SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q17249 Cluster: Urbain; n=1; Bombyx mori|Rep: Urbain - ...   183   2e-45
UniRef50_UPI0000E47620 Cluster: PREDICTED: hypothetical protein,...    38   0.17 
UniRef50_Q6R1M2 Cluster: Merozoite surface protein 6; n=9; Plasm...    38   0.22 
UniRef50_A0K0P1 Cluster: Putative uncharacterized protein; n=1; ...    36   0.68 
UniRef50_Q70C92 Cluster: Cytosine-specific methyltransferase; n=...    35   1.6  
UniRef50_A2DP29 Cluster: Putative uncharacterized protein; n=1; ...    35   1.6  
UniRef50_Q60P21 Cluster: Putative uncharacterized protein CBG224...    34   2.1  
UniRef50_Q870N7 Cluster: Putative uncharacterized protein 49D12....    34   2.1  
UniRef50_Q1RJ13 Cluster: Putative uncharacterized protein; n=2; ...    34   2.7  
UniRef50_A5I1U0 Cluster: Cell division protein precursor; n=4; C...    34   2.7  
UniRef50_A5KA27 Cluster: Putative uncharacterized protein; n=1; ...    34   2.7  
UniRef50_UPI00005885A6 Cluster: PREDICTED: similar to Caltractin...    33   3.6  
UniRef50_Q6BG00 Cluster: Putative uncharacterized protein; n=1; ...    33   3.6  
UniRef50_Q60YQ6 Cluster: Putative uncharacterized protein CBG181...    33   3.6  
UniRef50_A2EXE4 Cluster: Putative uncharacterized protein; n=1; ...    33   3.6  
UniRef50_A2D9V9 Cluster: Putative uncharacterized protein; n=1; ...    33   3.6  
UniRef50_Q5BH67 Cluster: Putative uncharacterized protein; n=1; ...    33   3.6  
UniRef50_Q4SMT2 Cluster: Chromosome 8 SCAF14545, whole genome sh...    33   4.8  
UniRef50_Q8EX41 Cluster: Putative uncharacterized protein MYPE90...    33   4.8  
UniRef50_Q7NTZ1 Cluster: Putative uncharacterized protein; n=1; ...    33   4.8  
UniRef50_Q6AQW9 Cluster: Related to ATP-dependent dsDNA exonucle...    33   4.8  
UniRef50_Q476C1 Cluster: Helix-turn-helix, AraC type; n=1; Ralst...    33   4.8  
UniRef50_Q2SE75 Cluster: Putative uncharacterized protein; n=1; ...    33   4.8  
UniRef50_A3DBI7 Cluster: Putative uncharacterized protein precur...    33   4.8  
UniRef50_Q23AB9 Cluster: Putative uncharacterized protein; n=1; ...    33   4.8  
UniRef50_Q17B99 Cluster: Putative uncharacterized protein; n=1; ...    33   4.8  
UniRef50_Q6ZVI3 Cluster: CDNA FLJ42547 fis, clone BRACE3004880; ...    33   4.8  
UniRef50_UPI0000E463CE Cluster: PREDICTED: hypothetical protein;...    33   6.3  
UniRef50_Q857J1 Cluster: Gp31; n=1; Mycobacterium phage Bxz2|Rep...    33   6.3  
UniRef50_Q45KY9 Cluster: Structural maintenance of chromosome 4;...    33   6.3  
UniRef50_Q16RE0 Cluster: Putative uncharacterized protein; n=1; ...    33   6.3  
UniRef50_A2DF93 Cluster: Putative uncharacterized protein; n=1; ...    33   6.3  
UniRef50_Q58089 Cluster: Putative hydrogenase expression/formati...    33   6.3  
UniRef50_Q2SJH0 Cluster: Putative uncharacterized protein; n=1; ...    32   8.3  
UniRef50_Q0F3L7 Cluster: Ubiquinol-cytochrome c reductase, iron-...    32   8.3  
UniRef50_A0ZFU9 Cluster: S-layer region-like protein; n=2; Nosto...    32   8.3  
UniRef50_Q55DZ3 Cluster: Putative uncharacterized protein; n=12;...    32   8.3  
UniRef50_A0CQY0 Cluster: Chromosome undetermined scaffold_241, w...    32   8.3  
UniRef50_P32608 Cluster: Retrograde regulation protein 2; n=6; S...    32   8.3  
UniRef50_Q51487 Cluster: Outer membrane protein oprM precursor; ...    32   8.3  
UniRef50_Q8T0S6 Cluster: Serine/threonine-protein kinase hippo; ...    32   8.3  

>UniRef50_Q17249 Cluster: Urbain; n=1; Bombyx mori|Rep: Urbain -
           Bombyx mori (Silk moth)
          Length = 551

 Score =  183 bits (446), Expect = 2e-45
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 252 VKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTA 431
           +KSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTA
Sbjct: 88  LKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTA 147

Query: 432 EIALRQGFQEVSDGIGKWYARTEQI 506
           EIALRQGFQEVSDGIGKWYARTEQI
Sbjct: 148 EIALRQGFQEVSDGIGKWYARTEQI 172



 Score =  128 bits (308), Expect = 1e-28
 Identities = 62/64 (96%), Positives = 64/64 (100%)
 Frame = +1

Query: 67  AIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIK 246
           +IPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIK
Sbjct: 26  SIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIK 85

Query: 247 PSLR 258
           PSL+
Sbjct: 86  PSLK 89



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 21/21 (100%), Positives = 21/21 (100%)
 Frame = +2

Query: 509 ELQASLQHFQENFGAQIQKLN 571
           ELQASLQHFQENFGAQIQKLN
Sbjct: 174 ELQASLQHFQENFGAQIQKLN 194



 Score = 39.9 bits (89), Expect = 0.041
 Identities = 20/26 (76%), Positives = 22/26 (84%)
 Frame = +3

Query: 9  VKLHAALLLTIFVLAARAACHPGQGP 86
          +KLHAALLLTIFVLAARAA  P + P
Sbjct: 7  MKLHAALLLTIFVLAARAASIPDKVP 32


>UniRef50_UPI0000E47620 Cluster: PREDICTED: hypothetical protein,
            partial; n=2; Strongylocentrotus purpuratus|Rep:
            PREDICTED: hypothetical protein, partial -
            Strongylocentrotus purpuratus
          Length = 2162

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +3

Query: 252  VKSDLENVEVPDENEEIKRPLVDLRNPGPPQ-HQEHETQNPEHHEDAEKIVSSVKNDINT 428
            +K   E  + P +N ++     D+R  GPP+   E  T+ P   +D EK  +  + +  T
Sbjct: 1156 LKLSQELFKEPGKNGDLGVTQFDIRGTGPPKVESELGTKGPGEEDDTEKTENVQEEEPPT 1215

Query: 429  AEIALRQGFQEVSDG 473
             ++ ++Q  +EVS G
Sbjct: 1216 RKVEMKQTAEEVSSG 1230


>UniRef50_Q6R1M2 Cluster: Merozoite surface protein 6; n=9;
           Plasmodium falciparum|Rep: Merozoite surface protein 6 -
           Plasmodium falciparum
          Length = 429

 Score = 37.5 bits (83), Expect = 0.22
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 2/90 (2%)
 Frame = +3

Query: 279 VPDENEEIKR-PLVDLRNPGPPQHQEHETQNPEHHED-AEKIVSSVKNDINTAEIALRQG 452
           +PDENE++K  P  D ++    + +E ET+N E  +D  E+I  + ++DI+   +  ++ 
Sbjct: 275 IPDENEQVKEDPQEDNKDEDEDEDEETETENLETEDDNNEEIEENEEDDIDEESVEEKEE 334

Query: 453 FQEVSDGIGKWYARTEQIKSSRPACNISKK 542
            +E  +   K   + E+ K      N  K+
Sbjct: 335 EEEKKEEEEKKEEKKEEKKPDNEITNEVKE 364


>UniRef50_A0K0P1 Cluster: Putative uncharacterized protein; n=1;
           Arthrobacter sp. FB24|Rep: Putative uncharacterized
           protein - Arthrobacter sp. (strain FB24)
          Length = 121

 Score = 35.9 bits (79), Expect = 0.68
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 6/53 (11%)
 Frame = +3

Query: 336 PPQHQEHETQNPEHHED--AEKIV---SSVKNDINTA-EIALRQGFQEVSDGI 476
           PP+H+E E    +HH D   E I    ++++ND+N+A +IALR   QE   G+
Sbjct: 36  PPRHREREHPMIKHHSDILLEIIAHDPATIENDLNSAVDIALRHAMQERRHGV 88


>UniRef50_Q70C92 Cluster: Cytosine-specific methyltransferase; n=2;
           Streptococcus|Rep: Cytosine-specific methyltransferase -
           Streptococcus thermophilus
          Length = 365

 Score = 34.7 bits (76), Expect = 1.6
 Identities = 14/34 (41%), Positives = 25/34 (73%)
 Frame = +1

Query: 109 NVVDNLSSEQELIDQANTIKDIDNSLRANKKEVI 210
           N+ D+++ + +L D+ + IKDI+N+L  NK +VI
Sbjct: 44  NLKDSVALKADLFDEESAIKDIENNLNGNKIDVI 77


>UniRef50_A2DP29 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 567

 Score = 34.7 bits (76), Expect = 1.6
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 KSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDA-EKIVSSVKNDINTA 431
           K + EN E P++ E  K       +   P H  +++ N  ++ED+ EK +    N+ N +
Sbjct: 80  KPENENQESPNKTESSKSNSEKSSSSSSPSHSSNQSDNENNNEDSKEKDLPKNDNENNES 139

Query: 432 EIALRQGFQEVSDG 473
            +AL    ++  DG
Sbjct: 140 GLALSNVIKDKLDG 153


>UniRef50_Q60P21 Cluster: Putative uncharacterized protein CBG22448;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG22448 - Caenorhabditis
           briggsae
          Length = 344

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +3

Query: 267 ENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKI 398
           +NV +  ++EEI   +V  RN GP +   H  ++P  H + E++
Sbjct: 245 DNVYMTRKSEEISTNVVFARNDGPIRKHHHHNKSPVRHRELERL 288


>UniRef50_Q870N7 Cluster: Putative uncharacterized protein
           49D12.160; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein 49D12.160 - Neurospora crassa
          Length = 651

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = +3

Query: 330 PGPPQHQEHETQNPEHHE-DAEKIVSSVKNDINTAEIALRQ 449
           P PP H     Q P HH+ D  +++   ++    AE+ALR+
Sbjct: 185 PPPPPHTSSSGQQPLHHQPDPRQLIQDAQDTARAAELALRE 225


>UniRef50_Q1RJ13 Cluster: Putative uncharacterized protein; n=2;
           Rickettsia bellii|Rep: Putative uncharacterized protein
           - Rickettsia bellii (strain RML369-C)
          Length = 675

 Score = 33.9 bits (74), Expect = 2.7
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 1/87 (1%)
 Frame = +3

Query: 246 TVVKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHH-EDAEKIVSSVKNDI 422
           TV+K  L +++ PD  E +  PL++       +    E +N E   + A K VS +  D 
Sbjct: 3   TVIKDTLPSIQNPDVKEILDIPLIEYLAEKQSKEYNQEKENFEKRGKVAPKAVSDLIRDR 62

Query: 423 NTAEIALRQGFQEVSDGIGKWYARTEQ 503
             A +   +   + S+G+   Y   EQ
Sbjct: 63  RVANVQEFKKEADKSEGVSGGYIADEQ 89


>UniRef50_A5I1U0 Cluster: Cell division protein precursor; n=4;
           Clostridium botulinum|Rep: Cell division protein
           precursor - Clostridium botulinum A str. ATCC 3502
          Length = 256

 Score = 33.9 bits (74), Expect = 2.7
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVID-IPVKVIVEEIK 246
           K+P    + + +  N++  +E+I  ++TIK  +N    NKK+ I+ I +   +EE+K
Sbjct: 41  KIPYFNIESIEIKGNVNIPKEVIKDSSTIKTGNNIFYTNKKDAIENISLNPYIEEVK 97


>UniRef50_A5KA27 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium vivax|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 495

 Score = 33.9 bits (74), Expect = 2.7
 Identities = 18/68 (26%), Positives = 38/68 (55%)
 Frame = +1

Query: 61  QPAIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEE 240
           Q  +  K+ E   K LN ++ L  + ++   A+TIKD+ + ++    ++    +K I +E
Sbjct: 244 QKEVKPKIDELTQKYLNELE-LEMKPKVDQLASTIKDLQSEIKPQFDDIKQKLLKDIQDE 302

Query: 241 IKPSLRVI 264
           +KP ++V+
Sbjct: 303 VKPKVQVL 310


>UniRef50_UPI00005885A6 Cluster: PREDICTED: similar to Caltractin
           (Centrin), partial; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to Caltractin
           (Centrin), partial - Strongylocentrotus purpuratus
          Length = 166

 Score = 33.5 bits (73), Expect = 3.6
 Identities = 20/61 (32%), Positives = 27/61 (44%)
 Frame = +3

Query: 252 VKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTA 431
           VK      + P   EE  RP  D   P PPQ    E   P H E  +K+++  + D+ T 
Sbjct: 5   VKKKRAKSKSPGSAEEKNRPRPD---PIPPQDFGPEEPKPSHRESLQKVLTGDRVDLQTK 61

Query: 432 E 434
           E
Sbjct: 62  E 62


>UniRef50_Q6BG00 Cluster: Putative uncharacterized protein; n=1;
            Paramecium tetraurelia|Rep: Putative uncharacterized
            protein - Paramecium tetraurelia
          Length = 2301

 Score = 33.5 bits (73), Expect = 3.6
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = +3

Query: 264  LENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAE 392
            +EN++V D+N + +    D  +    Q+Q+HE Q+ +H E  E
Sbjct: 1415 VENIDVQDQNHKEQVQQQDESHQEQDQYQDHEEQDEDHQEQIE 1457


>UniRef50_Q60YQ6 Cluster: Putative uncharacterized protein CBG18138;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG18138 - Caenorhabditis
           briggsae
          Length = 318

 Score = 33.5 bits (73), Expect = 3.6
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 4/61 (6%)
 Frame = +3

Query: 267 ENVEVPDENEEIKRPLVDLR----NPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
           E  E  D+ EE++ P V+ +     P P  H+E E ++ E  ED +      K  + T+ 
Sbjct: 169 EEEEEQDQEEEVQLPAVEAQAPEARPEPEHHEEKEEEDEEEEEDLKMNGEEKKEPVTTST 228

Query: 435 I 437
           +
Sbjct: 229 V 229


>UniRef50_A2EXE4 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 956

 Score = 33.5 bits (73), Expect = 3.6
 Identities = 15/54 (27%), Positives = 29/54 (53%)
 Frame = +3

Query: 381 EDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYARTEQIKSSRPACNISKK 542
           +D EK ++ +K +INT    + Q   ++S    K+Y   ++IK  +P   I ++
Sbjct: 149 QDVEKEINEIKTEINTNRDLISQITDDISTSRTKFYEIKDEIKKIKPQIEIDEQ 202


>UniRef50_A2D9V9 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 715

 Score = 33.5 bits (73), Expect = 3.6
 Identities = 18/63 (28%), Positives = 34/63 (53%)
 Frame = +3

Query: 240 NQTVVKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKND 419
           N+     D+EN+E   E E I     ++ N    + +E+E +NPE  E+ E+++   +++
Sbjct: 284 NENYENEDIENLEEEAEGENINENEEEMAN--DEELRENENENPEEQEN-EQVIDITEDN 340

Query: 420 INT 428
            NT
Sbjct: 341 QNT 343


>UniRef50_Q5BH67 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 1511

 Score = 33.5 bits (73), Expect = 3.6
 Identities = 15/52 (28%), Positives = 30/52 (57%)
 Frame = +3

Query: 252 VKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSS 407
           ++   +  +VP  + ++  P   ++ P PP   +H+TQ+P+ H DAE+ V +
Sbjct: 153 IRGAFQERKVPWVDVDVVLPAGTIQPPEPP---DHDTQDPDEHADAEESVDA 201


>UniRef50_Q4SMT2 Cluster: Chromosome 8 SCAF14545, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 8 SCAF14545, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 441

 Score = 33.1 bits (72), Expect = 4.8
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = +3

Query: 384 DAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYARTEQIKSSRPACNISKKISALRYK 563
           D +K++ SVK +I   ++ L Q FQ++     +W  R ++  S     N+ K +  L +K
Sbjct: 195 DLKKLIVSVKKEIGNEDLRLLQNFQDLKRK-AQW-TRDDRCLSEDSLLNVGKHVGGLSFK 252


>UniRef50_Q8EX41 Cluster: Putative uncharacterized protein MYPE90;
           n=1; Mycoplasma penetrans|Rep: Putative uncharacterized
           protein MYPE90 - Mycoplasma penetrans
          Length = 275

 Score = 33.1 bits (72), Expect = 4.8
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +3

Query: 261 DLENVEVPDENEEIKRPLVDLRNPGPPQ-HQEHETQNPEHHEDAEKIVSSVKN 416
           D+ N  VP +N+E+   L++ ++P     + + E +NP++ ED+E+     KN
Sbjct: 138 DILNDSVPQKNKEVIDSLIEKKDPIKELFNTKEEKENPQNSEDSEQETKVYKN 190


>UniRef50_Q7NTZ1 Cluster: Putative uncharacterized protein; n=1;
           Chromobacterium violaceum|Rep: Putative uncharacterized
           protein - Chromobacterium violaceum
          Length = 900

 Score = 33.1 bits (72), Expect = 4.8
 Identities = 17/42 (40%), Positives = 24/42 (57%)
 Frame = +1

Query: 52  PHAQPAIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDID 177
           P A+ A+PD  PE E KPL   D +S+  E + Q   ++D D
Sbjct: 720 PVAEAAVPDIQPEPEAKPLVEEDAVSTLYEAVPQPAPLEDED 761


>UniRef50_Q6AQW9 Cluster: Related to ATP-dependent dsDNA
           exonuclease; n=7; Bacteria|Rep: Related to ATP-dependent
           dsDNA exonuclease - Desulfotalea psychrophila
          Length = 1081

 Score = 33.1 bits (72), Expect = 4.8
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 6/86 (6%)
 Frame = +3

Query: 270 NVEVPDENEEIKRPLVDLRNPGPPQH------QEHETQNPEHHEDAEKIVSSVKNDINTA 431
           NV VPDENE+    L  L +    Q       +E +T      E++EK+ S+V ND    
Sbjct: 552 NVPVPDENEQKIELLTRLISRAEDQEAIVKKLEEAQTTARRDLENSEKLESNVAND---- 607

Query: 432 EIALRQGFQEVSDGIGKWYARTEQIK 509
           + A+ + F E+  G+ K+ +  +++K
Sbjct: 608 KRAVEKDFTELQGGLEKFRSGFKELK 633


>UniRef50_Q476C1 Cluster: Helix-turn-helix, AraC type; n=1;
           Ralstonia eutropha JMP134|Rep: Helix-turn-helix, AraC
           type - Ralstonia eutropha (strain JMP134) (Alcaligenes
           eutrophus)
          Length = 344

 Score = 33.1 bits (72), Expect = 4.8
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = -2

Query: 251 DGLISSTITLTGMSMTSFLFARRLLSMSLMVLAWSMSSC-SLDKL 120
           DGL++  + LTG +   F + RRL   S  +L ++M SC +LD+L
Sbjct: 55  DGLLAEALRLTGRTDIGFEWGRRLKLNSHDILGYAMLSCPTLDQL 99


>UniRef50_Q2SE75 Cluster: Putative uncharacterized protein; n=1;
           Hahella chejuensis KCTC 2396|Rep: Putative
           uncharacterized protein - Hahella chejuensis (strain
           KCTC 2396)
          Length = 570

 Score = 33.1 bits (72), Expect = 4.8
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%)
 Frame = +1

Query: 196 KKEVIDIPVKVIVEEIKPSLRVI*KTLKCRMKMRKSRGL*SI*EIPGPRSIKSTKHRILN 375
           + EVI   VK++ E+   ++R   +TL+ + K+   +   SI  +PG R+  + KH   N
Sbjct: 275 QSEVITYRVKLLKEDGSEAVRKKLRTLQQKRKLLPFKAYTSIPHLPGSRTGLADKHIDAN 334

Query: 376 TTKML-KKSFLPSKMTLTQRK 435
             +ML  +   P  + + Q K
Sbjct: 335 KAEMLTSRQRHPDDVVIVQEK 355


>UniRef50_A3DBI7 Cluster: Putative uncharacterized protein
           precursor; n=1; Clostridium thermocellum ATCC 27405|Rep:
           Putative uncharacterized protein precursor - Clostridium
           thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 247

 Score = 33.1 bits (72), Expect = 4.8
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 5/70 (7%)
 Frame = +3

Query: 267 ENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIV-----SSVKNDINTA 431
           EN E+  ENEE+K  + ++     P+++  E  N E+++  ++IV     +  + DI TA
Sbjct: 107 ENEEIKKENEELKIRIKEIGGVSIPEYRTSEGINDEYNQKIQEIVIKFIRAMYRGDIETA 166

Query: 432 EIALRQGFQE 461
                + F++
Sbjct: 167 RKISTEEFKQ 176


>UniRef50_Q23AB9 Cluster: Putative uncharacterized protein; n=1;
            Tetrahymena thermophila SB210|Rep: Putative
            uncharacterized protein - Tetrahymena thermophila SB210
          Length = 2177

 Score = 33.1 bits (72), Expect = 4.8
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +3

Query: 282  PDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQE 461
            P  N++ + P V  +NP PP   + +T  P  H     + SS KND + A+  L +G   
Sbjct: 1800 PLMNKKPQAPAVQKQNPLPPLPAD-DTIKPIQHNPPATLTSSQKNDDSAAQNKLLKGLPN 1858

Query: 462  V 464
            +
Sbjct: 1859 I 1859


>UniRef50_Q17B99 Cluster: Putative uncharacterized protein; n=1; Aedes
            aegypti|Rep: Putative uncharacterized protein - Aedes
            aegypti (Yellowfever mosquito)
          Length = 2250

 Score = 33.1 bits (72), Expect = 4.8
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = +3

Query: 252  VKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHET-QNPEHHEDAEKIVSSVKNDINT 428
            V+SD+  VE  +EN   +     L    P +H  HE+  N E H + +K   SV++DI  
Sbjct: 1140 VQSDIPIVETSNENNIAEAQGEGLAGESPMEHDTHESADNHEKHHEKDK---SVQSDIPI 1196

Query: 429  AEIALRQGFQE 461
             E +     +E
Sbjct: 1197 DETSDENNIEE 1207



 Score = 32.3 bits (70), Expect = 8.3
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +3

Query: 252  VKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQN--PEHHEDAEKIVSSVKNDIN 425
            V+SD+   E  DEN   ++   DL    P +H  HE+ N   +HH    +  SS KN I 
Sbjct: 1190 VQSDIPIDETSDENNIEEKQGEDLAEESPMEHDLHESTNNCEKHHASVHE--SSNKNTIA 1247

Query: 426  TAEI 437
              ++
Sbjct: 1248 EKQV 1251


>UniRef50_Q6ZVI3 Cluster: CDNA FLJ42547 fis, clone BRACE3004880;
           n=5; Homo/Pan/Gorilla group|Rep: CDNA FLJ42547 fis,
           clone BRACE3004880 - Homo sapiens (Human)
          Length = 256

 Score = 33.1 bits (72), Expect = 4.8
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 4/70 (5%)
 Frame = -2

Query: 263 ITLNDGLISS-TITLTGMSMTSFLFARRLLSMSLMVLAWS---MSSCSLDKLSTTFKGLS 96
           +TL+   +SS T++  G+S T+ LFA RL S+++   + S   +S+C L +++ +  GLS
Sbjct: 111 VTLSACCLSSMTLSACGLSSTT-LFACRLSSVTVSTCSLSSVTLSACGLSRVTLSACGLS 169

Query: 95  SASGTLSGMA 66
           S + +  G++
Sbjct: 170 SMTPSACGLS 179


>UniRef50_UPI0000E463CE Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 1012

 Score = 32.7 bits (71), Expect = 6.3
 Identities = 21/85 (24%), Positives = 37/85 (43%), Gaps = 2/85 (2%)
 Frame = +3

Query: 273 VEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKND--INTAEIALR 446
           V  P + ++ K+P  D  NP   + +E + Q PE  ED E +    + +  +  AE+  +
Sbjct: 10  VAPPKKKKKKKKPPEDNENPEQKKDEEQKKQEPEPEEDEELVKERQRREESLRRAEVLKQ 69

Query: 447 QGFQEVSDGIGKWYARTEQIKSSRP 521
           +  +    G G+   R       RP
Sbjct: 70  RKKEGARGGRGRGRGRGRGRGRGRP 94


>UniRef50_Q857J1 Cluster: Gp31; n=1; Mycobacterium phage Bxz2|Rep:
           Gp31 - Mycobacteriophage Bxz2
          Length = 100

 Score = 32.7 bits (71), Expect = 6.3
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 2/56 (3%)
 Frame = +3

Query: 348 QEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIG--KWYARTEQIK 509
           + H+     H+E      S++++DI+    A+R+GF+E+   IG  +   RTE+I+
Sbjct: 32  RSHQKVKQTHYEITNDHDSNIRHDIDDLAEAVREGFREIRKDIGGLREELRTERIE 87


>UniRef50_Q45KY9 Cluster: Structural maintenance of chromosome 4; n=1;
            Toxoplasma gondii|Rep: Structural maintenance of
            chromosome 4 - Toxoplasma gondii
          Length = 1479

 Score = 32.7 bits (71), Expect = 6.3
 Identities = 23/71 (32%), Positives = 35/71 (49%)
 Frame = +3

Query: 258  SDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEI 437
            SDL+   + DE EE + P  D    GP +H+E E +  E     E +   ++ D+ T E 
Sbjct: 1086 SDLQKT-LTDEGEEEESP--DAEGSGPTEHEEEEEKKGE-----EPVGGDLEGDMETCEK 1137

Query: 438  ALRQGFQEVSD 470
            A R+   E S+
Sbjct: 1138 ASREEAPEDSE 1148


>UniRef50_Q16RE0 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 206

 Score = 32.7 bits (71), Expect = 6.3
 Identities = 26/101 (25%), Positives = 49/101 (48%), Gaps = 4/101 (3%)
 Frame = +3

Query: 261 DLENVEVPDENEEIKRPLVDLRNPGPPQHQE-HETQN--PEHHE-DAEKIVSSVKNDINT 428
           D E  E+ DE+E   R   D  + G  +HQ+ HE +   PE H+   E+ +  +  +I  
Sbjct: 87  DDEEHEIEDEDESEGRSQQDDDSEGQDEHQQLHEEEESVPEEHDIPVEQKLKQITREIE- 145

Query: 429 AEIALRQGFQEVSDGIGKWYARTEQIKSSRPACNISKKISA 551
               +    ++V +G   + + ++ IK+ RPA  +  +I +
Sbjct: 146 ---EMTHSDRDVDNGRQSFLSLSDLIKNIRPAEKVIPQIDS 183


>UniRef50_A2DF93 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 527

 Score = 32.7 bits (71), Expect = 6.3
 Identities = 18/66 (27%), Positives = 38/66 (57%), Gaps = 1/66 (1%)
 Frame = +3

Query: 246 TVVKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEK-IVSSVKNDI 422
           T VKS+ E + + D++E I  P +++ +PG  ++  H + +    +D EK ++ S  ++ 
Sbjct: 215 TYVKSESEKLTIFDDDETIDVPKLNIHSPG-NRNNRHLSSHKSLPQDMEKTVIESELSEP 273

Query: 423 NTAEIA 440
            +A +A
Sbjct: 274 RSARVA 279


>UniRef50_Q58089 Cluster: Putative hydrogenase expression/formation
           protein MJ0676; n=22; cellular organisms|Rep: Putative
           hydrogenase expression/formation protein MJ0676 -
           Methanococcus jannaschii
          Length = 335

 Score = 32.7 bits (71), Expect = 6.3
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +3

Query: 381 EDAEKIVSSVKNDINTAEIALRQGFQEVSDGI 476
           ED EKIV S+      AE+A+  G  +VSDG+
Sbjct: 107 EDLEKIVKSINETSKEAEVAIITGDTKVSDGV 138


>UniRef50_Q2SJH0 Cluster: Putative uncharacterized protein; n=1;
           Hahella chejuensis KCTC 2396|Rep: Putative
           uncharacterized protein - Hahella chejuensis (strain
           KCTC 2396)
          Length = 469

 Score = 32.3 bits (70), Expect = 8.3
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = -2

Query: 245 LISSTITLTGMSMTSFLFARRLLSMSLMVLA 153
           L+ S + LT ++MT  L +RR++SM++ VLA
Sbjct: 185 LVVSAVLLTSLAMTVALASRRIISMTIFVLA 215


>UniRef50_Q0F3L7 Cluster: Ubiquinol-cytochrome c reductase,
           iron-sulfur subunit; n=1; Mariprofundus ferrooxydans
           PV-1|Rep: Ubiquinol-cytochrome c reductase, iron-sulfur
           subunit - Mariprofundus ferrooxydans PV-1
          Length = 200

 Score = 32.3 bits (70), Expect = 8.3
 Identities = 15/26 (57%), Positives = 18/26 (69%)
 Frame = -2

Query: 557 SERRNFLGNVASWPGALNLLGTSVPF 480
           S RRNFL  VAS  GA+ + G +VPF
Sbjct: 8   SRRRNFLWGVASGLGAVGVAGVAVPF 33


>UniRef50_A0ZFU9 Cluster: S-layer region-like protein; n=2;
           Nostocaceae|Rep: S-layer region-like protein - Nodularia
           spumigena CCY 9414
          Length = 458

 Score = 32.3 bits (70), Expect = 8.3
 Identities = 19/66 (28%), Positives = 32/66 (48%)
 Frame = +3

Query: 318 DLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYART 497
           +L NP  P +   +  N    +      S   ND+N A   LRQ  Q+++  +G    ++
Sbjct: 196 NLLNPALPDNVATQPDNTSVSQTTATAKSQKFNDLNQAPPELRQSIQDLA-ALGVLSLKS 254

Query: 498 EQIKSS 515
           E++KSS
Sbjct: 255 EEVKSS 260


>UniRef50_Q55DZ3 Cluster: Putative uncharacterized protein; n=12;
            Eukaryota|Rep: Putative uncharacterized protein -
            Dictyostelium discoideum AX4
          Length = 2221

 Score = 32.3 bits (70), Expect = 8.3
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = +3

Query: 285  DENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSV-KNDINTAEIALRQGFQE 461
            ++NEE  +P  + ++   P+ QE + + PE  E+ E+ V  + + +    E    Q  +E
Sbjct: 2024 NQNEENVQPTQEKQDEQEPEEQEEQEKQPEEEEEEEEKVKEIEQQEEEEEEPKEEQSEEE 2083

Query: 462  VSDGIGKWYARTEQIKSSRP 521
              +   +     EQ K  +P
Sbjct: 2084 EEEQPEEEQPEEEQTKEEQP 2103


>UniRef50_A0CQY0 Cluster: Chromosome undetermined scaffold_241,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_241,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 761

 Score = 32.3 bits (70), Expect = 8.3
 Identities = 25/90 (27%), Positives = 48/90 (53%)
 Frame = +3

Query: 288 ENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVS 467
           E++E+ + + DL+     Q+ +  TQN    E  ++I  S++N +N A++ L Q      
Sbjct: 673 EDDELHKTINDLKEKHKEQNLKISTQNQTLQEFQQQI-QSLQNQLNQAKLPLNQ-----V 726

Query: 468 DGIGKWYARTEQIKSSRPACNISKKISALR 557
             +  ++ +T+ IK    + N SK+IS L+
Sbjct: 727 KALTYFFRKTQNIKEF--SNNNSKEISELQ 754


>UniRef50_P32608 Cluster: Retrograde regulation protein 2; n=6;
           Saccharomycetales|Rep: Retrograde regulation protein 2 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 588

 Score = 32.3 bits (70), Expect = 8.3
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 1/89 (1%)
 Frame = +1

Query: 46  CSPHAQPAIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVK 225
           C  H    I D V +      + V+  S ++ +ID ANT K  + S R N+    ++ V+
Sbjct: 489 CGVHPGGNIRDNVFDFHVSKRSEVET-SLKELIIDDANTTKVKEESTRKNRG--YEVVVR 545

Query: 226 VIVEEIKPSLRVI*KTLKCRMKMRK-SRG 309
           +  +++K S  V  + +  + K+RK SRG
Sbjct: 546 ISKDDLKTSASVRSRIITLQKKVRKLSRG 574


>UniRef50_Q51487 Cluster: Outer membrane protein oprM precursor;
           n=40; Proteobacteria|Rep: Outer membrane protein oprM
           precursor - Pseudomonas aeruginosa
          Length = 485

 Score = 32.3 bits (70), Expect = 8.3
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +3

Query: 402 SSVKNDINTA--EIALRQGFQEVSDGIGKWYARTEQIKSSRPACNISKKISALRYK 563
           + ++ DIN A  E A++  FQEV+DG+      TEQ+++ R     S +   L  K
Sbjct: 364 AKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADK 419


>UniRef50_Q8T0S6 Cluster: Serine/threonine-protein kinase hippo;
           n=5; Eumetazoa|Rep: Serine/threonine-protein kinase
           hippo - Drosophila melanogaster (Fruit fly)
          Length = 669

 Score = 32.3 bits (70), Expect = 8.3
 Identities = 13/55 (23%), Positives = 29/55 (52%)
 Frame = +3

Query: 303 KRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVS 467
           ++P+    +P   + Q+ + Q  +  +  E+ ++S  ND+N  E  +   FQ++S
Sbjct: 476 EKPIATEYSPAAAEQQQQQQQQQQQQQQDEQHLASGANDLNNWEHNMEMQFQQIS 530


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 486,061,041
Number of Sequences: 1657284
Number of extensions: 8877981
Number of successful extensions: 40039
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 37764
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39953
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 39154548218
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -