SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20058
         (614 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6GLJ2 Cluster: LOC443718 protein; n=4; Tetrapoda|Rep: ...    80   5e-14
UniRef50_UPI00005A2C8E Cluster: PREDICTED: similar to TWIST neig...    75   1e-12
UniRef50_Q3B726 Cluster: DNA-directed RNA polymerase I subunit R...    74   3e-12
UniRef50_Q4RKE7 Cluster: Chromosome 21 SCAF15029, whole genome s...    70   4e-11
UniRef50_Q6PHG8 Cluster: DNA-directed RNA polymerase I subunit R...    69   1e-10
UniRef50_A7RZD8 Cluster: Predicted protein; n=1; Nematostella ve...    63   6e-09
UniRef50_Q7PV20 Cluster: ENSANGP00000016750; n=1; Anopheles gamb...    57   4e-07
UniRef50_Q9VM72 Cluster: CG13773-PA; n=2; Sophophora|Rep: CG1377...    56   5e-07
UniRef50_Q16XZ3 Cluster: Putative uncharacterized protein; n=1; ...    56   7e-07
UniRef50_O43036 Cluster: DNA-directed RNA polymerase I subunit R...    44   0.003
UniRef50_Q55FA4 Cluster: RNA polymerase I subunit; n=1; Dictyost...    42   0.015
UniRef50_Q4PEV0 Cluster: Putative uncharacterized protein; n=1; ...    40   0.036
UniRef50_Q6C2P5 Cluster: Yarrowia lipolytica chromosome F of str...    39   0.082
UniRef50_A6SBP0 Cluster: Putative uncharacterized protein; n=2; ...    38   0.14 
UniRef50_Q6BX66 Cluster: Similar to CA2272|CaRPA43 Candida albic...    36   0.58 
UniRef50_A3LV72 Cluster: DNA-dependent RNA polymerase I subunit ...    36   1.0  
UniRef50_Q00W27 Cluster: DNA polymerase epsilon, subunit C; n=3;...    34   2.3  
UniRef50_Q5K9N5 Cluster: Putative uncharacterized protein; n=1; ...    34   2.3  
UniRef50_Q5CSR5 Cluster: RPB7 like OB fold RNA polymerase subuni...    33   5.4  
UniRef50_A4QXX6 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  

>UniRef50_Q6GLJ2 Cluster: LOC443718 protein; n=4; Tetrapoda|Rep:
           LOC443718 protein - Xenopus laevis (African clawed frog)
          Length = 477

 Score = 79.8 bits (188), Expect = 5e-14
 Identities = 37/89 (41%), Positives = 54/89 (60%)
 Frame = +3

Query: 255 KELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHL 434
           + LNGV V+Y N  ++  +G I +D   IH  V+AD+ IF+P  G  L G+VNK   TH+
Sbjct: 85  ERLNGVPVAYDNIKLVGELGDIYDDLGHIHINVEADFVIFKPDCGQTLVGIVNKVAPTHI 144

Query: 435 SVLVHRVFNVVIPQPTEEPGDKWIGLVLK 521
             LVH  FN  IP+P + P + W+ + +K
Sbjct: 145 GCLVHGCFNASIPKPPKMPIENWLRIGVK 173


>UniRef50_UPI00005A2C8E Cluster: PREDICTED: similar to TWIST
           neighbor; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to TWIST neighbor - Canis familiaris
          Length = 423

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 33/83 (39%), Positives = 51/83 (61%)
 Frame = +3

Query: 255 KELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHL 434
           + L+GV ++Y N  ++  +G I +D   IH  ++AD+ IF P  G KL G+VNK  S+H+
Sbjct: 162 ESLSGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGKKLMGIVNKVSSSHI 221

Query: 435 SVLVHRVFNVVIPQPTEEPGDKW 503
             LVH  FN  IP+P +   ++W
Sbjct: 222 GCLVHGCFNASIPKPEQMSTEQW 244


>UniRef50_Q3B726 Cluster: DNA-directed RNA polymerase I subunit
           RPA43; n=16; Amniota|Rep: DNA-directed RNA polymerase I
           subunit RPA43 - Homo sapiens (Human)
          Length = 338

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 33/83 (39%), Positives = 50/83 (60%)
 Frame = +3

Query: 255 KELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHL 434
           + L GV ++Y N  ++  +G I +D   IH  ++AD+ IF P  G KL G+VNK  S+H+
Sbjct: 84  ESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSSSHI 143

Query: 435 SVLVHRVFNVVIPQPTEEPGDKW 503
             LVH  FN  IP+P +   ++W
Sbjct: 144 GCLVHGCFNASIPKPEQLSAEQW 166


>UniRef50_Q4RKE7 Cluster: Chromosome 21 SCAF15029, whole genome
           shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 21
           SCAF15029, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 352

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 35/83 (42%), Positives = 46/83 (55%)
 Frame = +3

Query: 255 KELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHL 434
           + L GV ++Y N  IL   G I +D   +H  V AD+ +FQP  G KL G VNK   +H+
Sbjct: 100 QSLKGVPLAYDNIRILGQYGDIVDDGGYVHMDVIADFIVFQPQKGQKLLGKVNKLGVSHV 159

Query: 435 SVLVHRVFNVVIPQPTEEPGDKW 503
             LVH  FN  IP+P   P + W
Sbjct: 160 GCLVHGCFNASIPKPNLVPMETW 182


>UniRef50_Q6PHG8 Cluster: DNA-directed RNA polymerase I subunit
           RPA43; n=3; Danio rerio|Rep: DNA-directed RNA polymerase
           I subunit RPA43 - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 391

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 30/81 (37%), Positives = 49/81 (60%)
 Frame = +3

Query: 261 LNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSV 440
           L+GV V+Y N  ++   G I +D   IHF ++A + IF+P  G++L G++NK  ++H+  
Sbjct: 94  LDGVPVAYDNIKVVGQHGNIYDDQGFIHFNIEASFVIFRPKNGSRLMGVINKMGASHVGC 153

Query: 441 LVHRVFNVVIPQPTEEPGDKW 503
           LVH  FN  + +P     D+W
Sbjct: 154 LVHGCFNASVMKPNALTSDQW 174


>UniRef50_A7RZD8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 159

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 31/80 (38%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 KELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHL 434
           ++L  V+V+Y    +LQ  G I +++  +HF  Q DY  F+P IG KL G+VNK    H+
Sbjct: 43  EKLRAVIVAYDKVTLLQRRGNIIDESPFLHFDAQVDYITFKPEIGNKLIGVVNKFGYDHI 102

Query: 435 SVLVHRVFNVVIPQPTEEPG 494
             LVH  FN  I +     G
Sbjct: 103 GCLVHGCFNASIAKSRTSNG 122


>UniRef50_Q7PV20 Cluster: ENSANGP00000016750; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000016750 - Anopheles gambiae
           str. PEST
          Length = 246

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 24/71 (33%), Positives = 42/71 (59%)
 Frame = +3

Query: 258 ELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLS 437
           +LNG+++ Y    +   +  +R D+  +H +   DY++FQP IG+ L G VN      +S
Sbjct: 65  KLNGIVLGYAKIRVDNALSALRLDSPYLHVRTTIDYYVFQPRIGSTLRGTVNYVSKNFVS 124

Query: 438 VLVHRVFNVVI 470
            +++RVFNV +
Sbjct: 125 AVIYRVFNVTV 135


>UniRef50_Q9VM72 Cluster: CG13773-PA; n=2; Sophophora|Rep:
           CG13773-PA - Drosophila melanogaster (Fruit fly)
          Length = 253

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 24/70 (34%), Positives = 43/70 (61%)
 Frame = +3

Query: 261 LNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSV 440
           L+G+++  KN  +L     +R D+  +H  + AD+++F+P  GA L+G+V      H+S 
Sbjct: 66  LDGIVLGIKNIKVLGQTAGLRADDPTMHLVINADFYVFRPKAGAILSGVVRHISRHHVSA 125

Query: 441 LVHRVFNVVI 470
           +++RVFN  I
Sbjct: 126 VIYRVFNTSI 135



 Score = 37.9 bits (84), Expect = 0.19
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = +1

Query: 79  IMSKIIKFDLRELKQLANDKNSCLVVKKITQNLALQPWCLGNIKESITNLL-DYKVGKFE 255
           I+ K IKF ++EL+  A+   SC+       +LA+ P+ + N K ++  LL   KVG ++
Sbjct: 4   ILQKYIKFSVKELENYASSPESCVRCITTDMHLAMGPYGMANFKHALHELLIRTKVGFYD 63


>UniRef50_Q16XZ3 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 571

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 22/72 (30%), Positives = 46/72 (63%)
 Frame = +3

Query: 255 KELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHL 434
           + ++G+++++KN  IL  +  IR ++  IH +V +++++F+P  GA + G +      +L
Sbjct: 64  RTVDGIILAFKNTKILSPLSAIRPNSVRIHVKVSSNFYVFRPISGATIEGTIKYVSKNYL 123

Query: 435 SVLVHRVFNVVI 470
           S +++ VFNV I
Sbjct: 124 SAVIYGVFNVTI 135



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = +1

Query: 85  SKIIKFDLRELKQLANDKNSCLVVKKITQNLALQPWCLGNIKESITNLLDYKVGKFEKS 261
           +K  K+ + EL+    D NSC+   + T  +++ P  LG+I E +   L  K+GK++++
Sbjct: 7   TKYAKYTVEELESYVADPNSCVQKLEWTNLVSVLPKYLGDICEGVKACLTQKIGKYDRT 65


>UniRef50_O43036 Cluster: DNA-directed RNA polymerase I subunit
           RPA43; n=1; Schizosaccharomyces pombe|Rep: DNA-directed
           RNA polymerase I subunit RPA43 - Schizosaccharomyces
           pombe (Fission yeast)
          Length = 173

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +3

Query: 261 LNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSV 440
           +NG++++Y N   L+    +  D+      V+ D  +F P  G  L G +N    +H+ +
Sbjct: 44  INGIVLAYDNIRFLEKSAKVMYDSPFSFIWVRVDVLVFSPKKGDCLEGKINLVSPSHIGL 103

Query: 441 LVHRVFNVVIPQPTEEPGDKWI 506
           L+  +FN  IP+ +  P D WI
Sbjct: 104 LILGIFNASIPRKS-IPKD-WI 123


>UniRef50_Q55FA4 Cluster: RNA polymerase I subunit; n=1;
           Dictyostelium discoideum AX4|Rep: RNA polymerase I
           subunit - Dictyostelium discoideum AX4
          Length = 356

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 19/73 (26%), Positives = 37/73 (50%)
 Frame = +3

Query: 258 ELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLS 437
           EL G+++SY +         I  D+  +   +   + +F+P+    L G+V +  +TH+S
Sbjct: 56  ELGGIIISYYDVIHTDKEAKIFYDSPYLGMNIHVKFLVFKPFKDQILNGVVKRVSTTHIS 115

Query: 438 VLVHRVFNVVIPQ 476
           +LV    +  IP+
Sbjct: 116 LLVFGTISASIPK 128


>UniRef50_Q4PEV0 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 364

 Score = 40.3 bits (90), Expect = 0.036
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = +3

Query: 258 ELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLS 437
           +L+GVL+++     LQ+      D+A     V  +  ++ P IG  L G +     +H+S
Sbjct: 112 QLSGVLITHSPTRFLQDTAVFSADSAFATASVGFECVVWTPRIGQMLEGNICLSSPSHVS 171

Query: 438 VLVHRVFNVVIP 473
           +L++ +FN  IP
Sbjct: 172 LLLYGLFNASIP 183


>UniRef50_Q6C2P5 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 288

 Score = 39.1 bits (87), Expect = 0.082
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 309 VGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSVLVHRVFNVVI 470
           +G   N++      +  D  +++P +G +L G VN +  +H+ +LVH  FN  I
Sbjct: 98  MGKFVNESPFTFMWISTDLLVWKPQVGDRLEGYVNMQTPSHIGLLVHDTFNCSI 151


>UniRef50_A6SBP0 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 323

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 9/92 (9%)
 Frame = +3

Query: 264 NGVLVSYKNPCILQ----NVGT---IRN-DNADIHFQ-VQADYFIFQPYIGAKLTGLVNK 416
           NGV++SY NP   +    N G    ++N D   + +  V A++ +F+P  GA L G +N 
Sbjct: 112 NGVILSYSNPRFAEKAFGNDGDSTLLQNLDEYAVSWAWVTAEFLLFKPEKGAWLEGYINL 171

Query: 417 KCSTHLSVLVHRVFNVVIPQPTEEPGDKWIGL 512
           +   HL ++   +FN  I +       +W+G+
Sbjct: 172 QNEGHLGLVCWNLFNASIERARLPKEWRWVGV 203


>UniRef50_Q6BX66 Cluster: Similar to CA2272|CaRPA43 Candida albicans
           CaRPA43 DNA-directed RNA polymerase I; n=3;
           Saccharomycetales|Rep: Similar to CA2272|CaRPA43 Candida
           albicans CaRPA43 DNA-directed RNA polymerase I -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 311

 Score = 36.3 bits (80), Expect = 0.58
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +3

Query: 351 VQADYFIFQPYIGAKLTGLVNKKCSTHLSVLVHRVFNVVI 470
           V  D+ I++P +G  L G +  + ++H+ +LVH  FN  I
Sbjct: 122 VSVDFLIWRPQVGDTLEGYIYMQTASHIGLLVHDTFNASI 161


>UniRef50_A3LV72 Cluster: DNA-dependent RNA polymerase I subunit
           A43; n=2; Pichia|Rep: DNA-dependent RNA polymerase I
           subunit A43 - Pichia stipitis (Yeast)
          Length = 307

 Score = 35.5 bits (78), Expect = 1.0
 Identities = 13/40 (32%), Positives = 24/40 (60%)
 Frame = +3

Query: 351 VQADYFIFQPYIGAKLTGLVNKKCSTHLSVLVHRVFNVVI 470
           +  D+ I++P +G  L G +  + ++HL +L+H  FN  I
Sbjct: 122 ITVDFLIWRPQVGDVLEGYIYMQTASHLGLLIHDTFNASI 161


>UniRef50_Q00W27 Cluster: DNA polymerase epsilon, subunit C; n=3;
           Ostreococcus|Rep: DNA polymerase epsilon, subunit C -
           Ostreococcus tauri
          Length = 569

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = +3

Query: 312 GTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLSVLVHRVFNVVI 470
           G + + +  +   V+AD  +F P  G++L G VNK     +  LV   FNV I
Sbjct: 101 GRVLHASGHVDVCVEADCDVFTPVRGSRLVGTVNKIAHDFIGALVLDKFNVAI 153


>UniRef50_Q5K9N5 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 360

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 21/72 (29%), Positives = 35/72 (48%)
 Frame = +3

Query: 258 ELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHLS 437
           E+ GVL+++ +     +   I N+       V+     + P IG KL G+ +    +HLS
Sbjct: 90  EVKGVLIAHWDHSFDDDTAKIINECPFEVVNVEFHAIYWAPKIGQKLRGIHSISSPSHLS 149

Query: 438 VLVHRVFNVVIP 473
           ++    FNV IP
Sbjct: 150 LIFAGAFNVSIP 161


>UniRef50_Q5CSR5 Cluster: RPB7 like OB fold RNA polymerase subunit;
           n=2; Cryptosporidium|Rep: RPB7 like OB fold RNA
           polymerase subunit - Cryptosporidium parvum Iowa II
          Length = 256

 Score = 33.1 bits (72), Expect = 5.4
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 2/84 (2%)
 Frame = +3

Query: 258 ELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADY--FIFQPYIGAKLTGLVNKKCSTH 431
           E  GV + +     +   G + +   +  F V  ++   +F+P IG  L   ++    +H
Sbjct: 115 EFQGVWICFHKISTVNTYGYVPDCEPNGSFLVNVEFKALVFKPKIGELLICRISHVSPSH 174

Query: 432 LSVLVHRVFNVVIPQPTEEPGDKW 503
           +S + + + NVVIP  + + GD++
Sbjct: 175 VSGITYGILNVVIPMKSFK-GDEY 197


>UniRef50_A4QXX6 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 404

 Score = 33.1 bits (72), Expect = 5.4
 Identities = 19/55 (34%), Positives = 28/55 (50%)
 Frame = +3

Query: 357 ADYFIFQPYIGAKLTGLVNKKCSTHLSVLVHRVFNVVIPQPTEEPGDKWIGLVLK 521
           A+ ++F P  GA + G+VN +   HL V+    FN  I       G K+I +V K
Sbjct: 320 AEVYLFVPRRGAWMEGVVNLQSEGHLGVVCWNRFNASIEANRVPEGWKFIDVVQK 374


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 554,703,843
Number of Sequences: 1657284
Number of extensions: 10282516
Number of successful extensions: 20194
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 19715
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20189
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44392209541
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -