G++ N
Sbjct: 98  SHGSIPNPKGISVVAEGDIVDIKGMGAVQKGIPHKHFHGKTQKSLQCYQQAVGIVGN 154


>UniRef50_Q23TC8 Cluster: 60S ribosomal protein L21, putative; n=9;
           Oligohymenophorea|Rep: 60S ribosomal protein L21,
           putative - Tetrahymena thermophila SB210
          Length = 180

 Score = 78.6 bits (185), Expect = 8e-14
 Identities = 40/93 (43%), Positives = 59/93 (63%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNS 257
           ++T G + +S Y+  YKVG+ VDI  +G+  KGMP+K+YHG+TG+V+NV   ++GVIV+ 
Sbjct: 42  YKTKGHVRISRYLTTYKVGEYVDIMVDGSQHKGMPYKLYHGRTGKVFNVNPRSIGVIVHR 101

Query: 258 VFAEGLYRSASISVLSMSSTPSADKTSLRESKR 356
           +   G Y    + V      PS  KT+L  SKR
Sbjct: 102 I-VNGRYIEKRLHVKIEHVRPSNVKTAL--SKR 131



 Score = 52.0 bits (119), Expect = 8e-06
 Identities = 25/64 (39%), Positives = 36/64 (56%)
 Frame = +2

Query: 260 VRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAH 439
           V GR I KR+++++EHV+ S  +    KR + N++   E   AGK V+ KR P  P  A 
Sbjct: 103 VNGRYIEKRLHVKIEHVRPSNVKTALSKRYQANDQAKAEGNKAGKRVSTKRNPGQPLEAV 162

Query: 440 IVSG 451
            V G
Sbjct: 163 QVQG 166


>UniRef50_P38653 Cluster: 60S ribosomal protein L21; n=2; Entamoeba
           histolytica|Rep: 60S ribosomal protein L21 - Entamoeba
           histolytica
          Length = 166

 Score = 78.6 bits (185), Expect = 8e-14
 Identities = 36/72 (50%), Positives = 47/72 (65%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           G   R + L +  FR HG    ST +  YKVGD V I  N ++Q G+P+K +HGKTGRV+
Sbjct: 6   GRNRRTRKLFKRPFRGHGLSNTSTILHTYKVGDYVTILCNSSIQHGLPYKAFHGKTGRVW 65

Query: 219 NVTAHALGVIVN 254
           NV  HA+GV+VN
Sbjct: 66  NVNPHAIGVMVN 77



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 8/87 (9%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRV-------KENERLLKEAKAAGKTVNLKR 412
           ++V  RI+ KR++I  EH++ S C++DFL+R        K+N +L KE K     +  KR
Sbjct: 78  KKVNNRIVVKRLHISPEHIRPSGCQKDFLERKAAVAAIRKQNIQLKKEGKPL-LPLPAKR 136

Query: 413 QPAPPKAAHIVSGTE-KPVLLAPIPYE 490
            P  P+ A ++ G + K   +AP+ +E
Sbjct: 137 LPKQPRPAELIKGADIKFTTVAPLKFE 163


>UniRef50_Q7XYA8 Cluster: 60S ribosome protein L21; n=1; Griffithsia
           japonica|Rep: 60S ribosome protein L21 - Griffithsia
           japonica (Red alga)
          Length = 159

 Score = 76.6 bits (180), Expect = 3e-13
 Identities = 42/85 (49%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +2

Query: 245 DCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAG-KTVNLKRQPA 421
           +  +RVR RII KR +IR+EHV+ S+C +DFL R K  E   +EA   G K   +KR PA
Sbjct: 75  EVSKRVRHRIINKRFHIRIEHVRKSQCNKDFLDRCKLREIEAQEAHKRGEKYTVVKRTPA 134

Query: 422 PPKAAHIVSGTEKPVLLAPIPYEFV 496
            P+ AH+V+  E   L+ PIPYEFV
Sbjct: 135 LPRDAHLVTAGEME-LVEPIPYEFV 158



 Score = 75.4 bits (177), Expect = 8e-13
 Identities = 33/64 (51%), Positives = 45/64 (70%)
 Frame = +3

Query: 63  LVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALG 242
           L +  FR  G    STY++V+K+G+ VDI  N  + KGMPHK YHG+TGRV+NV+  A+G
Sbjct: 14  LFKKAFRKSGNEHTSTYLQVFKIGEYVDIHINPTIMKGMPHKFYHGRTGRVFNVSRTAVG 73

Query: 243 VIVN 254
           V V+
Sbjct: 74  VEVS 77


>UniRef50_A2F2S5 Cluster: Ribosomal protein L21e, putative; n=6;
           Trichomonas vaginalis G3|Rep: Ribosomal protein L21e,
           putative - Trichomonas vaginalis G3
          Length = 159

 Score = 76.2 bits (179), Expect = 4e-13
 Identities = 33/72 (45%), Positives = 50/72 (69%)
 Frame = +3

Query: 36  QGLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRV 215
           +GL    + L   +FR HG    S  ++ +++GDIVDI+ NGA+  GMP++VYHG TG V
Sbjct: 5   EGLRHATRYLFARKFRKHGAPAPSITLRTFRIGDIVDIKVNGALHSGMPNRVYHGATGIV 64

Query: 216 YNVTAHALGVIV 251
           +NV+ HA+G++V
Sbjct: 65  WNVSPHAVGILV 76



 Score = 62.1 bits (144), Expect = 8e-09
 Identities = 35/78 (44%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +2

Query: 251 QQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNL-KRQPAPP 427
           ++RV   I PKRI +R EHV  SK + DF+ R + N +  +EAK AG  + L KR PA P
Sbjct: 77  KRRVNNHIAPKRIYVRTEHVFPSKSKNDFVARCQANLKAHEEAKKAGTKIALPKRLPAQP 136

Query: 428 KAAHIVSGTEKPVLLAPI 481
           +A+H+V    KP L+  I
Sbjct: 137 RASHVV----KPELIQTI 150


>UniRef50_Q4QEX4 Cluster: 60S ribosomal protein l21, putative; n=10;
           Trypanosomatidae|Rep: 60S ribosomal protein l21,
           putative - Leishmania major
          Length = 159

 Score = 74.5 bits (175), Expect = 1e-12
 Identities = 33/64 (51%), Positives = 44/64 (68%)
 Frame = +3

Query: 63  LVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALG 242
           L   +FR HG   +ST +   KVGD VD+  + AV++GMPHK YHG+TG V+NVT   +G
Sbjct: 14  LFAKKFRKHGVPSVSTILTNIKVGDYVDVVADSAVREGMPHKYYHGRTGIVWNVTPRGVG 73

Query: 243 VIVN 254
           VI+N
Sbjct: 74  VIIN 77



 Score = 36.3 bits (80), Expect = 0.44
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = +2

Query: 260 VRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENE-RLLKEAKAAGKTV 400
           VR R + KRI +R EHV+ S+C++ F  + KE++ +    AK AGK +
Sbjct: 80  VRTRTLRKRICVRFEHVRKSRCQEAF--KAKEHQFQAYLAAKKAGKAL 125


>UniRef50_Q7R5F3 Cluster: GLP_165_41283_41762; n=3; Eukaryota|Rep:
           GLP_165_41283_41762 - Giardia lamblia ATCC 50803
          Length = 159

 Score = 73.7 bits (173), Expect = 2e-12
 Identities = 40/83 (48%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +2

Query: 251 QQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVN-LKRQPAPP 427
           Q+RVRGRI+ KRIN+R+EHV  S CR++ L+RV  N+   + AK  G+ V  LKRQ A P
Sbjct: 77  QKRVRGRIMLKRINVRLEHVHPSDCRKNHLERVAANDAARRLAKETGQPVPCLKRQNALP 136

Query: 428 KAAHIVSGTEKPVLLAPIPYEFV 496
           +AAH+VS     + + P+ Y+ V
Sbjct: 137 RAAHVVS-IASAIDITPLKYDGV 158



 Score = 73.3 bits (172), Expect = 3e-12
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = +3

Query: 36  QGLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRV 215
           QG   + +     +FR HG   L+TY +VYK+G  V+I+ NGA  KGMPH+ Y+G+TG +
Sbjct: 5   QGYRCKTRYCFARKFRRHGMANLTTYNRVYKLGQYVNIKVNGAYHKGMPHRYYNGRTGTI 64

Query: 216 YNVTAHALGV 245
           +N+   ALGV
Sbjct: 65  FNIGPRALGV 74


>UniRef50_A6RC90 Cluster: 60s ribosomal protein l21; n=1;
           Ajellomyces capsulatus NAm1|Rep: 60s ribosomal protein
           l21 - Ajellomyces capsulatus NAm1
          Length = 163

 Score = 73.3 bits (172), Expect = 3e-12
 Identities = 47/100 (47%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKG-MPHKVYHGKTG-RVYNVTAHALGVIV 251
           ++ HG IPLSTYM+VY+VGDIVDI+ NGAVQ+G    KVYHGKTG  +    + A GVI+
Sbjct: 19  YKKHGVIPLSTYMRVYRVGDIVDIKVNGAVQQGSYAIKVYHGKTGVCLQRDKSLAFGVII 78

Query: 252 -----NSVFAEGLYRSASISVLSMSSTPSADKTSLRESKR 356
                N    E   R  S    S   TP  ++ S  ES+R
Sbjct: 79  YKRVGNRYIGEARQRPPS----STFPTPDPEENSSGESRR 114


>UniRef50_Q5CX53 Cluster: 60s ribosomal protein L21; n=3;
           Cryptosporidium|Rep: 60s ribosomal protein L21 -
           Cryptosporidium parvum Iowa II
          Length = 159

 Score = 72.9 bits (171), Expect = 4e-12
 Identities = 35/61 (57%), Positives = 41/61 (67%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNS 257
           FR  G   LS Y+K  KVGD VDI  + ++ KGMP+  YHG+TG VYNV   ALGVIVN 
Sbjct: 19  FRQKGVPMLSRYLKPIKVGDYVDIVVDSSIHKGMPYHFYHGRTGVVYNVAPRALGVIVNK 78

Query: 258 V 260
           V
Sbjct: 79  V 79



 Score = 58.0 bits (134), Expect = 1e-07
 Identities = 32/71 (45%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = +2

Query: 260 VRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAG-KTVNLKRQPAPPKAA 436
           V  R I KRIN+R+EHV+ S+C +DFLKRVK N+    EA  AG  +   KR P  P+  
Sbjct: 80  VGNRQIAKRINVRIEHVRLSRCNEDFLKRVKANDAARHEAHVAGLPSPVTKRVPQLPREG 139

Query: 437 HIVSGTEKPVL 469
             V  +   VL
Sbjct: 140 GFVDCSNMEVL 150


>UniRef50_Q7REC3 Cluster: Ribosomal protein L21e, putative; n=5;
           Plasmodium|Rep: Ribosomal protein L21e, putative -
           Plasmodium yoelii yoelii
          Length = 161

 Score = 72.1 bits (169), Expect = 7e-12
 Identities = 33/79 (41%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPK- 430
           +RVR RII K++ +R+EHV+ S+C +DF+ R K+N+ L+KEAK   + +++KR+   PK 
Sbjct: 79  KRVRHRIIQKKVCVRIEHVRKSRCNEDFILRKKKNQELIKEAKLKNERISVKRKTEGPKP 138

Query: 431 AAHIVSGTEKPVLLAPIPY 487
           AA I     K + + P+P+
Sbjct: 139 AAMIQVPPSKLITVEPLPF 157



 Score = 62.1 bits (144), Expect = 8e-09
 Identities = 26/59 (44%), Positives = 38/59 (64%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           FR HG    + Y++    GD VDI  + + QKGMP   YHG+TG+V+++T   +GV+VN
Sbjct: 20  FRKHGECTANKYLENINYGDYVDIVCDSSQQKGMPFNFYHGRTGKVFHITKRGVGVLVN 78


>UniRef50_Q8SRW8 Cluster: 60S ribosomal protein L21; n=1;
           Encephalitozoon cuniculi|Rep: 60S ribosomal protein L21
           - Encephalitozoon cuniculi
          Length = 160

 Score = 71.3 bits (167), Expect = 1e-11
 Identities = 31/61 (50%), Positives = 41/61 (67%)
 Frame = +3

Query: 63  LVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALG 242
           L     R HG   +S Y++ Y++GD+VDI  N A+ KGMPHK YHG+TGRVY+V   +L 
Sbjct: 13  LFSQDHRKHGVAHVSKYLEKYEIGDMVDILVNPAMMKGMPHKYYHGRTGRVYDVKPRSLN 72

Query: 243 V 245
           V
Sbjct: 73  V 73



 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 21/80 (26%), Positives = 46/80 (57%), Gaps = 2/80 (2%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTV--NLKRQPAPP 427
           +RVRG+ + K+I +R+EHV+ S+C ++  KR+     + ++A++ G  +  + ++   P 
Sbjct: 77  KRVRGKYVIKKIIVRIEHVRKSRCSEESQKRILMAAEMARDAESRGVVLAPSKRKIEGPR 136

Query: 428 KAAHIVSGTEKPVLLAPIPY 487
           KA  +     +P+ +   P+
Sbjct: 137 KAVEVSLDNNQPIEVGYEPH 156


>UniRef50_Q1KYN7 Cluster: RPL21; n=1; Streblomastix strix|Rep: RPL21
           - Streblomastix strix
          Length = 146

 Score = 69.3 bits (162), Expect = 5e-11
 Identities = 29/72 (40%), Positives = 45/72 (62%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           G   R + L +  F  HG    S Y++ + +GD VDI+ + A+ KGMP + YHG+TGR++
Sbjct: 6   GYRARTRTLFQKSFGKHGMPSTSRYLQKFNIGDYVDIKADSAIHKGMPFRYYHGRTGRIW 65

Query: 219 NVTAHALGVIVN 254
            +  HA+G+ VN
Sbjct: 66  ALFNHAVGIEVN 77



 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 23/57 (40%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +2

Query: 245 DCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKEN-ERLLKEAKAAGKTVNLKR 412
           +  +R   RII KR+ IR+EHV+ SKCRQDFL+R K +  + + +    G+ V++++
Sbjct: 75  EVNKRWGNRIIQKRVYIRIEHVRKSKCRQDFLQRCKTHAPKRVPQGPRKGQIVHIRK 131


>UniRef50_A3E3H5 Cluster: 60S ribosomal protein I21; n=3;
           Alveolata|Rep: 60S ribosomal protein I21 - Pfiesteria
           piscicida
          Length = 165

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 32/77 (41%), Positives = 49/77 (63%), Gaps = 1/77 (1%)
 Frame = +2

Query: 260 VRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAH 439
           V  R + KRI++ + HV+ S+C + FL+RVKEN++  ++AK  G  +  KRQP  PK   
Sbjct: 84  VGNRQLRKRIHVNIAHVRKSRCNEAFLRRVKENDQKKRDAKLQGLKIVCKRQPVGPKEMK 143

Query: 440 IVSGTEKPV-LLAPIPY 487
           IV   +  V +LAP+P+
Sbjct: 144 IVKAEDDDVEVLAPLPF 160



 Score = 65.7 bits (153), Expect = 6e-10
 Identities = 30/61 (49%), Positives = 40/61 (65%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNS 257
           +RT G    S YM V++ GD VDI  + +VQ GMPH  YHG+TG V+NV  +ALGV +  
Sbjct: 23  YRTKGLPGTSRYMAVFRRGDYVDICVDSSVQVGMPHSFYHGRTGIVFNVNRNALGVEITK 82

Query: 258 V 260
           +
Sbjct: 83  I 83


>UniRef50_UPI0000DC1311 Cluster: UPI0000DC1311 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC1311 UniRef100 entry -
           Rattus norvegicus
          Length = 88

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 7/87 (8%)
 Frame = +2

Query: 260 VRGRIIPKRINIRVEHVKHSKCR------QDFLKRVKENERLLKEAKAAGKTVNLKRQPA 421
           +R + IP R  + V  V +   R      ++F K +   E   +EA+  G  V LKRQP 
Sbjct: 2   LRAQFIPGRALLCVSKVLYQAQRSPILSSREFKKDLVTKENQEEEAEEKGAWVQLKRQPV 61

Query: 422 PPKAAHIV-SGTEKPVLLAPIPYEFVA 499
           PP+ AH+V +  ++P    PIPYEF+A
Sbjct: 62  PPREAHLVRTNGKEPEWQEPIPYEFMA 88


>UniRef50_Q9SHE5 Cluster: T19E23.15; n=1; Arabidopsis thaliana|Rep:
           T19E23.15 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 137

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 10/87 (11%)
 Frame = +2

Query: 254 QRVRGRIIPKRINIRVEHVKHSK----------CRQDFLKRVKENERLLKEAKAAGKTVN 403
           ++++ R I KRI++RVEHV+ S+          C  +F  R K+N+     AKA  +T++
Sbjct: 42  KQIKNRNIRKRIHVRVEHVQQSRTMCLRLQQSRCDDEFSLRKKQNDVFKAAAKAKCETIS 101

Query: 404 LKRQPAPPKAAHIVSGTEKPVLLAPIP 484
            KRQP  PK   +V G      + PIP
Sbjct: 102 TKRQPKGPKPCFMVEGMTLET-VTPIP 127



 Score = 35.9 bits (79), Expect = 0.58
 Identities = 17/38 (44%), Positives = 23/38 (60%)
 Frame = +3

Query: 60  GLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQK 173
           G V       G I LSTY+  +KVGD V+++ NGA+ K
Sbjct: 2   GFVLEVLWKKGYILLSTYLITFKVGDYVNVKVNGAIHK 39


>UniRef50_A4D227 Cluster: Similar to 60S RIBOSOMAL PROTEIN L21; n=1;
           Homo sapiens|Rep: Similar to 60S RIBOSOMAL PROTEIN L21 -
           Homo sapiens (Human)
          Length = 112

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 24/44 (54%), Positives = 28/44 (63%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTG 209
           FR  G +PL+TYM+VYK GD VDI+G   VQKG    V   K G
Sbjct: 7   FRKRGVVPLATYMRVYKKGDTVDIKGIDIVQKGSSAGVTAAKLG 50


>UniRef50_Q9UXE0 Cluster: 50S ribosomal protein L21e; n=6;
           Thermoprotei|Rep: 50S ribosomal protein L21e -
           Sulfolobus solfataricus
          Length = 101

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +3

Query: 36  QGLPXRHQGLVRSQFRTHGTIP-LSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGR 212
           +G   R + L+R   R  G +P LS  M  YK GD V ++ N +V +GMPH+ Y GK G+
Sbjct: 6   KGYRTRSRSLLRKSPRERGAVPSLSKLMVEYKEGDNVVVKINPSVHQGMPHRRYQGKVGK 65

Query: 213 VYNVTAHALGVIV 251
           +      A  V V
Sbjct: 66  IIGKRGRAYLVSV 78


>UniRef50_Q4JB11 Cluster: 50S ribosomal protein L21e; n=8;
           Archaea|Rep: 50S ribosomal protein L21e - Sulfolobus
           acidocaldarius
          Length = 103

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 28/74 (37%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +3

Query: 36  QGLPXRHQGLVRSQFRTHGTIP-LSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGR 212
           +G   + + L+  + R  G IP LS  M  Y  G+ V ++ N ++ KGMPH+ YHGK G 
Sbjct: 6   KGYRSKTRKLLEKKVREKGAIPKLSLLMHDYSQGEYVVVKINPSIHKGMPHRRYHGKVGL 65

Query: 213 VYNVTAHALGVIVN 254
           V      A  V VN
Sbjct: 66  VVGKRGKAYEVKVN 79


>UniRef50_UPI0000DA1EED Cluster: PREDICTED: similar to 60S ribosomal
           protein L21; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to 60S ribosomal protein L21 - Rattus norvegicus
          Length = 122

 Score = 50.0 bits (114), Expect = 3e-05
 Identities = 26/62 (41%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +2

Query: 200 KDRSRVQRDCSCSRC-DCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKE 376
           K    VQ++C   +C    Q     + P  I++ +EH+KHSK R   LKRVKEN++  KE
Sbjct: 43  KGMGTVQKECP--KCVTTAQPEESTMSPSMISVWIEHIKHSKSRDSLLKRVKENDQKKKE 100

Query: 377 AK 382
           AK
Sbjct: 101 AK 102



 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 20/35 (57%), Positives = 25/35 (71%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMP 182
           FR  G +PL TYM++YK  D+VDI+G G VQK  P
Sbjct: 19  FRKDGVVPLVTYMRIYKKVDVVDIKGMGTVQKECP 53


>UniRef50_Q9M2R5 Cluster: Putative uncharacterized protein
           T10K17.30; n=1; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein T10K17.30 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 89

 Score = 50.0 bits (114), Expect = 3e-05
 Identities = 22/52 (42%), Positives = 36/52 (69%)
 Frame = +2

Query: 257 RVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKR 412
           ++  +II KRI++ VEHV+ S+C  +F  R K+N+ L   +KA G+T++ KR
Sbjct: 38  QIGDKIIRKRIHVLVEHVQQSRCAVEFKLRKKKNDELKAASKARGETISTKR 89


>UniRef50_UPI0000D9A1A6 Cluster: PREDICTED: similar to 60S ribosomal
           protein L21; n=1; Macaca mulatta|Rep: PREDICTED: similar
           to 60S ribosomal protein L21 - Macaca mulatta
          Length = 82

 Score = 49.2 bits (112), Expect = 6e-05
 Identities = 18/26 (69%), Positives = 23/26 (88%)
 Frame = +3

Query: 177 MPHKVYHGKTGRVYNVTAHALGVIVN 254
           MPHK YH KTGRVYN+T +A+G++VN
Sbjct: 1   MPHKCYHSKTGRVYNITQNAVGIVVN 26



 Score = 37.9 bits (84), Expect = 0.14
 Identities = 18/43 (41%), Positives = 27/43 (62%)
 Frame = +2

Query: 371 KEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLAPIPYEFVA 499
           +EAK  G  V L + P+P +A  + +  ++P LLAP PYE +A
Sbjct: 39  REAKEKGTWVQLCQAPSPGEARFVKTTGKEPELLAPSPYELMA 81


>UniRef50_Q9AW28 Cluster: 60S ribosomal protein L21; n=1; Guillardia
           theta|Rep: 60S ribosomal protein L21 - Guillardia theta
           (Cryptomonas phi)
          Length = 156

 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 18/44 (40%), Positives = 31/44 (70%)
 Frame = +3

Query: 129 VGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNSV 260
           +GD+VDI  + + Q  MP K YHGKTG V+++ +++LG+ +  +
Sbjct: 35  IGDLVDIVIDPSFQSTMPFKFYHGKTGEVFSLNSNSLGIKIQKI 78


>UniRef50_Q64E17 Cluster: Ribosomal protein L21E; n=3; environmental
           samples|Rep: Ribosomal protein L21E - uncultured
           archaeon GZfos17A3
          Length = 130

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 21/58 (36%), Positives = 34/58 (58%)
 Frame = +3

Query: 81  RTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           R  G  P+S  ++ ++ G+ V IR + +V KGMPH+ +HG TG+V      A  V ++
Sbjct: 40  RARGLSPISKAIQQFEPGESVHIRIDPSVHKGMPHQRFHGMTGKVIGERGRAFIVEIS 97


>UniRef50_Q42194 Cluster: 60S ribosomal protein L21; n=10;
           Magnoliophyta|Rep: 60S ribosomal protein L21 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 72

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 20/42 (47%), Positives = 27/42 (64%)
 Frame = +3

Query: 51  RHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKG 176
           R + L    FR  G IPLSTY++ +KVG +   +GNGA+ KG
Sbjct: 10  RTRDLFARPFRKKGYIPLSTYLRTFKVGRLRRCQGNGAIHKG 51


>UniRef50_Q75F53 Cluster: AAL125Wp; n=1; Eremothecium gossypii|Rep:
           AAL125Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 369

 Score = 38.3 bits (85), Expect = 0.11
 Identities = 18/62 (29%), Positives = 35/62 (56%)
 Frame = +2

Query: 281 KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 460
           + +NI+    +  K + D L++ KEN+ L+K A + G   ++KR+  P +  ++ S  +K
Sbjct: 294 ENLNIKQAFARQDKYKTDVLEKQKENDILIKGAMSVGLQQDVKREGPPRQTTNLKSTVKK 353

Query: 461 PV 466
            V
Sbjct: 354 KV 355


>UniRef50_O74001 Cluster: 50S ribosomal protein L21e; n=15;
           Archaea|Rep: 50S ribosomal protein L21e - Pyrococcus
           horikoshii
          Length = 97

 Score = 37.5 bits (83), Expect = 0.19
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = +3

Query: 66  VRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRV 215
           +R   R  G  PL+ +++ ++VG  V I    +  KGMP   +HG+TG V
Sbjct: 16  LRKHPRRRGLPPLTRFLQEFEVGQKVHIVIEPSYHKGMPDPRFHGRTGTV 65


>UniRef50_Q8PU21 Cluster: 50S ribosomal protein L21e; n=7;
           Euryarchaeota|Rep: 50S ribosomal protein L21e -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 97

 Score = 35.5 bits (78), Expect = 0.77
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +3

Query: 81  RTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRV 215
           R  G  P+S  ++ ++ G +V I  + +VQKGMP+  + G TG+V
Sbjct: 20  RERGISPVSKAIQEFEDGQMVHIDIDPSVQKGMPNPKFQGFTGKV 64


>UniRef50_A5BFS9 Cluster: Putative uncharacterized protein; n=15;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 2326

 Score = 34.7 bits (76), Expect = 1.3
 Identities = 17/41 (41%), Positives = 27/41 (65%)
 Frame = +2

Query: 353 ENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLA 475
           ++E+ +KEAK A   + LK  PA  K A++V G E PV+++
Sbjct: 308 KDEKEMKEAKDAILKLELKTLPAELKYAYLVEGNEAPVVIS 348


>UniRef50_O28743 Cluster: 50S ribosomal protein L21e; n=5;
           Euryarchaeota|Rep: 50S ribosomal protein L21e -
           Archaeoglobus fulgidus
          Length = 97

 Score = 34.7 bits (76), Expect = 1.3
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = +3

Query: 66  VRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRV 215
           +R + R  G + +  +++ + VG  V I    A QKGMPH  + G+TG V
Sbjct: 16  LRKKVREKG-VRIRKFLQTFDVGQRVHIDIEPASQKGMPHPRFQGRTGVV 64


>UniRef50_A0BGP7 Cluster: Chromosome undetermined scaffold_106,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_106,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 155

 Score = 34.3 bits (75), Expect = 1.8
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = +2

Query: 350 KENERLLKEAKAAGKTVNLKRQPAPPKAA-HIVSGTEKPVLLAPIP 484
           ++ E ++K AKAA K     ++ APPKA  H+   T+KP    P P
Sbjct: 54  QKQENIIKMAKAATKGNKGAKKTAPPKATKHVKKVTKKPTETTPAP 99


>UniRef50_Q6L228 Cluster: 50S ribosomal protein L21e; n=2;
           Thermoplasmatales|Rep: 50S ribosomal protein L21e -
           Picrophilus torridus
          Length = 97

 Score = 34.3 bits (75), Expect = 1.8
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +3

Query: 81  RTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTG 209
           +  G   ++  MK ++VGD   I  N AV  GMPH  + G TG
Sbjct: 21  KNKGMPKVNEMMKTFEVGDRAAIVINSAVPDGMPHHDFQGITG 63


>UniRef50_A7TAZ0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 131

 Score = 33.9 bits (74), Expect = 2.4
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = +3

Query: 90  GTIPLSTYMKVYKVGDIVDIR 152
           G   LSTY+K YKVGDIVD++
Sbjct: 71  GVEHLSTYLKCYKVGDIVDVK 91


>UniRef50_A0LQP4 Cluster: Putative uncharacterized protein; n=1;
           Syntrophobacter fumaroxidans MPOB|Rep: Putative
           uncharacterized protein - Syntrophobacter fumaroxidans
           (strain DSM 10017 / MPOB)
          Length = 273

 Score = 33.5 bits (73), Expect = 3.1
 Identities = 27/123 (21%), Positives = 51/123 (41%), Gaps = 5/123 (4%)
 Frame = +2

Query: 83  HTWNYSALHVHESVQSWRHCRHQRQWCSSKGYATQSI---PWKDRS--RVQRDCSCSRCD 247
           H W Y  +H      +WR   + R W   + +  ++    P K+R+  R QR    ++  
Sbjct: 119 HPWRYERIHYRHMHDNWRKWHNSRHWRGKRAWNVENYRPRPNKERNHLRNQRRVEYNKRP 178

Query: 248 CQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPP 427
             Q+    I  ++   RV   K  + +Q   ++ +  ++  K+ +A       +RQP   
Sbjct: 179 EVQKHHQLIQEQKKRPRVYKPKGEQQKQPRAQKPRAQQQ--KQPRAQKPRTQQQRQPRAQ 236

Query: 428 KAA 436
           K A
Sbjct: 237 KPA 239


>UniRef50_Q5H358 Cluster: Citrate-dependent iron transporter; n=6;
           Xanthomonas|Rep: Citrate-dependent iron transporter -
           Xanthomonas oryzae pv. oryzae
          Length = 713

 Score = 33.1 bits (72), Expect = 4.1
 Identities = 20/66 (30%), Positives = 31/66 (46%)
 Frame = +3

Query: 15  RLEDDELQGLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVY 194
           R + D++QG     Q + R Q R  G   L   ++      I D  GNGA+ + M   +Y
Sbjct: 59  RSKPDDVQGYAGSRQVIDREQLRNGGNRSLDDALQRVPGIKIFDETGNGALPQLMLRGLY 118

Query: 195 HGKTGR 212
             ++GR
Sbjct: 119 ESRSGR 124


>UniRef50_UPI0000E1FC07 Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 99

 Score = 32.7 bits (71), Expect = 5.4
 Identities = 14/37 (37%), Positives = 23/37 (62%)
 Frame = -1

Query: 197 MVYFVWHTLLNCTIASDVYNVSNFVHFHVRGERNSSM 87
           MV  V H+ LN   + D ++++  +  H RG+RN+SM
Sbjct: 1   MVPLVGHSFLNGAHSLDFHSITFLIDSHTRGQRNNSM 37


>UniRef50_Q6Q883 Cluster: SirP; n=2; Ascomycota|Rep: SirP -
           Leptosphaeria maculans (Blackleg fungus)
          Length = 2176

 Score = 32.7 bits (71), Expect = 5.4
 Identities = 23/81 (28%), Positives = 42/81 (51%)
 Frame = +3

Query: 246 IVNSVFAEGLYRSASISVLSMSSTPSADKTSLRESKRMRGY*RKPRLPARPST*RDSQLP 425
           I  S  A+ +  + S ++LS S +  AD  SLRE+    GY   PR+     T     + 
Sbjct: 593 IFESDTAQRICDTLSATILSTSDSEEADLESLRENVVRAGYPLTPRMEVAYMT----AIQ 648

Query: 426 LKLPTSSVELRNPSYLRLSHT 488
           + +  S++++ + +Y++LS T
Sbjct: 649 VNMIQSTIKMPSMNYIQLSIT 669


>UniRef50_A0RUT3 Cluster: Ribosomal protein L21E; n=2;
           Thermoprotei|Rep: Ribosomal protein L21E - Cenarchaeum
           symbiosum
          Length = 102

 Score = 32.7 bits (71), Expect = 5.4
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +3

Query: 102 LSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRV 215
           +S  ++ Y  GD   I  +    KG+PH+ YHGK G V
Sbjct: 32  VSFLLREYSAGDRALIIIDPRQHKGLPHRRYHGKVGTV 69


>UniRef50_Q03214 Cluster: Protein ECM5; n=2; Saccharomyces
           cerevisiae|Rep: Protein ECM5 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 1411

 Score = 32.7 bits (71), Expect = 5.4
 Identities = 16/60 (26%), Positives = 33/60 (55%)
 Frame = +3

Query: 72  SQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIV 251
           +QF++ G  P +   +  K  D+V++       +G+P +V+H KTG  Y ++ H++   +
Sbjct: 71  TQFKSRGAAPFAP--ETIKSVDLVEL------PEGVPARVFHEKTGLFYQISPHSIPTFI 122


>UniRef50_O48796 Cluster: F24O1.5; n=6; Arabidopsis thaliana|Rep:
           F24O1.5 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 683

 Score = 32.3 bits (70), Expect = 7.2
 Identities = 20/59 (33%), Positives = 28/59 (47%)
 Frame = +3

Query: 174 GMPHKVYHGKTGRVYNVTAHALGVIVNSVFAEGLYRSASISVLSMSSTPSADKTSLRES 350
           G P K Y+G  GR+    AHAL    N +  + L+R      L+    P AD+ S + S
Sbjct: 162 GKPKKTYNGTYGRLLAYAAHALAEGQNKLEPKELWREPKDQALAWK--PCADQRSWKPS 218


>UniRef50_Q8UCM9 Cluster: Iron-chelator utilization protein; n=1;
           Agrobacterium tumefaciens str. C58|Rep: Iron-chelator
           utilization protein - Agrobacterium tumefaciens (strain
           C58 / ATCC 33970)
          Length = 358

 Score = 31.9 bits (69), Expect = 9.5
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = +3

Query: 153 GNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           G+GA Q+ +P+ ++ GK  R YN+T H   ++V+
Sbjct: 97  GHGAEQRELPN-LFRGKVARAYNLTPHMRRLVVS 129


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 524,704,677
Number of Sequences: 1657284
Number of extensions: 10358027
Number of successful extensions: 34902
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 33775
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34877
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 33873797511
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -