SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20056
         (750 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9; ...   170   3e-41
UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n...   134   2e-30
UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=23...   132   1e-29
UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome sho...   130   3e-29
UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock...   129   6e-29
UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular...   129   6e-29
UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular ...   129   8e-29
UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931; roo...   128   2e-28
UniRef50_P02826 Cluster: Heat shock 70 kDa protein cognate 1; n=...   125   1e-27
UniRef50_Q2VA67 Cluster: Putative heat schock protein 70; n=1; T...   112   8e-24
UniRef50_Q9UQC1 Cluster: Heat shock protein 72; n=10; Fungi/Meta...   111   1e-23
UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock...   109   5e-23
UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precur...   105   1e-21
UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella natan...   103   5e-21
UniRef50_Q4P628 Cluster: Putative uncharacterized protein; n=1; ...   102   8e-21
UniRef50_A3CIL0 Cluster: Putative uncharacterized protein; n=2; ...    99   1e-19
UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago...    97   5e-19
UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|R...    96   9e-19
UniRef50_A2Y4X8 Cluster: Putative uncharacterized protein; n=1; ...    94   4e-18
UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago...    93   7e-18
UniRef50_A2Y3V8 Cluster: Putative uncharacterized protein; n=4; ...    93   9e-18
UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial precur...    92   2e-17
UniRef50_UPI000058655A Cluster: PREDICTED: similar to heat shock...    91   2e-17
UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular ...    91   3e-17
UniRef50_A7HBX9 Cluster: 2-alkenal reductase precursor; n=7; Cys...    91   4e-17
UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular ...    91   4e-17
UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3; Planctomyc...    90   5e-17
UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Re...    90   6e-17
UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2; Enta...    89   1e-16
UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 7...    89   1e-16
UniRef50_A2WTX8 Cluster: Putative uncharacterized protein; n=1; ...    89   1e-16
UniRef50_A0DHP4 Cluster: Chromosome undetermined scaffold_50, wh...    89   1e-16
UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole gen...    87   4e-16
UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular...    87   4e-16
UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellula...    86   8e-16
UniRef50_O88687 Cluster: Heat shock protein 70; n=2; Euteleostom...    86   1e-15
UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonosp...    86   1e-15
UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia stip...    86   1e-15
UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial ...    85   1e-15
UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38; Bacteria|...    85   2e-15
UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum fer...    85   2e-15
UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella nata...    85   2e-15
UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep: ...    85   2e-15
UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2; ...    84   3e-15
UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia stip...    84   3e-15
UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular...    84   3e-15
UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:...    83   5e-15
UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter ...    83   5e-15
UniRef50_Q73CC4 Cluster: Dnak protein, truncation; n=1; Bacillus...    81   3e-14
UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodosp...    81   3e-14
UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1; ...    81   3e-14
UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2; Gammapro...    81   4e-14
UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n...    80   5e-14
UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila aurari...    80   5e-14
UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27; P...    80   5e-14
UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep...    79   1e-13
UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas vaginali...    79   1e-13
UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188; Bacteria...    78   2e-13
UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29; Proteobac...    78   3e-13
UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3; Psychrobacter...    77   4e-13
UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock...    77   5e-13
UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone...    77   6e-13
UniRef50_Q1CWT5 Cluster: DnaK family protein; n=2; Cystobacterin...    77   6e-13
UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1; Aca...    77   6e-13
UniRef50_A6C7U8 Cluster: DnaK protein (Heat shock protein), C-te...    76   8e-13
UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus...    76   1e-12
UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas s...    75   1e-12
UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular or...    75   2e-12
UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    75   2e-12
UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3; ...    75   2e-12
UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera a...    75   2e-12
UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus ...    74   3e-12
UniRef50_Q9M7S4 Cluster: Heat shock protein 70; n=1; Triticum ae...    74   4e-12
UniRef50_Q3SD91 Cluster: Cytosol-type hsp70; n=1; Paramecium tet...    74   4e-12
UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gamb...    74   4e-12
UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=...    73   6e-12
UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26; Bacteria|...    73   8e-12
UniRef50_UPI0000510557 Cluster: COG0443: Molecular chaperone; n=...    73   1e-11
UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein...    73   1e-11
UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4; Planctomyc...    72   1e-11
UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: Dna...    72   2e-11
UniRef50_Q64YI6 Cluster: Chaperone protein DnaK; n=2; Bacteroide...    72   2e-11
UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma marg...    72   2e-11
UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1; N...    72   2e-11
UniRef50_A4J964 Cluster: Heat shock protein 70; n=2; Clostridial...    72   2e-11
UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein), C-te...    71   2e-11
UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone...    71   2e-11
UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter ...    71   2e-11
UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1; Methanospir...    71   2e-11
UniRef50_Q6F9S6 Cluster: Chaperone protein; n=2; Acinetobacter|R...    71   3e-11
UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1; Planctom...    71   3e-11
UniRef50_UPI0000D56BFD Cluster: PREDICTED: similar to CG8937-PA,...    71   4e-11
UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein), HSP7...    71   4e-11
UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13; Rickett...    71   4e-11
UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshime...    71   4e-11
UniRef50_A5AUN6 Cluster: Putative uncharacterized protein; n=1; ...    70   7e-11
UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    69   9e-11
UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1; Syntroph...    69   2e-10
UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1; ...    69   2e-10
UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena ...    68   2e-10
UniRef50_A6C7U7 Cluster: DnaK protein (Heat shock protein), HSP7...    68   3e-10
UniRef50_Q7M080 Cluster: DnaK-type molecular chaperone; n=1; Cri...    67   4e-10
UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA...    66   7e-10
UniRef50_Q1CY00 Cluster: DnaK family protein; n=2; Cystobacterin...    66   7e-10
UniRef50_A7BR82 Cluster: Heat shock protein Hsp70; n=1; Beggiato...    66   7e-10
UniRef50_A2ECF5 Cluster: DnaK protein; n=1; Trichomonas vaginali...    66   7e-10
UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lambl...    66   9e-10
UniRef50_P77319 Cluster: Chaperone protein hscC; n=19; Gammaprot...    66   9e-10
UniRef50_A5MZQ7 Cluster: DnaK9; n=1; Clostridium kluyveri DSM 55...    66   1e-09
UniRef50_A3FQM0 Cluster: Heat shock 105kD; heat shock 105kD alph...    66   1e-09
UniRef50_A6EQS3 Cluster: Heat shock protein Hsp70; n=1; unidenti...    65   2e-09
UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2; Anaeromyxob...    65   2e-09
UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168, w...    64   3e-09
UniRef50_A2VD43 Cluster: Heat shock protein 14; n=3; Clupeocepha...    64   4e-09
UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera aphi...    64   4e-09
UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacif...    64   4e-09
UniRef50_Q010Y3 Cluster: DNAK_GLOVI Chaperone protein dnaK; n=1;...    64   4e-09
UniRef50_Q20752 Cluster: Putative uncharacterized protein stc-1;...    64   4e-09
UniRef50_Q8YNT4 Cluster: DnaK-type molecular chaperone; n=2; Nos...    64   5e-09
UniRef50_Q9VUC1 Cluster: CG6603-PA, isoform A; n=7; Endopterygot...    64   5e-09
UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG070...    64   5e-09
UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock...    63   6e-09
UniRef50_A4QNX8 Cluster: Zgc:162281 protein; n=6; Eumetazoa|Rep:...    63   6e-09
UniRef50_Q4XZF4 Cluster: Putative uncharacterized protein; n=1; ...    63   6e-09
UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera a...    63   6e-09
UniRef50_A2EAK8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    63   8e-09
UniRef50_A5N5I5 Cluster: DnaK1; n=1; Clostridium kluyveri DSM 55...    62   1e-08
UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;...    62   1e-08
UniRef50_UPI0000499E28 Cluster: hsp70 family protein; n=1; Entam...    62   1e-08
UniRef50_A6UND5 Cluster: 2-alkenal reductase; n=1; Methanococcus...    62   1e-08
UniRef50_P48723 Cluster: Stress 70 protein chaperone microsome-a...    62   1e-08
UniRef50_UPI0000499681 Cluster: heat shock protein 70; n=1; Enta...    62   2e-08
UniRef50_A3BBU4 Cluster: Putative uncharacterized protein; n=2; ...    62   2e-08
UniRef50_A7RF55 Cluster: Predicted protein; n=1; Nematostella ve...    62   2e-08
UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    61   2e-08
UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2; Panspora...    61   2e-08
UniRef50_UPI000038E267 Cluster: hypothetical protein Faci_030017...    61   3e-08
UniRef50_A2G573 Cluster: DnaK protein; n=2; Trichomonas vaginali...    61   3e-08
UniRef50_A7QL81 Cluster: Chromosome chr3 scaffold_117, whole gen...    60   4e-08
UniRef50_A2DR00 Cluster: DnaK protein; n=7; Trichomonas vaginali...    60   6e-08
UniRef50_A6NJU0 Cluster: Uncharacterized protein HSPA14; n=2; Eu...    60   8e-08
UniRef50_Q0VDF9 Cluster: Heat shock 70 kDa protein 14; n=25; Eut...    60   8e-08
UniRef50_A6NYB9 Cluster: Putative uncharacterized protein; n=1; ...    59   1e-07
UniRef50_A5MZQ6 Cluster: DnaK8; n=2; Clostridium kluyveri DSM 55...    59   1e-07
UniRef50_A5B0E9 Cluster: Putative uncharacterized protein; n=1; ...    59   1e-07
UniRef50_Q54GD7 Cluster: Heat shock protein Hsp70 family protein...    59   1e-07
UniRef50_Q3W504 Cluster: Heat shock protein Hsp70; n=3; Actinomy...    59   1e-07
UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14; R...    59   1e-07
UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia bu...    58   2e-07
UniRef50_A2F432 Cluster: DnaK protein; n=1; Trichomonas vaginali...    58   2e-07
UniRef50_Q9XZM1 Cluster: Heat shock protein HSP70-2; n=3; Entamo...    58   2e-07
UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2; Actinomy...    58   3e-07
UniRef50_Q2QXK2 Cluster: DnaK protein, expressed; n=2; Oryza sat...    58   3e-07
UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1; Saccharo...    57   4e-07
UniRef50_A4AEG2 Cluster: Putative uncharacterized protein; n=1; ...    57   4e-07
UniRef50_Q4SW20 Cluster: Chromosome undetermined SCAF13693, whol...    57   5e-07
UniRef50_Q22CW2 Cluster: Heat shock protein 70 homolog; n=1; Tet...    56   7e-07
UniRef50_UPI0000499AA8 Cluster: hsp70 family protein; n=1; Entam...    56   1e-06
UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1; Enta...    55   2e-06
UniRef50_UPI0000498597 Cluster: chaperone protein dnaK; n=1; Ent...    55   2e-06
UniRef50_A6CBP2 Cluster: Dnak protein, truncation; n=1; Planctom...    55   2e-06
UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena t...    55   2e-06
UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia intest...    55   2e-06
UniRef50_Q9Y4L1 Cluster: Hypoxia up-regulated protein 1 precurso...    55   2e-06
UniRef50_UPI00015B551B Cluster: PREDICTED: similar to ENSANGP000...    54   4e-06
UniRef50_Q96269 Cluster: Heat-shock protein; n=14; Magnoliophyta...    54   4e-06
UniRef50_Q05036 Cluster: Uncharacterized protein C30C11.4; n=2; ...    54   4e-06
UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM 55...    54   5e-06
UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n...    53   7e-06
UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM 55...    53   9e-06
UniRef50_Q7M2S5 Cluster: DnaK-type molecular chaperone; n=1; Sus...    53   9e-06
UniRef50_Q1D211 Cluster: DnaK family protein; n=1; Myxococcus xa...    52   1e-05
UniRef50_A4ZY06 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_UPI0000E474BD Cluster: PREDICTED: hypothetical protein;...    52   2e-05
UniRef50_Q7ZUM5 Cluster: Heat shock protein 4; n=20; Euteleostom...    52   2e-05
UniRef50_Q0WM51 Cluster: HSP like protein; n=11; Magnoliophyta|R...    52   2e-05
UniRef50_O23508 Cluster: Growth regulator like protein; n=6; Mag...    52   2e-05
UniRef50_A2DWC1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    52   2e-05
UniRef50_UPI0000498BE2 Cluster: chaperone protein dnaK; n=2; Ent...    52   2e-05
UniRef50_A5N5I8 Cluster: DnaK4; n=1; Clostridium kluyveri DSM 55...    52   2e-05
UniRef50_Q5C1F3 Cluster: SJCHGC04997 protein; n=1; Schistosoma j...    52   2e-05
UniRef50_Q4CS27 Cluster: Putative uncharacterized protein; n=3; ...    52   2e-05
UniRef50_O15797 Cluster: CG4; n=10; Plasmodium|Rep: CG4 - Plasmo...    52   2e-05
UniRef50_UPI0000498B17 Cluster: hsp70 family protein; n=1; Entam...    51   4e-05
UniRef50_Q1VU26 Cluster: Heat shock protein Hsp70; n=2; Bacteroi...    51   4e-05
UniRef50_Q92598 Cluster: Heat shock protein 105 kDa; n=92; Eumet...    51   4e-05
UniRef50_A2G8T1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    50   5e-05
UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    50   5e-05
UniRef50_A2ECV1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    50   5e-05
UniRef50_O14992 Cluster: HS24/P52; n=8; Eutheria|Rep: HS24/P52 -...    50   5e-05
UniRef50_UPI0000660D8E Cluster: Homolog of Homo sapiens "heat sh...    50   6e-05
UniRef50_Q1D082 Cluster: DnaK family protein; n=2; Cystobacterin...    50   6e-05
UniRef50_Q06068 Cluster: 97 kDa heat shock protein; n=3; Strongy...    50   6e-05
UniRef50_UPI0000F1F58C Cluster: PREDICTED: similar to Heat shock...    49   1e-04
UniRef50_Q00YD5 Cluster: Heat shock protein 91-Arabidopsis thali...    49   1e-04
UniRef50_Q2H062 Cluster: Putative uncharacterized protein; n=2; ...    49   1e-04
UniRef50_O59838 Cluster: Heat shock protein homolog pss1; n=21; ...    49   1e-04
UniRef50_P32590 Cluster: Heat shock protein homolog SSE2; n=20; ...    49   1e-04
UniRef50_A0ZXN0 Cluster: Heat shock protein 70-like; n=1; Fig le...    48   2e-04
UniRef50_Q86JV8 Cluster: Similar to heat shock protein; n=2; Dic...    48   2e-04
UniRef50_Q57VU9 Cluster: Heat shock 70 kDa protein, putative; n=...    48   2e-04
UniRef50_UPI00006CA81B Cluster: dnaK protein; n=1; Tetrahymena t...    48   2e-04
UniRef50_Q4RM18 Cluster: Chromosome 10 SCAF15019, whole genome s...    48   2e-04
UniRef50_A2F0R7 Cluster: DnaK protein; n=2; Trichomonas vaginali...    48   2e-04
UniRef50_UPI0000DC15CB Cluster: UPI0000DC15CB related cluster; n...    48   3e-04
UniRef50_A6EMR6 Cluster: Heat shock protein Hsp70; n=1; unidenti...    47   4e-04
UniRef50_A7QHP2 Cluster: Chromosome chr8 scaffold_99, whole geno...    47   4e-04
UniRef50_A3LSS8 Cluster: Stress-seventy subfamily A; n=1; Pichia...    47   4e-04
UniRef50_UPI0000D55C7E Cluster: PREDICTED: similar to CG2918-PA;...    47   6e-04
UniRef50_Q3WFH0 Cluster: Heat shock protein Hsp70; n=1; Frankia ...    47   6e-04
UniRef50_Q22758 Cluster: Putative uncharacterized protein; n=2; ...    47   6e-04
UniRef50_A2DZ76 Cluster: DnaK protein; n=1; Trichomonas vaginali...    46   8e-04
UniRef50_A0C553 Cluster: Chromosome undetermined scaffold_15, wh...    46   8e-04
UniRef50_Q4RRT3 Cluster: Chromosome 16 SCAF15002, whole genome s...    46   0.001
UniRef50_UPI0000499107 Cluster: 70 kDa heat shock protein; n=1; ...    46   0.001
UniRef50_A6GJQ9 Cluster: Heat shock protein Hsp70; n=1; Plesiocy...    46   0.001
UniRef50_A0NUH2 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_A2R006 Cluster: Contig An12c0210, complete genome; n=1;...    46   0.001
UniRef50_Q52V38 Cluster: Heat shock protein 70-like; n=4; Mint v...    45   0.002
UniRef50_A7PZE7 Cluster: Chromosome chr15 scaffold_40, whole gen...    45   0.002
UniRef50_A7AN53 Cluster: DnaK family protein; n=1; Babesia bovis...    45   0.002
UniRef50_A2EPF1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    45   0.002
UniRef50_A2UL28 Cluster: Glutamate dehydrogenase; n=5; Enterobac...    45   0.002
UniRef50_A2EVQ1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    45   0.002
UniRef50_UPI000049A3E9 Cluster: 70 kDa heat shock protein; n=2; ...    44   0.003
UniRef50_A4RY30 Cluster: Heat Shock Protein 70, ER lumen; n=2; O...    44   0.003
UniRef50_Q4QDQ2 Cluster: Heat shock protein, putative; n=5; Tryp...    44   0.003
UniRef50_Q4Q9A4 Cluster: Heat shock 70 protein-like protein; n=3...    44   0.003
UniRef50_A7SM46 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.003
UniRef50_A4IC10 Cluster: Putative uncharacterized protein; n=3; ...    44   0.003
UniRef50_A2DHP3 Cluster: Heat shock protein, putative; n=1; Tric...    44   0.003
UniRef50_A1FNI8 Cluster: Glutamate dehydrogenase; n=1; Pseudomon...    44   0.004
UniRef50_Q9SAB1 Cluster: F25C20.19 protein; n=3; core eudicotyle...    44   0.004
UniRef50_Q9S8V5 Cluster: ATP-binding HSP70 homolog; n=4; cellula...    44   0.004
UniRef50_Q6L4S6 Cluster: Putative uncharacterized protein P0663C...    44   0.004
UniRef50_Q01M68 Cluster: OSIGBa0114M03.5 protein; n=4; Oryza sat...    44   0.004
UniRef50_A2XF45 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q9GYV8 Cluster: 70-kDa heat shock protein; n=5; Entamoe...    44   0.004
UniRef50_Q22515 Cluster: Putative uncharacterized protein; n=3; ...    44   0.004
UniRef50_A2EFJ4 Cluster: DnaK protein; n=1; Trichomonas vaginali...    44   0.004
UniRef50_Q8RH06 Cluster: Putative uncharacterized protein FN0115...    44   0.005
UniRef50_Q4ETY1 Cluster: Putative uncharacterized protein; n=2; ...    44   0.005
UniRef50_A2FKE2 Cluster: DnaK protein; n=3; Trichomonas vaginali...    44   0.005
UniRef50_Q66239 Cluster: 65-kDa protein; n=19; Citrus tristeza v...    43   0.007
UniRef50_Q655N4 Cluster: Putative heat-shock protein; n=2; Oryza...    43   0.007
UniRef50_A2E407 Cluster: DnaK protein; n=1; Trichomonas vaginali...    43   0.007
UniRef50_Q1E6G2 Cluster: Heat shock protein 70 homolog; n=17; Pe...    43   0.007
UniRef50_A4EA23 Cluster: Putative uncharacterized protein; n=1; ...    43   0.009
UniRef50_A0NRW0 Cluster: Heat shock protein Hsp70; n=1; Stappia ...    43   0.009
UniRef50_Q1NR74 Cluster: Heat shock protein Hsp70; n=3; Proteoba...    42   0.012
UniRef50_Q3VZ88 Cluster: Heat shock protein Hsp70; n=1; Frankia ...    42   0.016
UniRef50_Q1YJU7 Cluster: Possible chaperone protein; n=1; Aurant...    42   0.016
UniRef50_A0PTC6 Cluster: Chaperone protein DnaK1; n=3; Mycobacte...    42   0.016
UniRef50_Q9QCV8 Cluster: Heat shock 70 protein; n=2; Plum bark n...    42   0.021
UniRef50_Q1NQZ1 Cluster: Glutamate dehydrogenase precursor; n=1;...    42   0.021
UniRef50_O46067 Cluster: CG2918-PA; n=3; Diptera|Rep: CG2918-PA ...    42   0.021
UniRef50_UPI0000DB7485 Cluster: PREDICTED: similar to CG2918-PA;...    41   0.028
UniRef50_UPI00004995BC Cluster: hsp70 family protein; n=1; Entam...    41   0.028
UniRef50_Q0EST2 Cluster: Heat shock protein 70; n=3; Thermoanaer...    41   0.028
UniRef50_A2FVJ6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    41   0.028
UniRef50_Q9Q1X6 Cluster: Heat shock protein 70-like; n=2; Olive ...    41   0.037
UniRef50_Q04E70 Cluster: Actin-like ATPase for cell morphogenesi...    41   0.037
UniRef50_A2YAM2 Cluster: Putative uncharacterized protein; n=3; ...    41   0.037
UniRef50_Q8SWH2 Cluster: Similarity to HSP70-RELATED PROTEIN; n=...    41   0.037
UniRef50_UPI000049A5EA Cluster: hsp70 family protein; n=1; Entam...    40   0.049
UniRef50_A2FPJ8 Cluster: Heat shock protein SSB-related protein;...    40   0.049
UniRef50_A0DJC4 Cluster: Chromosome undetermined scaffold_53, wh...    40   0.049
UniRef50_A7BCD2 Cluster: Putative uncharacterized protein; n=1; ...    40   0.065
UniRef50_A6VWZ8 Cluster: Molecular chaperone; n=2; Marinomonas|R...    40   0.065
UniRef50_A5AJL9 Cluster: Putative uncharacterized protein; n=1; ...    40   0.065
UniRef50_Q17291 Cluster: Heat shock protein 70A; n=1; Bursaphele...    40   0.065
UniRef50_A7AWJ8 Cluster: Tetratricopeptide repeat domain contain...    40   0.065
UniRef50_A2FYV4 Cluster: DnaK protein; n=1; Trichomonas vaginali...    40   0.065
UniRef50_A2E4A6 Cluster: DnaK protein; n=2; Trichomonas vaginali...    40   0.065
UniRef50_P37092 Cluster: Heat shock protein 70 homolog; n=5; Clo...    40   0.065
UniRef50_O71192 Cluster: 59 kDa protein; n=26; Grapevine leafrol...    40   0.086
UniRef50_Q08P77 Cluster: Chaperone protein DnaK, putative; n=1; ...    40   0.086
UniRef50_Q9TX41 Cluster: 200 kDa wall antigen; n=1; Cryptosporid...    40   0.086
UniRef50_A2EMY0 Cluster: DnaK protein; n=4; Trichomonas vaginali...    40   0.086
UniRef50_Q4P3F6 Cluster: Putative uncharacterized protein; n=1; ...    40   0.086
UniRef50_P87142 Cluster: Heat shock protein 70 homolog C57A7.12;...    40   0.086
UniRef50_Q9X1N0 Cluster: Rod shape-determining protein MreB; n=1...    39   0.11 
UniRef50_Q8NN35 Cluster: Molecular chaperone; n=3; Corynebacteri...    39   0.11 
UniRef50_A5VT75 Cluster: Putative NAD-specific glutamate dehydro...    39   0.11 
UniRef50_A1TTJ9 Cluster: Putative chaperone heat-shock protein; ...    39   0.11 
UniRef50_A0UQH1 Cluster: Glutamate dehydrogenase; n=14; Proteoba...    39   0.11 
UniRef50_Q4Q5R6 Cluster: Putative uncharacterized protein; n=3; ...    39   0.11 
UniRef50_A2DQ03 Cluster: DnaK protein; n=1; Trichomonas vaginali...    39   0.11 
UniRef50_A0XXF0 Cluster: Predicted chaperone; n=3; Alteromonadal...    39   0.15 
UniRef50_A0VAV7 Cluster: Molecular chaperone, HSP70 class; n=4; ...    39   0.15 
UniRef50_Q9VSI1 Cluster: CG7182-PA; n=2; Sophophora|Rep: CG7182-...    39   0.15 
UniRef50_P38788 Cluster: Ribosome-associated complex subunit SSZ...    39   0.15 
UniRef50_UPI00005A2730 Cluster: PREDICTED: similar to heat shock...    38   0.20 
UniRef50_A7PR73 Cluster: Chromosome chr14 scaffold_26, whole gen...    38   0.20 
UniRef50_Q5CTE6 Cluster: APG-1 like HSP70 domain containing prot...    38   0.20 
UniRef50_A2FS75 Cluster: DnaK protein; n=1; Trichomonas vaginali...    38   0.20 
UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative g...    38   0.26 
UniRef50_A0MBW7 Cluster: HSP 70h; n=6; Closterovirus|Rep: HSP 70...    38   0.26 
UniRef50_A5ANY6 Cluster: Putative uncharacterized protein; n=1; ...    38   0.26 
UniRef50_A2DQX2 Cluster: DnaK protein; n=1; Trichomonas vaginali...    38   0.26 
UniRef50_Q8XIE1 Cluster: Cell shape determining protein; n=7; Fi...    38   0.35 
UniRef50_A2F7Z8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    38   0.35 
UniRef50_Q55Y28 Cluster: Putative uncharacterized protein; n=2; ...    38   0.35 
UniRef50_A7U5U4 Cluster: Hsp70; n=4; Pezizomycotina|Rep: Hsp70 -...    38   0.35 
UniRef50_Q98159 Cluster: ORF1 protein; n=2; Little cherry virus ...    37   0.46 
UniRef50_A7DID8 Cluster: Glutamate dehydrogenase; n=14; Alphapro...    37   0.46 
UniRef50_A3TFM0 Cluster: Rod shape-determining protein; n=1; Jan...    37   0.46 
UniRef50_A1R9R9 Cluster: Putative DnaK family protein; n=1; Arth...    37   0.46 
UniRef50_A1G644 Cluster: Heat shock protein 70; n=2; Salinispora...    37   0.46 
UniRef50_Q06YR5 Cluster: Possibile polyglycylated protein 1; n=2...    37   0.46 
UniRef50_A4ZIR9 Cluster: Heat shock protein 70; n=12; Closterovi...    37   0.61 
UniRef50_Q4JX13 Cluster: Molecular chaperone protein; n=1; Coryn...    37   0.61 
UniRef50_Q3XWY0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.61 
UniRef50_Q9SKY8 Cluster: 70kD heat shock protein; n=6; Magnoliop...    37   0.61 
UniRef50_A0CZG2 Cluster: Chromosome undetermined scaffold_32, wh...    37   0.61 
UniRef50_Q4PG59 Cluster: Putative uncharacterized protein; n=1; ...    37   0.61 
UniRef50_Q9Q6Q1 Cluster: HSP70-like protein; n=47; Grapevine lea...    36   0.81 
UniRef50_Q7T733 Cluster: P60; n=2; Little cherry virus 2|Rep: P6...    36   0.81 
UniRef50_Q7UQD6 Cluster: Probable thioredoxin related protein; n...    36   0.81 
UniRef50_Q6MMA0 Cluster: Rod shape-determining protein; n=1; Bde...    36   0.81 
UniRef50_Q5LSW4 Cluster: Putative uncharacterized protein; n=1; ...    36   0.81 
UniRef50_A4FEW4 Cluster: Putative surface layer protein; n=1; Sa...    36   0.81 
UniRef50_A2F6W8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    36   0.81 
UniRef50_A2DMZ9 Cluster: Putative uncharacterized protein; n=5; ...    36   0.81 
UniRef50_Q98BE0 Cluster: DnaK-type molecular chaperone; DnaK; n=...    36   1.1  
UniRef50_UPI000023CEA8 Cluster: hypothetical protein FG00850.1; ...    36   1.4  
UniRef50_A0W7A3 Cluster: Heat shock protein, HSP70 family; n=4; ...    36   1.4  
UniRef50_A0GV00 Cluster: Putative NAD-specific glutamate dehydro...    36   1.4  
UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginali...    36   1.4  
UniRef50_A1XM67 Cluster: Heat shock protein Hsp70-6; n=1; Blasto...    36   1.4  
UniRef50_Q9HHC0 Cluster: Putative glutamate dehydrogenase; n=1; ...    36   1.4  
UniRef50_Q8KEY5 Cluster: Rod shape-determining protein MreB; n=4...    35   1.9  
UniRef50_Q392G1 Cluster: Molecular chaperone-like; n=20; Proteob...    35   1.9  
UniRef50_Q15XT0 Cluster: Putative uncharacterized protein; n=1; ...    35   1.9  
UniRef50_Q01UV8 Cluster: Molecular chaperone; n=1; Solibacter us...    35   1.9  
UniRef50_A6FD17 Cluster: Putative heat shock protein 70 family p...    35   1.9  
UniRef50_A6E8E9 Cluster: Probable heat shock protein; n=1; Pedob...    35   1.9  
UniRef50_A2E5D4 Cluster: DnaK protein; n=3; Trichomonas vaginali...    35   1.9  
UniRef50_A6SIT8 Cluster: Putative uncharacterized protein; n=1; ...    35   1.9  
UniRef50_O57013 Cluster: Hsp-70 protein; n=2; Grapevine leafroll...    35   2.5  
UniRef50_Q1EWS0 Cluster: Heat shock protein Hsp70; n=1; Clostrid...    35   2.5  
UniRef50_A7PMW8 Cluster: Chromosome chr14 scaffold_21, whole gen...    35   2.5  
UniRef50_Q4E175 Cluster: Heat shock protein 70 (HSP70), putative...    35   2.5  
UniRef50_Q6CM78 Cluster: Similarities with sp|Q12355 Saccharomyc...    35   2.5  
UniRef50_Q1DPZ3 Cluster: Putative uncharacterized protein; n=1; ...    35   2.5  
UniRef50_A6R3U1 Cluster: Predicted protein; n=1; Ajellomyces cap...    35   2.5  
UniRef50_Q805J2 Cluster: Heat shock protein 70-like protein; n=1...    34   3.3  
UniRef50_Q6QCI1 Cluster: HSP70h; n=1; Mint vein banding virus|Re...    34   3.3  
UniRef50_Q8YXE9 Cluster: DnaK-type molecular chaperone; n=13; Cy...    34   3.3  
UniRef50_Q6MI83 Cluster: Molecular chaperone, Hsp70 family; n=1;...    34   3.3  
UniRef50_Q7X199 Cluster: Lfe195p1; n=2; Leptospirillum|Rep: Lfe1...    34   3.3  
UniRef50_Q1NCH4 Cluster: Putative NAD-specific glutamate dehydro...    34   3.3  
UniRef50_Q0SK53 Cluster: Rod shaping protein, MreB; n=1; Rhodoco...    34   3.3  
UniRef50_A7CRR2 Cluster: Glutamate dehydrogenase; n=1; Opitutace...    34   3.3  
UniRef50_A6VV34 Cluster: Molecular chaperone; n=4; Gammaproteoba...    34   3.3  
UniRef50_A1WC34 Cluster: DnaK-related protein; n=3; Comamonadace...    34   3.3  
UniRef50_Q4SWT1 Cluster: Chromosome undetermined SCAF13528, whol...    34   4.3  
UniRef50_A0YV37 Cluster: Heat shock protein 70; n=2; Oscillatori...    34   4.3  
UniRef50_A0PZG5 Cluster: Rod shape-determining protein mreB; n=3...    34   4.3  
UniRef50_Q93ZQ3 Cluster: AT3g63200/F16M2_50; n=4; core eudicotyl...    34   4.3  
UniRef50_Q63ML7 Cluster: Rod shape-determining protein; n=25; Bu...    33   5.7  
UniRef50_Q609C9 Cluster: DnaK-related protein; n=4; cellular org...    33   5.7  
UniRef50_Q13YJ4 Cluster: Putative chaperone protein, HscA/DnaK; ...    33   5.7  
UniRef50_Q0LE46 Cluster: Molecular chaperone; n=4; Chloroflexi (...    33   5.7  
UniRef50_A6FHN6 Cluster: Heat shock protein 70; n=1; Moritella s...    33   5.7  
UniRef50_A4FJJ3 Cluster: Putative uncharacterized protein; n=1; ...    33   5.7  
UniRef50_A1FXC2 Cluster: RNA-binding S4; n=1; Stenotrophomonas m...    33   5.7  
UniRef50_A0W7X9 Cluster: Actin-like ATPase involved in cell morp...    33   5.7  
UniRef50_Q6ZLB3 Cluster: Putative uncharacterized protein OJ1014...    33   5.7  
UniRef50_Q5DEW6 Cluster: SJCHGC09345 protein; n=1; Schistosoma j...    33   5.7  
UniRef50_Q2GU23 Cluster: Putative uncharacterized protein; n=1; ...    33   5.7  
UniRef50_Q0CGD6 Cluster: Putative uncharacterized protein; n=3; ...    33   5.7  
UniRef50_Q8G2E7 Cluster: Heat shock protein, Hsp70 family; n=6; ...    33   7.5  
UniRef50_Q82FX5 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_Q3M5N1 Cluster: DevC protein; n=1; Anabaena variabilis ...    33   7.5  
UniRef50_Q0RLI8 Cluster: Putative uncharacterized protein; n=2; ...    33   7.5  
UniRef50_Q07UL1 Cluster: Molecular chaperone, HSP70 class; n=4; ...    33   7.5  
UniRef50_A7BVW1 Cluster: Heat shock protein, Hsp70 family protei...    33   7.5  
UniRef50_A4SHJ1 Cluster: Molecular chaperone; n=2; Aeromonas|Rep...    33   7.5  
UniRef50_A4M4H3 Cluster: Actin-like ATPase involved in cell morp...    33   7.5  
UniRef50_A3INB1 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_A2ET78 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_A2QXA7 Cluster: Similarity to Neisseria meningitidis Hs...    33   7.5  
UniRef50_UPI00015C5E7A Cluster: hypothetical protein CKO_02913; ...    33   9.9  
UniRef50_Q62G55 Cluster: Chaperone protein, putative; n=30; Burk...    33   9.9  
UniRef50_Q47UP8 Cluster: Putative heat shock protein 70 family p...    33   9.9  
UniRef50_Q11T56 Cluster: Probable heat shock protein; n=1; Cytop...    33   9.9  
UniRef50_A0LQM4 Cluster: Cell shape determining protein, MreB/Mr...    33   9.9  
UniRef50_Q388G4 Cluster: Putative uncharacterized protein; n=1; ...    33   9.9  
UniRef50_Q5KGD4 Cluster: Putative uncharacterized protein; n=1; ...    33   9.9  

>UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9;
           Trypanosomatidae|Rep: Heat shock cognate HSP70 protein -
           Trypanosoma brucei brucei
          Length = 676

 Score =  170 bits (414), Expect = 3e-41
 Identities = 116/234 (49%), Positives = 142/234 (60%), Gaps = 13/234 (5%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           A+GIDLGTTYSCVGV+Q+ +VEIIANDQGNRTTPSYVAF + E L+GDAAK+  A     
Sbjct: 6   AIGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFVNNEVLVGDAAKSHAARGSN- 64

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFHGAYE 446
                 V  D + +++  K + S   S  + W    ++G   G    +   G       E
Sbjct: 65  -----GVIFD-AKRLIGRKFSDSVVQSDMKHWPFKVEEGEKGGAVMRVEHLGEGMLLQPE 118

Query: 447 NEGNCRSLSW-QNCAECSYHGS----------AYFNDSQRQATKDAGTISGLNVLRIINE 593
            + + R L++ ++CAE SY G           AYFNDSQRQATKDAGTI+GL VLRIINE
Sbjct: 119 -QISARVLAYLKSCAE-SYLGKQVAKAVVTVPAYFNDSQRQATKDAGTIAGLEVLRIINE 176

Query: 594 PTAAAIAYGLDKKGTG-ERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           PTAAAIAYGLDK   G ERNVL+FD GGGT     +  S      +   GDTHL
Sbjct: 177 PTAAAIAYGLDKADEGKERNVLVFDFGGGTFDVSIISVSGGVFEVKATNGDTHL 230



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 23/31 (74%), Positives = 27/31 (87%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           N  IFDAKRLIGRKF D+ VQ+DMKHWPF++
Sbjct: 64  NGVIFDAKRLIGRKFSDSVVQSDMKHWPFKV 94



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/49 (44%), Positives = 31/49 (63%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G   ++V + GE     PE++S+ VL  +K  AE+YLGK V  AV+TVP
Sbjct: 100 GGAVMRVEHLGEGMLLQPEQISARVLAYLKSCAESYLGKQVAKAVVTVP 148


>UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n=2;
           Trichomonas vaginalis|Rep: Heat shock cognate protein,
           putative - Trichomonas vaginalis G3
          Length = 622

 Score =  134 bits (324), Expect = 2e-30
 Identities = 85/226 (37%), Positives = 117/226 (51%), Gaps = 2/226 (0%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           K P +GIDLGTT+SCVGVF +GKV+II N+ GNR TPS V   + ++++GDAA   +   
Sbjct: 15  KHPIIGIDLGTTFSCVGVFMNGKVDIIPNEVGNRITPSVVYIGNGKKIVGDAAMPYLVSE 74

Query: 258 P-TTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFH 434
           P  T Y++  +     S   +       G            + +  G  ++  P      
Sbjct: 75  PKNTIYAIKRLIGRRFSDPEVQNEIPHLGYKVIDKNNHPYVEINNNGVIEHYSPEEISSM 134

Query: 435 GAYENEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA 614
             Y+ +    S       E      AYFND+QR++T DAG I GL + RIINEPTAA++A
Sbjct: 135 ILYKMKSVAESYLGYQINESVVTVPAYFNDNQRKSTFDAGKIIGLKITRIINEPTAASLA 194

Query: 615 YGLDKKGTGERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           YGLD+K     N+L++DLGGGT     L     +       GDTHL
Sbjct: 195 YGLDRKNQDSVNILVYDLGGGTFDISLLTVEDSFFEVLATSGDTHL 240



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 23/58 (39%), Positives = 37/58 (63%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L ++V+     P +++   G  + + PEE+SSM+L KMK  AE+YLG  +  +V+TVP
Sbjct: 102 LGYKVIDKNNHPYVEINNNGVIEHYSPEEISSMILYKMKSVAESYLGYQINESVVTVP 159



 Score = 37.5 bits (83), Expect = 0.35
 Identities = 15/33 (45%), Positives = 23/33 (69%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTI+  KRLIGR+F D  VQ ++ H  +++
Sbjct: 74  EPKNTIYAIKRLIGRRFSDPEVQNEIPHLGYKV 106


>UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=239;
           Eukaryota|Rep: Heat shock cognate 71 kDa protein - Homo
           sapiens (Human)
          Length = 646

 Score =  132 bits (318), Expect = 1e-29
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  110 bits (265), Expect = 3e-23
 Identities = 59/81 (72%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIEDGIFEVKSTAGDTHL 228



 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 43/56 (76%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKGE K+F+PEEVSSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 92  FMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF +       + +   + +TK F P +
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEE 118


>UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome
           shotgun sequence; n=3; Fungi/Metazoa group|Rep:
           Chromosome 3 SCAF9564, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 414

 Score =  130 bits (315), Expect = 3e-29
 Identities = 82/172 (47%), Positives = 102/172 (59%), Gaps = 8/172 (4%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+
Sbjct: 4   AEGLAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAL 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*W--RQT*DQGS------I*G*RQNL 410
                   PN +   + +++  K    T  +  + W  +   D G         G  ++ 
Sbjct: 64  N-------PNNTVFDAKRLIGRKLDDPTVQADVKLWPFKVIGDGGKPKIQVEYKGEEKSF 116

Query: 411 FPRGSQFHGAYENEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISG 566
           +P         + +    +   Q  ++      AYFNDSQRQATKDAG I+G
Sbjct: 117 YPEEISSMVLVKMKEIAEAYLGQKVSDAVVTVPAYFNDSQRQATKDAGVIAG 168



 Score = 92.7 bits (220), Expect = 9e-18
 Identities = 40/56 (71%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+ DGGKPKI+V YKGE+K+F+PEE+SSMVL KMKE AEAYLG+ V +AV+TVP
Sbjct: 94  FKVIGDGGKPKIQVEYKGEEKSFYPEEISSMVLVKMKEIAEAYLGQKVSDAVVTVP 149



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 24/33 (72%), Positives = 30/33 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +PNNT+FDAKRLIGRK +D TVQAD+K WPF++
Sbjct: 64  NPNNTVFDAKRLIGRKLDDPTVQADVKLWPFKV 96


>UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock
           protein 2; n=1; Pan troglodytes|Rep: PREDICTED: similar
           to heat shock protein 2 - Pan troglodytes
          Length = 640

 Score =  129 bits (312), Expect = 6e-29
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPT 263
            PT
Sbjct: 63  NPT 65



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 34/61 (55%), Positives = 42/61 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRKSVP 433
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF +       + +   R + +P S R+  P
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKCKXSTRGRPRPSSQRRYPP 122

Query: 434 W 436
           W
Sbjct: 123 W 123


>UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular
           organisms|Rep: Chaperone protein dnaK1 - Synechocystis
           sp. (strain PCC 6803)
          Length = 692

 Score =  129 bits (312), Expect = 6e-29
 Identities = 86/199 (43%), Positives = 111/199 (55%), Gaps = 2/199 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQ-VAMTPT 263
           +GIDLGTT SC  V + GK  +I N +G RTTPS V FT  ++RL+G  AK Q V     
Sbjct: 5   IGIDLGTTNSCASVLEGGKPIVITNTEGGRTTPSIVGFTKGSQRLVGQLAKRQSVTNAEN 64

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFHGAY 443
           T YS+      +  +        S    +C   R      SI G  Q+  P+        
Sbjct: 65  TVYSIKRF---IGRRWDDTVEERSRVPYNCVKGRDDTVSVSIRG--QSYTPQEISAMILQ 119

Query: 444 ENEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
           + + +  +   +   +      AYF D+QRQATKDAGTI+GL VLRIINEPTAAA+AYGL
Sbjct: 120 KLKADSEAFLGEPVTQAVITVPAYFTDAQRQATKDAGTIAGLEVLRIINEPTAAALAYGL 179

Query: 624 DKKGTGERNVLIFDLGGGT 680
           DK+ T E  +L+FDLGGGT
Sbjct: 180 DKQET-EELILVFDLGGGT 197



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 22/50 (44%), Positives = 34/50 (68%)
 Frame = +1

Query: 361 GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G    + V+ +G+  T  P+E+S+M+L K+K  +EA+LG+ V  AVITVP
Sbjct: 94  GRDDTVSVSIRGQSYT--PQEISAMILQKLKADSEAFLGEPVTQAVITVP 141


>UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular
           organisms|Rep: Chaperone protein dnaK - Bordetella
           bronchiseptica (Alcaligenes bronchisepticus)
          Length = 641

 Score =  129 bits (311), Expect = 8e-29
 Identities = 81/199 (40%), Positives = 106/199 (53%), Gaps = 2/199 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP-T 263
           +GIDLGTT SCV V   G+V+II N +G RTTPS VA+ D  E L+G  AK Q    P  
Sbjct: 5   IGIDLGTTNSCVAVLDGGQVKIIENAEGARTTPSIVAYMDDGETLVGAPAKRQAVTNPKN 64

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFHGAY 443
           T Y++  +      +  + K      L      +       +    + L P         
Sbjct: 65  TLYAVKRLIGRKFDEKAVQK---DIDLMPYSIVKADNGDAWVEVRGKKLAPPQVSAEVLR 121

Query: 444 ENEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
           + +        +   E      AYFNDSQRQATKDAG I+GL V RIINEPTAAA+A+GL
Sbjct: 122 KMKKTAEDYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGL 181

Query: 624 DKKGTGERNVLIFDLGGGT 680
           DK   G+R ++++DLGGGT
Sbjct: 182 DKTEKGDRKIVVYDLGGGT 200



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/36 (61%), Positives = 26/36 (72%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K   P +VS+ VL KMK+TAE YLG+ V  AVITVP
Sbjct: 108 KKLAPPQVSAEVLRKMKKTAEDYLGEEVTEAVITVP 143



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 15/33 (45%), Positives = 23/33 (69%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT++  KRLIGRKF++  VQ D+   P+ +
Sbjct: 61  NPKNTLYAVKRLIGRKFDEKAVQKDIDLMPYSI 93


>UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931;
           root|Rep: Heat shock 70 kDa protein 1 - Homo sapiens
           (Human)
          Length = 641

 Score =  128 bits (308), Expect = 2e-28
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  111 bits (268), Expect = 1e-23
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 207

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 208 SILTIDDGIFEVKATAGDTHL 228



 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 92  FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF++       + +   + +TK F P +
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEE 118


>UniRef50_P02826 Cluster: Heat shock 70 kDa protein cognate 1; n=2;
           melanogaster subgroup|Rep: Heat shock 70 kDa protein
           cognate 1 - Drosophila simulans (Fruit fly)
          Length = 214

 Score =  125 bits (302), Expect = 1e-27
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 252 MTP 260
           M P
Sbjct: 61  MNP 63



 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 28/32 (87%), Positives = 32/32 (100%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFE 349
           +PNNTIFDAKRLIGR+F+DATVQ+DMKHWPFE
Sbjct: 62  NPNNTIFDAKRLIGRRFDDATVQSDMKHWPFE 93


>UniRef50_Q2VA67 Cluster: Putative heat schock protein 70; n=1;
           Theileria sp. China|Rep: Putative heat schock protein 70
           - Theileria sp. China
          Length = 372

 Score =  112 bits (270), Expect = 8e-24
 Identities = 58/81 (71%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDKK  GE+NVLIFDLGGGT   
Sbjct: 4   AYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKSGGEKNVLIFDLGGGTFDV 63

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 64  SILTIEDGIFEVKATAGDTHL 84


>UniRef50_Q9UQC1 Cluster: Heat shock protein 72; n=10; Fungi/Metazoa
           group|Rep: Heat shock protein 72 - Homo sapiens (Human)
          Length = 151

 Score =  111 bits (268), Expect = 1e-23
 Identities = 58/81 (71%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGT   
Sbjct: 62  AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDV 121

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 122 SILTIDDGIFEVKATAGDTHL 142



 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 41/56 (73%), Positives = 49/56 (87%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVITVP
Sbjct: 6   FQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVP 61


>UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock
           cognate 71 kDa protein (Heat shock 70 kDa protein 8);
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           Heat shock cognate 71 kDa protein (Heat shock 70 kDa
           protein 8) - Canis familiaris
          Length = 393

 Score =  109 bits (263), Expect = 5e-23
 Identities = 53/57 (92%), Positives = 54/57 (94%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT
Sbjct: 88  AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGT 144



 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 41/56 (73%), Positives = 50/56 (89%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F VV+D G+PK++V YKG+ K+F+PEE+SSMVLTKMKE AEAYLGKTV NAV+TVP
Sbjct: 32  FMVVNDAGRPKVQVEYKGKTKSFYPEELSSMVLTKMKEIAEAYLGKTVTNAVVTVP 87



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +F+AK LIG +F+DA VQ+DMKHWPF +       + +   + KTK F P +
Sbjct: 7   VFNAKCLIGCRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGKTKSFYPEE 58


>UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78); n=736;
           root|Rep: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78) - Homo
           sapiens (Human)
          Length = 654

 Score =  105 bits (252), Expect = 1e-21
 Identities = 54/81 (66%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGT   
Sbjct: 174 AYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTFDV 232

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 233 SLLTIDNGVFEVVATNGDTHL 253



 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88



 Score = 72.9 bits (171), Expect = 8e-12
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKG-EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F+VV    KP I+V   G + KTF PEE+S+MVLTKMKETAEAYLGK V +AV+TVP
Sbjct: 115 LPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRV---KTKPFSPRK 424
           +P NT+FDAKRLIGR + D +VQ D+K  PF+  V+E   +    + +   +TK F+P +
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFK--VVEKKTKPYIQVDIGGGQTKTFAPEE 144


>UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella
           natans|Rep: Chaperone DnaK - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 653

 Score =  103 bits (247), Expect = 5e-21
 Identities = 70/198 (35%), Positives = 95/198 (47%), Gaps = 1/198 (0%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMTPTT 266
           VGIDLGTT S +     G+  I+ N  G R TPS +        ++GD AK Q  + P  
Sbjct: 67  VGIDLGTTNSAIATMVAGQPSILPNSSGARLTPSVIGIDKQNNFVVGDIAKRQAVVNPQN 126

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFHGAYE 446
            Y   +V S +  K     P  S+     +       + S      + +P         +
Sbjct: 127 TYY--SVKSLIGRKYQTTAPNLSSLAYPIKEGPNGLIKVSCPQLNTDFYPEQPSAKVLEQ 184

Query: 447 NEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLD 626
            E N  +              AYF+D+QR ATKDAG+I+GLNV RIINEPTAA++AYG D
Sbjct: 185 LESNYHTAFDSKPELAVITVPAYFDDAQRNATKDAGSIAGLNVQRIINEPTAASLAYGFD 244

Query: 627 KKGTGERNVLIFDLGGGT 680
           K  +    + +FD GGGT
Sbjct: 245 K--SDNSIIFVFDAGGGT 260


>UniRef50_Q4P628 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 225

 Score =  102 bits (245), Expect = 8e-21
 Identities = 47/58 (81%), Positives = 53/58 (91%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A+GIDLGTTYSCVG + + +VEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQ AM P
Sbjct: 18  AIGIDLGTTYSCVGWWVNERVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQAAMNP 75



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 34/51 (66%), Positives = 39/51 (76%)
 Frame = +1

Query: 358 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           D G P I+V Y GE K F P+E+SSMVLTKMKE AEA +GK V+ AVITVP
Sbjct: 94  DDGSPFIEVNYLGETKQFSPQEISSMVLTKMKEIAEAKIGKEVKKAVITVP 144



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 22/42 (52%), Positives = 26/42 (61%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG 635
           AYFNDSQR ATKDAGT     +L I +   AA+ A G +  G
Sbjct: 145 AYFNDSQRLATKDAGTYC-FPLLNITSTCAAASAATGKNNGG 185



 Score = 33.9 bits (74), Expect = 4.3
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFED 310
           +P  T+FDAKRLIGR+++D
Sbjct: 74  NPKQTVFDAKRLIGRRYDD 92


>UniRef50_A3CIL0 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 382

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 49/59 (83%), Positives = 53/59 (89%), Gaps = 2/59 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGT 680
           AYFN SQRQATKDA  I+GLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDLGGGT
Sbjct: 182 AYFNYSQRQATKDARVIAGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDLGGGT 240



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++  G K  I V YKGE+K F  EE+SSMVL KM+E AEAYLG T++ AV+TVP
Sbjct: 125 FKVIAGPGDKSMIVVQYKGEEKQFAAEEISSMVLIKMREIAEAYLGTTIKKAVVTVP 181



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/30 (60%), Positives = 25/30 (83%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           N   +AKRLIGR+F DA+VQ+D+K WPF++
Sbjct: 22  NMAENAKRLIGRRFTDASVQSDIKLWPFKV 51



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 16/26 (61%), Positives = 23/26 (88%)
 Frame = +2

Query: 275 DAKRLIGRKFEDATVQADMKHWPFEL 352
           DAKRLIG++F DA+VQ+D+  WPF++
Sbjct: 102 DAKRLIGQRFTDASVQSDIMLWPFKV 127


>UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 599

 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 51/83 (61%), Positives = 58/83 (69%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQR+ATKDAG I+GLNV+RIINEPTAAA+AYGL K+     ERN+ IFDLGGGT 
Sbjct: 124 AYFNDSQRKATKDAGAIAGLNVMRIINEPTAAALAYGLQKRANCLEERNIFIFDLGGGTF 183

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 184 DVSLLTIKNNVFVVKATAGDTHL 206



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 29/57 (50%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDGG-KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++    KP+I V YKGE+K    EE+SSMVL KM+E AE +L   ++N V+TVP
Sbjct: 67  FKVLAGSDDKPEIIVKYKGEEKHLCAEEISSMVLKKMREIAENFLESPIENVVVTVP 123



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 14/26 (53%), Positives = 22/26 (84%)
 Frame = +2

Query: 275 DAKRLIGRKFEDATVQADMKHWPFEL 352
           +AKRLIGRK+ D+ +Q D++ WPF++
Sbjct: 44  NAKRLIGRKYSDSIIQNDIQLWPFKV 69


>UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|Rep:
           Chaperone protein DnaK - Roseiflexus sp. RS-1
          Length = 624

 Score = 95.9 bits (228), Expect = 9e-19
 Identities = 51/81 (62%), Positives = 58/81 (71%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG I+GL VLRIINEPTAAA+AYGLDKK   +  +L+FDLGGGT   
Sbjct: 144 AYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKK--KDETILVFDLGGGTFDV 201

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L      +  +   GDTHL
Sbjct: 202 SVLEVGDGVVEVKATNGDTHL 222



 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           VGIDLGTT S V V + G   +I N +GNRTTPS VAFT + ERL+G  AK Q  + P  
Sbjct: 5   VGIDLGTTNSVVAVMEGGDPVVIPNAEGNRTTPSVVAFTKNGERLVGQTAKRQATINPDN 64

Query: 264 TQYSM 278
           T YS+
Sbjct: 65  TFYSI 69



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 28/60 (46%), Positives = 39/60 (65%)
 Frame = +1

Query: 331 EALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           E + F+VV  G +  ++V      K + P+E+S+MVL K+K  AEAYLG+ V  AVITVP
Sbjct: 85  EMVPFKVVK-GPRNDVRVFSPVTGKEYAPQEISAMVLQKLKTDAEAYLGEPVTKAVITVP 143



 Score = 33.9 bits (74), Expect = 4.3
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADM 331
           +P+NT +  KR IGR F++ TV+ +M
Sbjct: 61  NPDNTFYSIKRFIGRNFDETTVEREM 86


>UniRef50_A2Y4X8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 391

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 44/58 (75%), Positives = 51/58 (87%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPS+VAFTD  ERLIG+AAKNQ A  P
Sbjct: 47  IGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP 104



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 30/49 (61%), Positives = 37/49 (75%), Gaps = 1/49 (2%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYK-GEDKTFFPEEVSSMVLTKMKETAEAYLGK 480
           L F VV   GKP ++V  K G+ + F PEEVS+MVLT+MKETAEAYLG+
Sbjct: 131 LPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAMVLTRMKETAEAYLGE 179



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 27/51 (52%), Positives = 36/51 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTK 406
           +P  TI+DAKRLIGR+F DA VQ DMK  PF  +V++ N   + H+RV+ K
Sbjct: 103 NPERTIYDAKRLIGRQFSDAEVQRDMKLLPF--AVVDRN--GKPHVRVEVK 149


>UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 592

 Score = 93.1 bits (221), Expect = 7e-18
 Identities = 43/60 (71%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCV V+  +H +VEII NDQGN+TTPS+VAFTD +RL+GDAAKNQ    P
Sbjct: 9   AVGIDLGTTYSCVAVWLDEHNRVEIIHNDQGNKTTPSFVAFTDDQRLVGDAAKNQAPTNP 68



 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 35/57 (61%), Positives = 45/57 (78%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND+QR+AT DAG I+GLN++RIINEPTAAAIAYGLDK+   ++   +  + G T
Sbjct: 154 AYFNDAQRKATIDAGVIAGLNIMRIINEPTAAAIAYGLDKRTNCDKVFQVKAIAGNT 210



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 30/57 (52%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+     KP I V  KG++K    EE+SSMVLTKM++TAE +L   V+NAV+TVP
Sbjct: 97  FKVICGVNDKPMISVKCKGQEKHLCAEEISSMVLTKMRKTAEEFLELPVKNAVVTVP 153



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 22/33 (66%), Positives = 27/33 (81%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D+ VQ DM  WPF++
Sbjct: 67  NPENTVFDAKRLIGRKFGDSVVQNDMMLWPFKV 99


>UniRef50_A2Y3V8 Cluster: Putative uncharacterized protein; n=4;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 430

 Score = 92.7 bits (220), Expect = 9e-18
 Identities = 44/58 (75%), Positives = 50/58 (86%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFT   ERLIG+AAKNQ A  P
Sbjct: 42  IGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTGGGERLIGEAAKNQAAANP 99



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 35/59 (59%), Positives = 43/59 (72%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGED-KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F VV  GGKP ++V  +G D +   PEEVS+MVL +MKETAEAYLG+ V  AV+TVP
Sbjct: 126 LPFAVVDKGGKPHVRVEVRGGDVRLLSPEEVSAMVLARMKETAEAYLGEEVTRAVVTVP 184



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/37 (81%), Positives = 34/37 (91%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 620
           AYFND+QRQATKDA TI+GL V RI+NEPTAAA+AYG
Sbjct: 185 AYFNDAQRQATKDAATIAGLAVERILNEPTAAALAYG 221



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/51 (43%), Positives = 34/51 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTK 406
           +P  T++DAKRLIG +F DA VQ DM+  PF  +V++     + H+RV+ +
Sbjct: 98  NPGRTVYDAKRLIGLRFADAEVQRDMRLLPF--AVVDKG--GKPHVRVEVR 144


>UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial
           precursor; n=291; root|Rep: Stress-70 protein,
           mitochondrial precursor - Homo sapiens (Human)
          Length = 679

 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 43/57 (75%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGT
Sbjct: 195 AYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGT 249



 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPTTQY 272
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 22/36 (61%), Positives = 27/36 (75%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K + P ++ + VL KMKETAE YLG T +NAVITVP
Sbjct: 159 KLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVP 194



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKI 144


>UniRef50_UPI000058655A Cluster: PREDICTED: similar to heat shock
           protein protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 684

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 42/61 (68%), Positives = 49/61 (80%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           K+P +GIDLGT+ SCVGVFQ+G VEII ND GNRTTPS VAFTD E LIG+ A NQ++  
Sbjct: 5   KSPVIGIDLGTSCSCVGVFQNGTVEIIPNDYGNRTTPSCVAFTDREILIGEEANNQMSKN 64

Query: 258 P 260
           P
Sbjct: 65  P 65



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 34/56 (60%), Positives = 42/56 (75%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V++  GKP ++V Y G   T  PEEVSSMVLTK+KETAEAY+G+ V + VITVP
Sbjct: 94  FTVINTDGKPMLQVEYIGVTGTLSPEEVSSMVLTKLKETAEAYIGEKVTDTVITVP 149



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 23/31 (74%), Positives = 26/31 (83%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPF 346
           +P NTIFDAKRLIGR+F D  VQ+ MKHWPF
Sbjct: 64  NPKNTIFDAKRLIGRQFNDEVVQSGMKHWPF 94



 Score = 32.7 bits (71), Expect = 9.9
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTI 560
           YFND+QRQATK+AG I
Sbjct: 151 YFNDAQRQATKEAGVI 166


>UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular
           organisms|Rep: Chaperone protein dnaK1 - Streptomyces
           avermitilis
          Length = 622

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 42/57 (73%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDS+RQATK+AG I+GLNVLRI+NEPTAAA+AYGLDK    ++ +L+FDLGGGT
Sbjct: 120 AYFNDSERQATKEAGEIAGLNVLRIVNEPTAAALAYGLDK---DDQTILVFDLGGGT 173



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 1/56 (1%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 245
           A AVGIDLGTT S V V + G+  +I N +G RTTPS VAF  + E L+G+ AK Q
Sbjct: 2   ARAVGIDLGTTNSVVSVLEGGEPTVITNAEGARTTPSVVAFAKNGEVLVGEVAKRQ 57



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/38 (52%), Positives = 29/38 (76%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + K F P+++S+ +L K+K  AEAYLG+ V +AVITVP
Sbjct: 82  DGKDFNPQQMSAFILQKLKRDAEAYLGEKVTDAVITVP 119


>UniRef50_A7HBX9 Cluster: 2-alkenal reductase precursor; n=7;
           Cystobacterineae|Rep: 2-alkenal reductase precursor -
           Anaeromyxobacter sp. Fw109-5
          Length = 542

 Score = 90.6 bits (215), Expect = 4e-17
 Identities = 63/201 (31%), Positives = 103/201 (51%), Gaps = 2/201 (0%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           P +GIDLGTT +CV   +    +++  D+GN   P+ VA +D  + L+G+ AK+Q+   P
Sbjct: 8   PVLGIDLGTTNACVAHVRSRIPKVVPTDRGNLILPTVVALSDRGDLLVGNVAKDQLVTNP 67

Query: 261 -TTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFHG 437
             T Y    +     S  ++ +          +      D   + G      P  S    
Sbjct: 68  KNTIYGAKRLIGRKWSSRVVQELRNYYSYDIVE--GPNGDAAVMLGGEVRTLPEISAMVL 125

Query: 438 AYENEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
           A+  +   + L  ++  E      AY++D+QRQA ++AG ++G  V RI+NEPTAAA+AY
Sbjct: 126 AHVRKIAGQFLQ-KDVDEAVISVPAYYSDAQRQAVREAGKLAGFEVRRIVNEPTAAALAY 184

Query: 618 GLDKKGTGERNVLIFDLGGGT 680
           G  +    ++ +L++DLGGGT
Sbjct: 185 GFGR--ALDQKILVYDLGGGT 203



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTI+ AKRLIGRK+    VQ    ++ +++
Sbjct: 66  NPKNTIYGAKRLIGRKWSSRVVQELRNYYSYDI 98


>UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular
           organisms|Rep: Chaperone protein dnaK - Lactobacillus
           johnsonii
          Length = 624

 Score = 90.6 bits (215), Expect = 4e-17
 Identities = 43/57 (75%), Positives = 50/57 (87%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND+QRQATKDAG I+GLNV RIINEPTA+A+AYGLDK    E+ VL++DLGGGT
Sbjct: 119 AYFNDAQRQATKDAGKIAGLNVQRIINEPTASALAYGLDKDENDEK-VLVYDLGGGT 174



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 31/63 (49%), Positives = 40/63 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GIDLGTT S V V +  + +II N +GNRTTPS VAF + E  +G+ AK Q    P T 
Sbjct: 5   IGIDLGTTNSAVAVLEGKEPKIITNPEGNRTTPSVVAFKNGEIQVGEVAKRQAITNPNTI 64

Query: 270 YSM 278
            S+
Sbjct: 65  VSI 67



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 18/37 (48%), Positives = 28/37 (75%)
 Frame = +1

Query: 400 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           DK + P+E+S+ +L  +K+ +E YLG+ V +AVITVP
Sbjct: 82  DKEYTPQEISAFILQYIKKFSEDYLGEKVTDAVITVP 118


>UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3;
           Planctomycetaceae|Rep: Chaperone protein dnaK -
           Rhodopirellula baltica
          Length = 645

 Score = 90.2 bits (214), Expect = 5e-17
 Identities = 42/57 (73%), Positives = 50/57 (87%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND+QRQATKDAG I+GL V RIINEPTAAA+AYGLDKK   + ++++FDLGGGT
Sbjct: 145 AYFNDAQRQATKDAGQIAGLEVARIINEPTAAALAYGLDKK--KDESIIVFDLGGGT 199



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMTP-T 263
           +GIDLGTT S V + +  + ++I N +GNR TPS VAFTD  E ++G+ A+ Q    P  
Sbjct: 8   IGIDLGTTNSVVAIMEGSEPKVIPNPEGNRLTPSVVAFTDKQETIVGEPARRQAVTNPKR 67

Query: 264 TQYS 275
           T YS
Sbjct: 68  TVYS 71



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/49 (48%), Positives = 32/49 (65%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G P   V  +  D  + P+E+S+ VL K+KE+AE+YLG  V  AVITVP
Sbjct: 96  GGPGDYVKIQVGDSEYTPQEISAKVLRKLKESAESYLGHKVNKAVITVP 144


>UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Rep:
           Heat shock protein 70 - Acidobacteria bacterium (strain
           Ellin345)
          Length = 634

 Score = 89.8 bits (213), Expect = 6e-17
 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL VLR++NEPTAA++AYGLDKK  G   V ++DLGGGT   
Sbjct: 146 AYFNDAQRQATKDAGRIAGLEVLRLVNEPTAASLAYGLDKKRNG--TVAVYDLGGGTFDI 203

Query: 690 PSLPSRRYLRGEIH-RGDTHL 749
             L     +   +   GDTHL
Sbjct: 204 SILKLHDGIFEVMSTNGDTHL 224



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/56 (41%), Positives = 34/56 (60%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           FRV  D    ++   + GE +T+ P E+S+ +L ++K+ AE Y G  V  AVITVP
Sbjct: 91  FRVADDLAAGEVIRIHLGE-RTYTPPEISAFILRQLKKNAERYFGAPVTKAVITVP 145



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI-GDAAKNQV 248
           MA+   VGIDLGTT S V   +  +  +I  + G    PS VA     ++I G+AA+  +
Sbjct: 1   MAEERVVGIDLGTTNSLVAYMEGDRPVVIPGEDGANLVPSIVALDPAAQIIVGNAARKYL 60

Query: 249 AMTP 260
             TP
Sbjct: 61  IETP 64


>UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 603

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 47/82 (57%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT--S 683
           AYFNDSQR++TK+AG I+G +V+RIINEPTAAAIAYG ++    + NVL+FDLGGGT   
Sbjct: 145 AYFNDSQRESTKNAGKIAGFDVMRIINEPTAAAIAYGFEQNIKEKSNVLVFDLGGGTFDV 204

Query: 684 TCPSLPSRRYLRGEIHRGDTHL 749
           T  S+ +  Y +     GDTHL
Sbjct: 205 TLLSIDNGEY-KVIATDGDTHL 225



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 2/53 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG--KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           +GIDLGTT+SC+ V++    +VEII N QG  TTPS VAFTD +RLIG+ A N
Sbjct: 5   IGIDLGTTFSCMAVWKESSKRVEIITNRQGKETTPSVVAFTDKQRLIGEEAIN 57



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)
 Frame = +1

Query: 352 VSDGGK--PKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + D GK  P I+V Y      F PE++S+M+L + KE A   +G+ V+ A+ITVP
Sbjct: 90  IKDNGKNEPIIEVPYMSVLSAFRPEDISAMLLRRFKEIASDAMGRDVKKAIITVP 144



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 13/28 (46%), Positives = 20/28 (71%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +FD KRLIGRK+ D  +Q D+K+  + +
Sbjct: 63  VFDVKRLIGRKYNDPELQKDLKYITYSI 90


>UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 70;
           n=11; Entamoeba histolytica|Rep: Mitochondrial-type heat
           shock protein 70 - Entamoeba histolytica
          Length = 598

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 40/58 (68%), Positives = 50/58 (86%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 680
           AYFND+QRQATKDAGT++GL V RIINEPTAAA+AYG+D +   E +N+ ++DLGGGT
Sbjct: 146 AYFNDAQRQATKDAGTLAGLKVKRIINEPTAAALAYGIDTRKENEGKNIAVYDLGGGT 203



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 34/67 (50%), Positives = 44/67 (65%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A++  +GIDLGTT SC+ VF      I+ N +G RTTPS V+FT T  L+G+AAK   A+
Sbjct: 7   ARSTCIGIDLGTTNSCMCVFDKTTPRILENAEGKRTTPSCVSFTPTGILVGEAAKRMEAL 66

Query: 255 TPTTQYS 275
            PTT  S
Sbjct: 67  HPTTTVS 73



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/36 (58%), Positives = 26/36 (72%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           KT+ P E+SS +L K+K+ AEA LGK V  AVIT P
Sbjct: 110 KTYSPSEISSFILKKLKKDAEAKLGKRVDEAVITCP 145


>UniRef50_A2WTX8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 359

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 37/60 (61%), Positives = 46/60 (76%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           P +GIDLGT  SCV V+Q+G+ EI+ N+ G R TPSY AFTD ERL+GDAAK+Q +  PT
Sbjct: 60  PVIGIDLGTACSCVAVWQNGRAEIVTNEHGGRATPSYAAFTDAERLVGDAAKSQASRNPT 119



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
 Frame = +1

Query: 343 FRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTS 519
           F+VV   G KP +  +YKG+ K    EEV+SM+L+KMK  AEAY+G  V+NAV+TVP + 
Sbjct: 147 FKVVPGRGDKPMVAASYKGKQKLLAAEEVASMLLSKMKAEAEAYIGGPVKNAVVTVPASF 206

Query: 520 MTLKDKPQK 546
             L+ +  K
Sbjct: 207 DVLQRRATK 215



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 18/33 (54%), Positives = 26/33 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+F  KRL+GR+F DA+VQ  +K WPF++
Sbjct: 117 NPTNTVFATKRLMGRRFSDASVQDGLKLWPFKV 149


>UniRef50_A0DHP4 Cluster: Chromosome undetermined scaffold_50, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_50,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 598

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 42/57 (73%), Positives = 50/57 (87%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFN++QRQATKDAG I+GLNV+RI+NEPTAAAIAYG  K+   E N++IFDLGGGT
Sbjct: 167 AYFNNAQRQATKDAGAIAGLNVVRILNEPTAAAIAYGFSKRKLKE-NLVIFDLGGGT 222



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 36/66 (54%), Positives = 47/66 (71%), Gaps = 1/66 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           P +GIDLGT  SCVG+F++G VEII N++G R TPS VAFTD   +IG  A NQ  + P+
Sbjct: 22  PIIGIDLGTKNSCVGIFRNGNVEIIPNEEGKRKTPSVVAFTDKGLIIGKEANNQAIINPS 81

Query: 264 -TQYSM 278
            T Y++
Sbjct: 82  RTLYNI 87



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 31/60 (51%), Positives = 40/60 (66%), Gaps = 2/60 (3%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVA-YKG-EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + + +V    KP+I V   KG   K F PEE+S+MVL KMKE +E YL + V+NAVITVP
Sbjct: 107 MPYEIVELDDKPQIMVQNIKGFSSKMFAPEEISAMVLMKMKEISETYLKREVENAVITVP 166



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 16/33 (48%), Positives = 25/33 (75%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P+ T+++ KRL+GRKF D +VQ D K  P+E+
Sbjct: 79  NPSRTLYNIKRLMGRKFADPSVQNDRKFMPYEI 111


>UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole genome
           shotgun sequence; n=3; core eudicotyledons|Rep:
           Chromosome chr18 scaffold_24, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 667

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 41/57 (71%), Positives = 47/57 (82%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG +KK      +L+FDLGGGT
Sbjct: 177 AYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKK--NNETILVFDLGGGT 231



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +3

Query: 66  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKN 242
           + +     VGIDLGTT S V   + GK  I+ N +G RTTPS VA+T + + L+G  AK 
Sbjct: 53  FHVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKNGDMLVGQIAKR 112

Query: 243 QVAMTPTTQY 272
           Q  + P   +
Sbjct: 113 QAVVNPENTF 122


>UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular
           organisms|Rep: Chaperone protein dnaK - Brucella
           melitensis
          Length = 637

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 41/57 (71%), Positives = 49/57 (85%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND+QRQATKDAG I+GL VLRIINEPTAAA+AYGLDK  +  + + ++DLGGGT
Sbjct: 144 AYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDK--SEGKTIAVYDLGGGT 198



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 31/61 (50%), Positives = 37/61 (60%), Gaps = 1/61 (1%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMT 257
           A  +GID+GTT SCV V      ++I N +G RTTPS +AFTD  ERL G  AK Q    
Sbjct: 2   AKVIGIDMGTTNSCVAVMDGKNAKVIENAEGARTTPSIIAFTDGDERLAGQPAKRQAVTN 61

Query: 258 P 260
           P
Sbjct: 62  P 62



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 23/36 (63%), Positives = 30/36 (83%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K + P ++S+M+L KMKETAE+YLG+TV  AVITVP
Sbjct: 108 KKYSPSQISAMILQKMKETAESYLGETVTQAVITVP 143



 Score = 33.1 bits (72), Expect = 7.5
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P  T+F  KRLIGR+++D  V  D    P+++
Sbjct: 61  NPEGTLFAVKRLIGRRYDDPMVTKDKDLVPYKI 93


>UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellular
           organisms|Rep: Chaperone protein dnaK3 - Synechocystis
           sp. (strain PCC 6803)
          Length = 771

 Score = 86.2 bits (204), Expect = 8e-16
 Identities = 41/57 (71%), Positives = 49/57 (85%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQAT+DAG I+GL VLRIINEPTAA++AYGLD+     + +L+FDLGGGT
Sbjct: 144 AYFNDSQRQATRDAGKIAGLEVLRIINEPTAASLAYGLDQGRI--QKILVFDLGGGT 198



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPTT 266
           VGIDLGTT S V V + GK  +IAN +G RTTPS V F  + E ++G   + Q  + P  
Sbjct: 5   VGIDLGTTNSVVAVMEGGKPIVIANAEGMRTTPSVVGFNKEGELVVGQMGRRQAVLNPQN 64

Query: 267 QY 272
            +
Sbjct: 65  TF 66



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/48 (50%), Positives = 30/48 (62%)
 Frame = +1

Query: 367 KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +  IKV      K F PEE+S+M+L K+ E A  YLG+ V  AVITVP
Sbjct: 96  RDNIKVRCPRLKKDFAPEEISAMILRKLAEEASRYLGEKVTGAVITVP 143


>UniRef50_O88687 Cluster: Heat shock protein 70; n=2;
           Euteleostomi|Rep: Heat shock protein 70 - Mus musculus
           (Mouse)
          Length = 43

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 39/43 (90%), Positives = 40/43 (93%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVA 200
           MAK  A+GIDLGTTYSCVGV QHGKVEIIANDQGNRTTPSYVA
Sbjct: 1   MAKNTAIGIDLGTTYSCVGVLQHGKVEIIANDQGNRTTPSYVA 43


>UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonospora
           locustae|Rep: Mitochondrial-type HSP70 - Antonospora
           locustae (Nosema locustae)
          Length = 622

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 40/57 (70%), Positives = 47/57 (82%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQATKDAG ++GL VLR+INEPTAAA+AYGL +   G   + +FDLGGGT
Sbjct: 175 AYFNDSQRQATKDAGRLAGLKVLRVINEPTAAALAYGLGRTENG--TIAVFDLGGGT 229



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 209
           ++ K+  +GIDLGTT SCV V +    +II N  G RTTPS V F D
Sbjct: 34  EVEKSTIIGIDLGTTNSCVSVIKDRYPKIIRNRTGKRTTPSTVTFGD 80



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSP 418
           DP  T+F  KRLIGRKFED  +Q  ++  P++ +V   N  +   I+V  + FSP
Sbjct: 92  DPGATVFGTKRLIGRKFEDPEIQKYIQKLPYK-TVSHVNGDA--WIKVSDRMFSP 143



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
 Frame = +1

Query: 331 EALAFRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           + L ++ VS   G   IKV+    D+ F P ++++ +LT++K  AE +L   V  +VITV
Sbjct: 118 QKLPYKTVSHVNGDAWIKVS----DRMFSPSQIAAYILTELKRCAEDFLKSPVSKSVITV 173

Query: 508 P 510
           P
Sbjct: 174 P 174


>UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 946

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG-LDKKGTGERNVLIFDLGGGT 680
           AYFNDSQR+ATK AG I+GLNVL IINEPTAAA+AYG  + K   ERN+L++DLGGGT
Sbjct: 146 AYFNDSQRKATKAAGEIAGLNVLGIINEPTAAALAYGQSNNKDCKERNLLVYDLGGGT 203



 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 35/59 (59%), Positives = 43/59 (72%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           P +GIDLGTT SCV VF + KVE+IAN  G+R TPS V+F D E +IG+ AKNQ+   P
Sbjct: 4   PVIGIDLGTTNSCVAVFNN-KVEVIANVLGSRITPSCVSFDDNETIIGEGAKNQLGKNP 61



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 32/56 (57%), Positives = 41/56 (73%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV+  GKP I+V YK E +T  PEE+S+MVL  +K TAE YLG  V++ VITVP
Sbjct: 90  FKVVNRNGKPFIQVQYKKEIRTLPPEEISAMVLESVKCTAEEYLGVKVEDVVITVP 145



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 248 GDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           G +P NT++  KRLIGR F+D  VQ D+ H+ F++
Sbjct: 58  GKNPENTVYGTKRLIGRDFDDPEVQHDITHFLFKV 92


>UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial
           precursor; n=18; Ascomycota|Rep: Heat shock protein
           SSQ1, mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 657

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 44/81 (54%), Positives = 54/81 (66%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG ++GLNVLR+INEPTAAA+++G+D K      + ++DLGGGT   
Sbjct: 184 AYFNDSQRQATKDAGKLAGLNVLRVINEPTAAALSFGIDDK-RNNGLIAVYDLGGGTFDI 242

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 243 SILDIEDGVFEVRATNGDTHL 263



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 5/81 (6%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGK----VEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAM 254
           +GIDLGTT S V   +         II ND+G RTTPS VAF   +     D  K  V M
Sbjct: 31  IGIDLGTTNSAVAYIRDSNDKKSATIIENDEGQRTTPSIVAFDVKSSPQNKDQMKTLVGM 90

Query: 255 TPTTQYSMPNVSSDVSSKMLL 317
               Q ++ + ++  ++K L+
Sbjct: 91  AAKRQNAINSENTFFATKRLI 111



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEAN 370
           NT F  KRLIGR F D  VQ DM   P+++   E+N
Sbjct: 102 NTFFATKRLIGRAFNDKEVQRDMAVMPYKIVKCESN 137



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 16/32 (50%), Positives = 25/32 (78%)
 Frame = +1

Query: 415 PEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           P +++S++L  +K+T+E YLG+ V  AVITVP
Sbjct: 152 PSQIASILLKYLKQTSEEYLGEKVNLAVITVP 183


>UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38;
           Bacteria|Rep: Chaperone protein dnaK - Ureaplasma parvum
           (Ureaplasma urealyticum biotype 1)
          Length = 603

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 40/57 (70%), Positives = 50/57 (87%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+D+QRQATK+AG I+GL+V RIINEPTAAA+AYG+DK    E+ +L+FDLGGGT
Sbjct: 120 AYFDDAQRQATKNAGIIAGLSVERIINEPTAAALAYGIDKLDK-EQKILVFDLGGGT 175



 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 32/65 (49%), Positives = 41/65 (63%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAK   +GIDLGTT SCV V ++ K  ++ N +G RT PS V+F   E L+GDAAK +  
Sbjct: 1   MAKEIILGIDLGTTNSCVAVIENKKPIVLENPEGKRTVPSVVSFNGDEVLVGDAAKRKQI 60

Query: 252 MTPTT 266
             P T
Sbjct: 61  TNPNT 65



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +1

Query: 361 GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G K K+ V     +K + PEE+S+ +LT +KE AE  +G  V  AVITVP
Sbjct: 74  GTKEKVTVL----NKDYTPEEISAKILTYIKEYAEKKIGAKVNKAVITVP 119


>UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum
           ferrooxidans|Rep: HscA chaperone - Leptospirillum
           ferrooxidans
          Length = 588

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 46/82 (56%), Positives = 57/82 (69%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV-LIFDLGGGTST 686
           AYFND+QRQATKDAG ++GLNVLRI+NEPT+AA+AYG    G G+  +  ++DLGGGT  
Sbjct: 124 AYFNDAQRQATKDAGEMAGLNVLRILNEPTSAALAYGF---GAGKDGLYAVYDLGGGTFD 180

Query: 687 CPSLPSRR-YLRGEIHRGDTHL 749
              L  RR     +   GDTHL
Sbjct: 181 FSLLSIRRGVFEVKATSGDTHL 202



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 20/58 (34%), Positives = 36/58 (62%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           LA+ V +  G P I   ++   +     ++ +M+L+++++ AE  LG+TV +AVITVP
Sbjct: 68  LAYPVENVDGLPLIPDPFR--KRHLSAPQIGAMILSELRKRAEVALGQTVTDAVITVP 123


>UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella
           natans|Rep: Chaperone HSP70 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 610

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLD--KKGTGERNVLIFDLGGGT 680
           AYFND QR ATKDAG ++ L V RI+NEPTAA IAYG+D  KK + ER+VLIFDLGGGT
Sbjct: 130 AYFNDGQRIATKDAGALAELKVNRIVNEPTAACIAYGMDRTKKQSRERSVLIFDLGGGT 188



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 25/40 (62%), Positives = 32/40 (80%)
 Frame = +3

Query: 144 KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           KV+II+N+ GNRTT S VAFTD ++L+GDAAKNQ    P+
Sbjct: 6   KVQIISNEAGNRTTASVVAFTDDDKLVGDAAKNQAIFHPS 45



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 21/57 (36%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFE-LSVMEANLRSR*HIRVKTKPFSPRK 424
           P+  ++D+KR++G+K+ D T+Q DMK WPF+ L   + ++     I+ +T+ FSP +
Sbjct: 44  PSQVVYDSKRMLGKKYNDETIQDDMKTWPFKVLQGPKESILISVQIKGETREFSPEQ 100



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/45 (48%), Positives = 30/45 (66%)
 Frame = +1

Query: 376 IKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           I V  KGE + F PE++SS+VL KM+E  E +  K + + VITVP
Sbjct: 85  ISVQIKGETREFSPEQISSIVLRKMREIGENFTLKPINDVVITVP 129


>UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep:
           GLP_623_6850_8883 - Giardia lamblia ATCC 50803
          Length = 677

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 41/61 (67%), Positives = 53/61 (86%), Gaps = 4/61 (6%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGE-RNVLIFDLGGG 677
           AYF+DSQR ATKDAG I+GL+V+RIINEPT+++IAYGLDKK    +G+ +N+L+FD GGG
Sbjct: 178 AYFSDSQRSATKDAGRIAGLDVVRIINEPTSSSIAYGLDKKTQETSGKAKNILVFDCGGG 237

Query: 678 T 680
           T
Sbjct: 238 T 238



 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCV V + G+VEII N+ G R TPSYVAFT D ERL+GDAAKN   ++P
Sbjct: 31  IGIDLGTTYSCVAVSRAGQVEIIPNELGARVTPSYVAFTADGERLVGDAAKNYAPISP 88



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 26/63 (41%), Positives = 42/63 (66%), Gaps = 5/63 (7%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKG-----EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVI 501
           L ++V++  G+P ++++        ++K   PEE+S+MVLTKMK  AE YLG+ +  AV+
Sbjct: 115 LPYKVINKDGRPFVQLSGTNLPKELQNKIMSPEEISAMVLTKMKTIAEDYLGEKITKAVV 174

Query: 502 TVP 510
           TVP
Sbjct: 175 TVP 177



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/32 (65%), Positives = 25/32 (78%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           P NTIFD KRLIGRKF+D  VQ DMK  P+++
Sbjct: 88  PENTIFDVKRLIGRKFDDPEVQKDMKLLPYKV 119


>UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2;
           Ostreococcus|Rep: Heat Shock Protein 70, cytosolic -
           Ostreococcus lucimarinus CCE9901
          Length = 711

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 7/87 (8%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--GTGE--RN--VLIFDLG 671
           AYFND+QR+ TKDAG I+GL+VLRIINEPTAAA+AYGLD++    GE  +N  +L+FDLG
Sbjct: 312 AYFNDAQRRQTKDAGAIAGLDVLRIINEPTAAALAYGLDRREGENGEVIKNQCILVFDLG 371

Query: 672 GGTSTCPSLPSRRYLRGEIH-RGDTHL 749
           GGT     L  +  +   +   GDTHL
Sbjct: 372 GGTFDVSLLNLQDGVFEVLSTAGDTHL 398



 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 34/57 (59%), Positives = 47/57 (82%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCV V+++G+  ++ N +G+RTTPS+VAFT+  RL+GDAAK Q A+ P
Sbjct: 172 IGIDLGTTYSCVSVWRNGEAHVLTNAEGDRTTPSWVAFTEQGRLVGDAAKRQAAINP 228



 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 1/66 (1%)
 Frame = +1

Query: 316 CASRHEALAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQN 492
           CA   E + F V   +GGKP + V   GE K F PE++S+MVL KMK TAEA LG  +  
Sbjct: 246 CAHELELMPFDVKEGEGGKPIVSVDVNGEKKDFAPEQISAMVLQKMKATAEAQLGVPITK 305

Query: 493 AVITVP 510
           AV+TVP
Sbjct: 306 AVVTVP 311


>UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 593

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 41/57 (71%), Positives = 47/57 (82%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A FND QRQATKDA  I+GLNV RIINEPTAAA++YG+DKK     NVL++DLGGGT
Sbjct: 141 ATFNDKQRQATKDAALIAGLNVKRIINEPTAAALSYGIDKK-QETLNVLVYDLGGGT 196



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 37/59 (62%), Positives = 44/59 (74%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           A+GIDLGTTYSCVGVF++ +VEII N+ G RTTPS VAF      IG+AA N+ A  PT
Sbjct: 4   AIGIDLGTTYSCVGVFRNQRVEIIPNELGKRTTPSCVAFNSFHTHIGEAAVNERAENPT 62



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 25/47 (53%), Positives = 34/47 (72%)
 Frame = +1

Query: 376 IKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRT 516
           IKV++ G+ +   PE +S+M+L K+K  AE YLG  V+NAVITVP T
Sbjct: 96  IKVSFNGKKRKLKPELISAMILRKLKTDAEIYLGADVKNAVITVPAT 142


>UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular
           organisms|Rep: Chaperone protein dnaK - Chlamydophila
           caviae
          Length = 664

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 39/57 (68%), Positives = 48/57 (84%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQR +TKDAG I+GL+V RII EPTAAA+AYG+DK   G++ + +FDLGGGT
Sbjct: 147 AYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDK--AGDKKIAVFDLGGGT 201



 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 29/57 (50%), Positives = 37/57 (64%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTT SCV V + G+ ++I + +G RTTPS VAF   E L+G  AK Q    P
Sbjct: 11  IGIDLGTTNSCVSVMEGGQAKVITSSEGTRTTPSIVAFKGNETLVGIPAKRQAVTNP 67



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 25/43 (58%), Positives = 31/43 (72%)
 Frame = +1

Query: 382 VAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           V +  + K + PEE+ + VL KMKETAEAYLG+ V  AVITVP
Sbjct: 104 VVFLVDGKQYTPEEIGAQVLIKMKETAEAYLGEPVTEAVITVP 146


>UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:
           2-alkenal reductase - Anaeromyxobacter sp. Fw109-5
          Length = 623

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 45/81 (55%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND QRQATKDAG I+GL VLRI+NEPTAAA+AYG  ++   +  V++FDLGGGT   
Sbjct: 148 AYFNDGQRQATKDAGRIAGLEVLRIVNEPTAAALAYGFGRQVRSK--VVVFDLGGGTFDV 205

Query: 690 PSLPSRRYLRGEIH-RGDTHL 749
             L   R +   +   GDT+L
Sbjct: 206 SVLDVGRSVYDVVAVGGDTYL 226



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/60 (45%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           P VGIDLGTT S V   Q G   +I    G   TPS VA   +  RL+G  AK Q    P
Sbjct: 6   PVVGIDLGTTNSVVATVQDGVPRVIPGRTGQPLTPSVVAVAKNGRRLVGALAKRQAITNP 65



 Score = 40.3 bits (90), Expect = 0.049
 Identities = 22/60 (36%), Positives = 37/60 (61%)
 Frame = +1

Query: 331 EALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +AL + +V+      ++V   G   +    E+S++VL ++K  AEA+LGK V+ AV+TVP
Sbjct: 90  KALPYELVAGPEGNDVRVQLGGRAVSM--PELSALVLAELKADAEAFLGKPVRRAVVTVP 147



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P  T+F AKRLIGR++  + V+   K  P+EL
Sbjct: 64  NPEGTVFAAKRLIGRRWGSSEVEDARKALPYEL 96


>UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter sp.
           BAL39|Rep: Heat shock protein 70 - Pedobacter sp. BAL39
          Length = 617

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 35/57 (61%), Positives = 48/57 (84%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQRQAT+DAG ++GL+VLRI+NEPTAA++AYG+      ++ + ++DLGGGT
Sbjct: 159 AYFNDSQRQATRDAGKLAGLDVLRIVNEPTAASLAYGIGLDPNKQQTIAVYDLGGGT 215



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = +1

Query: 319 ASRHEALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAV 498
           A+  +  +++++ D     +K+  K  DK + P E+S+ +L ++K  AE  L   V  AV
Sbjct: 97  AAHQDTFSYKIIDDENDTLVKI--KAGDKFYTPIELSAEILKELKGRAEHALKTPVNRAV 154

Query: 499 ITVP 510
           ITVP
Sbjct: 155 ITVP 158



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 23/59 (38%), Positives = 29/59 (49%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQG-NRTTPSYVAF-TDTERLIGDAAKNQVAMTP 260
           VGIDLGTT S V      K+  + ND G     PS V F    + L+G+ AK  +   P
Sbjct: 20  VGIDLGTTNSLVAFINPDKLPQVINDTGKGLLVPSVVHFNAHGDTLVGNEAKEFLITDP 78



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQAD 328
           DP NTIF  KRL+GR ++D     D
Sbjct: 77  DPANTIFSVKRLLGRSYKDLAAHQD 101


>UniRef50_Q73CC4 Cluster: Dnak protein, truncation; n=1; Bacillus
           cereus ATCC 10987|Rep: Dnak protein, truncation -
           Bacillus cereus (strain ATCC 10987)
          Length = 505

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 36/57 (63%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+D+QR+AT+DAG I+GL+VL++INEPTAAA+AYGL  +   ++NV+++DLGGGT
Sbjct: 119 AYFDDAQRKATQDAGRIAGLHVLKVINEPTAAALAYGLANR-EQKQNVMVYDLGGGT 174



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           +GIDLGTT S V  +   G   I+ N +G R TPS + F D   +IG  AK+     PT
Sbjct: 3   IGIDLGTTNSAVAYIDDSGNPTILPNREGERVTPSVIFFEDGSPVIGSTAKSISVSDPT 61



 Score = 40.3 bits (90), Expect = 0.049
 Identities = 21/49 (42%), Positives = 29/49 (59%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G    K    GE   F PE++S+++L ++KE AE  +G  V  AVITVP
Sbjct: 72  GNASYKFPIGGE--VFTPEDLSALILKRLKEDAEEAIGAKVTKAVITVP 118


>UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodospira
           halophila SL1|Rep: Heat shock protein 70 -
           Halorhodospira halophila (strain DSM 244 / SL1)
           (Ectothiorhodospirahalophila (strain DSM 244 / SL1))
          Length = 577

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 37/57 (64%), Positives = 49/57 (85%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+D+QRQAT+DAGT++GL V+RIINEPTAAA+AY  D+     R++L++DLGGGT
Sbjct: 120 AYFSDAQRQATRDAGTLAGLEVVRIINEPTAAALAYESDQ--AERRHILVYDLGGGT 174



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 17/37 (45%), Positives = 30/37 (81%)
 Frame = +1

Query: 400 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           D+++ P+E+S+++L ++K+ AE  LG+ V+ AVITVP
Sbjct: 83  DRSYTPQEISAVILARLKQAAEVQLGEPVRKAVITVP 119



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           +GIDLGTT S V V ++G+V++I  +      PS V   +    L+G AA+NQ+A+ P
Sbjct: 6   IGIDLGTTNSEVAVVRNGQVQLIEVEDA-YLMPSAVGLDEEGGLLVGYAARNQLALHP 62


>UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 607

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 42/81 (51%), Positives = 55/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFN +QR+AT++A  I+GL VLRI+NEPTAAAIAY L  +    RN+LI+DLGGGT   
Sbjct: 145 AYFNATQRRATEEAAEIAGLKVLRILNEPTAAAIAYSLKGQRLSRRNILIYDLGGGTFDV 204

Query: 690 PSL-PSRRYLRGEIHRGDTHL 749
            ++      +  +   GDTHL
Sbjct: 205 AAVNVDGPRITVKAKGGDTHL 225



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/68 (41%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTPT 263
           ++GIDLGTT+SCV  +Q+G+V I+ N+ G RTTPS +A   D + LIG  AK+ +     
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKDVIGKATN 61

Query: 264 TQYSMPNV 287
           + + +  +
Sbjct: 62  SLFDVKRI 69



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 15/30 (50%), Positives = 24/30 (80%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           N++FD KR+IGR+++D  +Q DM  WPF++
Sbjct: 61  NSLFDVKRIIGRRYDDVLLQRDMPLWPFKV 90



 Score = 36.3 bits (80), Expect = 0.81
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +1

Query: 358 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           D G P +++    +   F    VSS++L  +K  AE  LG  V++AVITVP
Sbjct: 94  DNGIPYLEIHKNEKPLKFSAVTVSSLILRCLKYNAERKLGLEVKSAVITVP 144


>UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2;
           Gammaproteobacteria|Rep: Molecular chaperone HscA -
           Vesicomyosocius okutanii subsp. Calyptogena okutanii
           (strain HA)
          Length = 614

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 39/58 (67%), Positives = 48/58 (82%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV-LIFDLGGGT 680
           AYFND+QRQATKDA T++GL  LR++NEPTAAA+AYGL+   +GE  V  I+DLGGGT
Sbjct: 157 AYFNDAQRQATKDAATLAGLKTLRLLNEPTAAAVAYGLE---SGEEGVHAIYDLGGGT 211


>UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n=2;
           Cystobacterineae|Rep: Heat shock protein 70 family
           protein - Myxococcus xanthus (strain DK 1622)
          Length = 535

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 37/57 (64%), Positives = 47/57 (82%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND+QRQATKDAG I+G+ VLRI+NEPTAAA+AYG  +     + V+++DLGGGT
Sbjct: 146 AYFNDNQRQATKDAGRIAGMEVLRILNEPTAAALAYGFGR--DVNQRVVVYDLGGGT 200



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 2/70 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQV 248
           MA   A+GIDLGT++SCV V Q G+  +I N+ G  T  S V+F  D   L+G+AAK  +
Sbjct: 1   MADDIAIGIDLGTSFSCVAVVQDGQPTVIPNEWGETTHASCVSFLEDGSVLVGNAAKKNI 60

Query: 249 AMTP-TTQYS 275
              P  T YS
Sbjct: 61  ITNPEQTVYS 70



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 20/58 (34%), Positives = 37/58 (63%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + +R+V +G    +++A    + ++   E+S++VL ++K  AE YLG+ V  AV+TVP
Sbjct: 91  MPYRIV-EGDNNSVRIAMN--EHSYSLPEISALVLKELKAVAETYLGQEVTKAVVTVP 145


>UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila
           auraria|Rep: LAC ORF protein - Drosophila auraria (Fruit
           fly)
          Length = 613

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 38/62 (61%), Positives = 47/62 (75%), Gaps = 3/62 (4%)
 Frame = -2

Query: 254 HRHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDS---YCG 84
           HRHLVLG ++D+TLGVCE ++   G VALVVGDDLHL +L D +A VRG Q+DS   +C 
Sbjct: 551 HRHLVLGRVADQTLGVCECHVGGRGAVALVVGDDLHLSMLVDAHAGVRGAQVDSNGRHCV 610

Query: 83  CF 78
           CF
Sbjct: 611 CF 612



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = -2

Query: 674 AAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEVRG 507
           AA+V+D++++    + V+ V        +DD E+VQ  D   +  GL+LRV+EV G
Sbjct: 410 AAQVEDEHVALPLEVLVQPVGQCRRRGLVDDPEHVQPGDAAGVLGGLALRVVEVGG 465



 Score = 32.7 bits (71), Expect = 9.9
 Identities = 15/54 (27%), Positives = 26/54 (48%)
 Frame = -1

Query: 501 DNCILHSFAKISFGSFLHFRKHHGTDFLGEKGFVFTLICYLDLRFASITDNSKG 340
           D+ +    A+I      H  +HH  DFLG +     L  + DL  +++ D+ +G
Sbjct: 468 DDRVRDRLAQIGLRRLPHLDQHHRADFLGGEALGLALELHADLGLSAVADHLEG 521


>UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27;
           Proteobacteria|Rep: Chaperone protein hscA homolog -
           Burkholderia mallei (Pseudomonas mallei)
          Length = 622

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 38/57 (66%), Positives = 46/57 (80%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+D+QRQATKDA  ++GLNVLR++NEPTAAAIAYGLD    G     ++DLGGGT
Sbjct: 157 AYFDDAQRQATKDAARLAGLNVLRLLNEPTAAAIAYGLDNGAEG--LYAVYDLGGGT 211



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 26/59 (44%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           AVGIDLGTT S V   ++   E + +D G    PS V + D   R IG AAK + A+ P
Sbjct: 21  AVGIDLGTTNSLVAAVRNSIPEALPDDAGRVLLPSVVRYLDKGGRRIGHAAKEEAAIDP 79


>UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep:
           Heat shock protein 70 - Frankia sp. (strain CcI3)
          Length = 556

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 36/57 (63%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF D +R+ATK AG ++GLNV+ IINEPTAAA AYG  + G  E  VL++DLGGGT
Sbjct: 128 AYFGDEERKATKLAGELAGLNVVDIINEPTAAAFAYGFGQDGAEESTVLVYDLGGGT 184



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 6/69 (8%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFT-----DTERLIGDA 233
           MA     GIDLGTTYSC+  V ++G+ E+I N +   TTPS V F       T  ++G  
Sbjct: 1   MAGTKVFGIDLGTTYSCIAQVDEYGRPEVIRNIESQPTTPSVVLFDTGAEGPTSFVVGTQ 60

Query: 234 AKNQVAMTP 260
           AK Q  + P
Sbjct: 61  AKRQARIRP 69


>UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas
           vaginalis|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 617

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFN+ QR+AT  AG I+GL V RII+EPTAAA+AYGL+K+   E+ V+++DLGGGT   
Sbjct: 156 AYFNEDQRKATITAGQIAGLKVDRIISEPTAAALAYGLNKE--DEKYVIVYDLGGGTFDV 213

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L   + Y +     GDTHL
Sbjct: 214 SLLTLDKDYFQVVATGGDTHL 234



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 26/59 (44%), Positives = 43/59 (72%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           +GIDLGTT+S VG++++G+VEII N+   + TPS V++ +  R++GD+A     ++P T
Sbjct: 15  IGIDLGTTFSVVGIYKNGEVEIIPNEINKKITPSVVSYYNGSRVVGDSAVRLGTISPET 73



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/56 (46%), Positives = 38/56 (67%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F +V    +P IK++ + ED    PEE+S++VL K+K+ AE YL +T+  AVITVP
Sbjct: 100 FTIVERDERPYIKISTEEEDTLISPEEISALVLKKLKQQAELYLNETIHEAVITVP 155



 Score = 40.3 bits (90), Expect = 0.049
 Identities = 22/54 (40%), Positives = 32/54 (59%)
 Frame = +2

Query: 245 GGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTK 406
           G   P  T+F  KRLIGRKF D  VQ +M   PF  +++E +   R +I++ T+
Sbjct: 67  GTISPETTVFAVKRLIGRKFSDPIVQQEMHRVPF--TIVERD--ERPYIKISTE 116


>UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188;
           Bacteria|Rep: Chaperone protein hscA - Yersinia pestis
          Length = 650

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 37/58 (63%), Positives = 49/58 (84%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL-IFDLGGGT 680
           AYF+D+QRQ TKDA  ++GL+VLR++NEPTAAAIAYGLD   +G+  V+ ++DLGGGT
Sbjct: 192 AYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLD---SGQEGVIAVYDLGGGT 246


>UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29;
           Proteobacteria|Rep: Chaperone protein hscA - Salmonella
           typhimurium
          Length = 616

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 36/57 (63%), Positives = 46/57 (80%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+D+QRQ TKDA  ++GL+VLR++NEPTAAAIAYGLD    G   + ++DLGGGT
Sbjct: 158 AYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSGKEGV--IAVYDLGGGT 212



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 20/55 (36%), Positives = 29/55 (52%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           A GIDLGTT S V   + G+ E + + +G    PS V +      +G AA++  A
Sbjct: 21  AAGIDLGTTNSLVATVRSGQAETLPDHEGRHLLPSVVHYQQQGHTVGYAARDNAA 75


>UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3;
           Psychrobacter|Rep: 2-alkenal reductase - Psychrobacter
           sp. PRwf-1
          Length = 650

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 6/63 (9%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG------ERNVLIFDLG 671
           AYF+++QRQATKDA  ++GL VLR++NEPTAAA+AYGLD+          ER  LI+DLG
Sbjct: 166 AYFDEAQRQATKDAAQLAGLKVLRLLNEPTAAAVAYGLDRAAGSSDETQQERLFLIYDLG 225

Query: 672 GGT 680
           GGT
Sbjct: 226 GGT 228


>UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock
           protein protein; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 502

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 36/56 (64%), Positives = 45/56 (80%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V++  GKP ++V + GE KT  PEEVSSMVLTK+KETAEAYLG+ + +AVITVP
Sbjct: 63  FTVINTDGKPMLQVEHIGETKTLSPEEVSSMVLTKLKETAEAYLGEKITDAVITVP 118



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 22/32 (68%), Positives = 27/32 (84%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPF 346
           ++P NTIFDAKRLIGR+F D  V++ MKHWPF
Sbjct: 32  ENPKNTIFDAKRLIGRQFNDEVVRSGMKHWPF 63



 Score = 33.1 bits (72), Expect = 7.5
 Identities = 15/22 (68%), Positives = 17/22 (77%)
 Frame = +3

Query: 195 VAFTDTERLIGDAAKNQVAMTP 260
           VAFTD E LIGDAAKN ++  P
Sbjct: 13  VAFTDREILIGDAAKNHMSENP 34


>UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 545

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 35/57 (61%), Positives = 45/57 (78%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF D +R ATK+AG I+G NVL +I+EP AAA++YGLDK    ++NV +FDLGGGT
Sbjct: 153 AYFGDPERAATKEAGVIAGFNVLAVIDEPVAAALSYGLDKL-KQDQNVFVFDLGGGT 208



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 3/64 (4%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQH--GKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQV 248
           K   VGIDLGTT+S +       GK EII + + +R TPS V      + ++G+ AK   
Sbjct: 17  KTTVVGIDLGTTFSAIAHINEDTGKAEIIPSPEQDRITPSVVLIEKVNDIIVGEIAKQNA 76

Query: 249 AMTP 260
              P
Sbjct: 77  VAEP 80



 Score = 37.5 bits (83), Expect = 0.35
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +1

Query: 385 AYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +++ E K +  +E+S+ +L K+K  AE  LG  + +AVIT P
Sbjct: 111 SFEHEGKKYSAQEISAFILKKLKNDAEERLGTMITDAVITCP 152


>UniRef50_Q1CWT5 Cluster: DnaK family protein; n=2;
           Cystobacterineae|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 608

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 36/64 (56%), Positives = 50/64 (78%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           +C     A F+D+QRQAT++A +I+GL+V+R++NEPTAAA+AYGL +   G  N L+FDL
Sbjct: 138 KCVITVPANFDDNQRQATREAASIAGLDVVRLVNEPTAAALAYGLSRGFEG--NALVFDL 195

Query: 669 GGGT 680
           GGGT
Sbjct: 196 GGGT 199



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKN 242
           +GIDLGTT S V   + G+  +I    G R TPS +      ER++G AA++
Sbjct: 6   IGIDLGTTNSAVATVEDGRPRMIPPRAGGRLTPSTLGVNKAGERVVGVAAQS 57


>UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1;
           Acanthamoeba polyphaga mimivirus|Rep: Heat shock protein
           70 homolog - Mimivirus
          Length = 941

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 42/84 (50%), Positives = 56/84 (66%), Gaps = 4/84 (4%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLIFDLGGGT 680
           AYFND+QRQAT D+  I+GL+VL+IINEPTAAA+AYGL  +   ++   NV+++DLG GT
Sbjct: 168 AYFNDAQRQATLDSAKIAGLDVLKIINEPTAAALAYGLGSEKWNKKTGGNVIVYDLGAGT 227

Query: 681 STCPSLP-SRRYLRGEIHRGDTHL 749
                +  S    R     G+THL
Sbjct: 228 LDVSLMNISNGVFRTLAVGGNTHL 251



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/49 (46%), Positives = 35/49 (71%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           +GIDLGT +SCV ++++ + EII +  GNRT PS V+F  + +L+G  A
Sbjct: 20  IGIDLGTRFSCVSIWRNKRFEIIPDQFGNRTIPSVVSFYKSAKLVGHNA 68



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 7/65 (10%)
 Frame = +1

Query: 337 LAFRVVSDGGKPK-IKVAYKGEDKT------FFPEEVSSMVLTKMKETAEAYLGKTVQNA 495
           +++ +VSD  K + I V     D T      + PEE+ + +L +++  A  YL K +  A
Sbjct: 103 ISYELVSDESKHENILVQLDKSDYTLTHKYQYKPEEICAQILIEIRRIASQYLQKPINKA 162

Query: 496 VITVP 510
           VITVP
Sbjct: 163 VITVP 167



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTI+D KR+IGR+  D +++       +EL
Sbjct: 75  NPKNTIYDIKRIIGRRMNDKSIEQTKNLISYEL 107


>UniRef50_A6C7U8 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Planctomyces maris DSM 8797|Rep: DnaK protein (Heat
           shock protein), C-terminal region has VWA type A domain
           - Planctomyces maris DSM 8797
          Length = 715

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 34/57 (59%), Positives = 46/57 (80%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF D++R+AT +AG  +GLN+L++INEPTAAAIAYG+  +     NVL++DLGGGT
Sbjct: 121 AYFYDAERKATIEAGRQAGLNILQLINEPTAAAIAYGVTAQPKSTSNVLVYDLGGGT 177



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/51 (45%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           +GIDLGTT S V  V    +VE++ N+ G   TPS V F +   ++GD AK
Sbjct: 5   IGIDLGTTNSVVATVGCSERVEVLPNEHGKSITPSVVLFENGSVVVGDEAK 55



 Score = 33.1 bits (72), Expect = 7.5
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +1

Query: 388 YKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           ++   K +   E+S+ VL  +K  AE  LG +V +AVIT+P
Sbjct: 80  FETAQKEYSAIELSACVLRSLKADAERELGHSVSDAVITIP 120


>UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus
           weihenstephanensis KBAB4|Rep: Heat shock protein Hsp70 -
           Bacillus weihenstephanensis KBAB4
          Length = 578

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 36/57 (63%), Positives = 46/57 (80%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+DSQR+AT+ AG I+GL V RIINEPTAAAIAYG +     + ++L++DLGGGT
Sbjct: 119 AYFSDSQRKATQKAGEIAGLKVERIINEPTAAAIAYGFENLDQNQ-HILVYDLGGGT 174



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 29/58 (50%), Positives = 37/58 (63%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV-AFTDTERLIGDAAKNQVAMTP 260
           VGIDLGTT S +   ++GK EII N +GNRTTPS V      E +IG+ AK+ +   P
Sbjct: 4   VGIDLGTTNSAIAYLKNGKPEIIENKKGNRTTPSVVQKDLKGEIIIGEDAKSGIKSLP 61



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +1

Query: 415 PEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           PEEVS+++L  +KE+ E  LG+ V  AVITVP
Sbjct: 87  PEEVSALILKYLKESVEEKLGEAVTEAVITVP 118


>UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas sp.
           MWYL1|Rep: 2-alkenal reductase - Marinomonas sp. MWYL1
          Length = 552

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 34/57 (59%), Positives = 47/57 (82%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFN+ QRQAT+ A +++GL+V R++NEPTAAA+AYGLD + + E+  L+ DLGGGT
Sbjct: 118 AYFNNKQRQATQQAASLAGLDVERLLNEPTAAALAYGLDNQDS-EQTYLVLDLGGGT 173



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 26/58 (44%), Positives = 40/58 (68%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTT+S VGV++ G V++I + +GN   PS V  + D   L+G AA++++A  P
Sbjct: 3   IGIDLGTTHSVVGVWKDGSVQLIPDMEGNILVPSAVGISEDNYILVGQAARDRLATNP 60



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +1

Query: 400 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSMTLKDKPQKMQVPSLA 567
           D+ +   E+S+++L  +KE AE YL + V  AVI+VP      K +    Q  SLA
Sbjct: 81  DQEYNAIELSAILLKSLKEQAEQYLEEPVYEAVISVP-AYFNNKQRQATQQAASLA 135


>UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular
           organisms|Rep: Heat shock protein 70 - Rhodoferax
           ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118)
          Length = 633

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 34/57 (59%), Positives = 46/57 (80%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+D+QR ATKDA  I+GL V+R++NEPTAA++AYGLD+  + E  + + DLGGGT
Sbjct: 123 AYFDDNQRSATKDACRIAGLEVIRLVNEPTAASLAYGLDRL-SEELRIAVIDLGGGT 178



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 5/62 (8%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQ----GNRTTPSYVAFT-DTERLIGDAAKNQVAM 254
           +GIDLGT+ S   V + G+  II + +    G +  PSYVA T D + L+G+ A+ Q   
Sbjct: 4   IGIDLGTSNSAAAVLRGGRPVIIPSAEGLSIGGKAFPSYVALTADGQMLVGEPARRQATA 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 17/36 (47%), Positives = 27/36 (75%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + + PE++S+ +L K+K  AEA+LG+ V  AV+TVP
Sbjct: 87  RDYSPEQLSAFLLQKIKRDAEAFLGEPVHQAVVTVP 122


>UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 509

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 36/57 (63%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF D QRQA K+AG +  L V+RIINEPTAAA+AYG+ K+   E  VL++DLGGGT
Sbjct: 150 AYFTDRQRQAVKEAGALVDLEVVRIINEPTAAALAYGIGKR--LEERVLVYDLGGGT 204



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGV-FQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 245
           +A  P +GIDLGTT SC  V +  G+V++I    G+ T PS  A  D    LIG  AK Q
Sbjct: 4   LAADPIIGIDLGTTNSCGAVAYGDGQVKLIPYKGGDYTIPSIFAIDDKGNELIGHEAKRQ 63

Query: 246 VAMTP 260
             + P
Sbjct: 64  WQLNP 68



 Score = 32.7 bits (71), Expect = 9.9
 Identities = 13/36 (36%), Positives = 25/36 (69%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           ++F  +++ S +L K+++ A  +LG  V+ AV+TVP
Sbjct: 114 RSFSIQQIGSRILGKIRDVASDHLGFKVRRAVVTVP 149


>UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 623

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 32/54 (59%), Positives = 44/54 (81%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGG 674
           YFND+QR+A  DAG I+GL+V+RI++EP AAA+AYGLD   +  + V++FDLGG
Sbjct: 182 YFNDAQRRAISDAGDIAGLDVMRIVSEPIAAAVAYGLDNVRSNGKRVVVFDLGG 235



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 34/59 (57%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD--TERLIGDAAKNQVAMTP 260
           +GID+G TYSCV V+  G+VEII NDQG+R TPS+VAFTD     ++G+AAK Q   +P
Sbjct: 37  LGIDIGATYSCVAVYCKGRVEIIPNDQGSRLTPSWVAFTDGGGRLVVGEAAKEQAVGSP 95



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKV-AYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L + VV   GKP + V A  G+ +   PEE+++ VL KMK+TAEA+LG+TV +AV+ VP
Sbjct: 122 LPYAVVDMEGKPHVLVEAADGDVRVLSPEEIAAAVLAKMKKTAEAHLGRTVSSAVVAVP 180


>UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera
           aphidicola|Rep: Chaperone protein hscA - Buchnera
           aphidicola subsp. Acyrthosiphon pisum (Acyrthosiphon
           pisumsymbiotic bacterium)
          Length = 611

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 34/57 (59%), Positives = 45/57 (78%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND Q++ TK A  +SG+N++R++NEPTAAA+AYGL K   G   VL++DLGGGT
Sbjct: 150 AYFNDFQKKETKKAAVLSGINLIRLLNEPTAAAVAYGLQKLKKG--IVLVYDLGGGT 204



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 21/71 (29%), Positives = 31/71 (43%)
 Frame = +3

Query: 63  KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           K K  K   +GIDLGTTYS     +   V ++ + +     PS V +   +  +G  A  
Sbjct: 5   KKKHDKKLLLGIDLGTTYSLAATVREKSVILLLDKKKRYLLPSVVHYKKNKISVGWKALE 64

Query: 243 QVAMTPTTQYS 275
            +   PT   S
Sbjct: 65  NITEDPTNTIS 75


>UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus
           metalliredigens QYMF|Rep: 2-alkenal reductase -
           Alkaliphilus metalliredigens QYMF
          Length = 569

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 34/57 (59%), Positives = 45/57 (78%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF D QR+AT +AG ++GL V RIINEPTAAA+AYG+D     + ++L++DLGGGT
Sbjct: 120 AYFTDEQRRATVEAGGLAGLKVERIINEPTAAALAYGIDHMDENQ-HILVYDLGGGT 175



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMTP 260
           +GIDLGT+ S VG+F+ GK  +I N    + TPS V   +  +L IG  AK+Q+   P
Sbjct: 5   IGIDLGTSTSEVGIFETGKPIVIGNHLNEKITPSVVGLGEEGQLIIGRDAKDQMLFKP 62



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/50 (46%), Positives = 32/50 (64%)
 Frame = +1

Query: 361 GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G + K+K+      K + P+E+SS +L  +KE AEAYL + V  AVITVP
Sbjct: 74  GSREKVKMG----GKEYRPQEMSSFILKYLKECAEAYLEEEVLRAVITVP 119


>UniRef50_Q9M7S4 Cluster: Heat shock protein 70; n=1; Triticum
           aestivum|Rep: Heat shock protein 70 - Triticum aestivum
           (Wheat)
          Length = 130

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 37/93 (39%), Positives = 55/93 (59%)
 Frame = +2

Query: 74  GKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCRQEPGGD 253
           G+    R+R  +H+L+R  + AR   DHRQRPGQ  H+++  +HR  ASHRRC +     
Sbjct: 36  GRGAGHRHRPRHHLLVRRRVAARPRRDHRQRPGQPHHALVRRLHRLGASHRRCAKNQVAM 95

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDA  L          Q+D+K WP+++
Sbjct: 96  NPINTVFDANVLSAEGLL-MPCQSDIKMWPYKV 127


>UniRef50_Q3SD91 Cluster: Cytosol-type hsp70; n=1; Paramecium
           tetraurelia|Rep: Cytosol-type hsp70 - Paramecium
           tetraurelia
          Length = 604

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 36/59 (61%), Positives = 43/59 (72%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           A+GIDLG  YS VGV  + + E+IAN+ GN+ TPSYVAF D E LIG+AA NQ A  PT
Sbjct: 8   AIGIDLGLKYSRVGVMINDQFELIANEFGNKFTPSYVAFVDNEILIGEAALNQQAKNPT 66



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +3

Query: 507 SAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTST 686
           S   N   ++A +DAG ISGL +LRII + TAA  AYG++ +    R +LIF+LGGG+ T
Sbjct: 150 SCNLNFCSKRAIEDAGLISGLRILRIIIDSTAAYFAYGMNLQNINLRTILIFNLGGGSIT 209



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 30/57 (52%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +1

Query: 337 LAFRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVIT 504
           L F+V SD   +PKI V  K E     PEEV SM+L+KMK  AE +LG  V  AVIT
Sbjct: 92  LLFKVESDEHDRPKIVVQQKQEQLRLHPEEVCSMILSKMKTAAEIHLGHKVNQAVIT 148



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 13/33 (39%), Positives = 24/33 (72%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTI++  RL+GR+F D  VQ ++++  F++
Sbjct: 64  NPTNTIYNVMRLMGRRFSDKIVQEEIQNLLFKV 96


>UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031574 - Anopheles gambiae
           str. PEST
          Length = 503

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 35/56 (62%), Positives = 44/56 (78%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGG 677
           A F+D QRQA  DA TI+GL+VLR+INEPTAAAI+ G++KK  GE+ VL+   GGG
Sbjct: 127 AQFSDGQRQAVLDAATIAGLSVLRLINEPTAAAISIGINKKLIGEQYVLVCSFGGG 182



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 30/58 (51%), Positives = 41/58 (70%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A+GID GT++S VG++++GK EIIAN+ GN   PS VAFT+  RL+G+ A  Q    P
Sbjct: 5   AIGIDFGTSFSSVGIYRNGKFEIIANECGNHRIPSVVAFTEKGRLVGEEALAQADTDP 62



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/65 (33%), Positives = 36/65 (55%)
 Frame = +1

Query: 316 CASRHEALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNA 495
           C    + +  R   +GG   ++V +KGE K + PEE+  ++L  ++  AE  LG+ V  A
Sbjct: 65  CVIEVKRILGRHKKEGG---LQVQFKGETKCYQPEEICGIILAHLRSMAERQLGEPVTCA 121

Query: 496 VITVP 510
           V+ VP
Sbjct: 122 VVAVP 126


>UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=1;
           Yersinia mollaretii ATCC 43969|Rep: COG0443: Molecular
           chaperone - Yersinia mollaretii ATCC 43969
          Length = 571

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 35/57 (61%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFN+ QRQA K AG I+GLNV+R++NEPTAA++AYGL      ++  L FDLGGGT
Sbjct: 128 AYFNNVQRQAVKTAGRIAGLNVIRLLNEPTAASLAYGL--LNNTQQKYLTFDLGGGT 182



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/65 (38%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +3

Query: 72  MAKAPA-VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQ 245
           +A+A A +GIDLGT+ S V ++Q G+  ++ N +G+  TPS V   D  + ++G AAK +
Sbjct: 6   VAQANALIGIDLGTSNSAVSLWQDGQAILLPNAEGDHLTPSVVGVDDHGQFIVGQAAKLR 65

Query: 246 VAMTP 260
           +   P
Sbjct: 66  LQSHP 70



 Score = 39.5 bits (88), Expect = 0.086
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = +1

Query: 415 PEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           PEE+S+++L ++K  AE YLG  V +A+ITVP
Sbjct: 96  PEELSALLLQQLKADAERYLGYGVSDAIITVP 127


>UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26;
           Bacteria|Rep: Chaperone protein hscC - Bacillus
           anthracis
          Length = 566

 Score = 72.9 bits (171), Expect = 8e-12
 Identities = 36/57 (63%), Positives = 45/57 (78%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND+QR++TK A  I+GL V R+I+EPTAAAIAYGL ++   E   L+FDLGGGT
Sbjct: 119 AYFNDTQRKSTKRAAEIAGLTVERLISEPTAAAIAYGLYQE-ESETKFLVFDLGGGT 174



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 19/35 (54%), Positives = 25/35 (71%)
 Frame = +1

Query: 406 TFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           TF  EE+SS V+  +K+ AEAYL + V  AVI+VP
Sbjct: 84  TFSSEELSSFVIKSLKQDAEAYLNEEVTGAVISVP 118



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           +GIDLGTT S V  +      +I N  G   TPS V+  +T E L+G  AK ++   P
Sbjct: 4   IGIDLGTTNSLVATWSEDGATLIPNVLGEFLTPSVVSVDETGEILVGRIAKERLITHP 61


>UniRef50_UPI0000510557 Cluster: COG0443: Molecular chaperone; n=1;
           Brevibacterium linens BL2|Rep: COG0443: Molecular
           chaperone - Brevibacterium linens BL2
          Length = 340

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 35/57 (61%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF + +R AT+DA  ++GL +LRIINEPTAAAIA+G    G+   NVL+FDLGGGT
Sbjct: 126 AYFGELERSATRDAAEMAGLPLLRIINEPTAAAIAHGFG-GGSRSENVLVFDLGGGT 181



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 19/42 (45%), Positives = 29/42 (69%)
 Frame = +1

Query: 385 AYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           A+  + K + PEE+SS+VL K+K+ AE  L + V  A++TVP
Sbjct: 84  AFAVDGKVWRPEELSSLVLKKLKQIAEENLSEPVTGAIVTVP 125



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 25/59 (42%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQ-HGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMTP 260
           +GIDLGTT S V      G    IA   G+RT PS V F  ++ + IG  AK+   M P
Sbjct: 4   IGIDLGTTNSAVAATDAMGITTTIAARDGSRTLPSAVYFEPSDEVSIGARAKSMAVMEP 62


>UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein;
           n=1; Dictyostelium discoideum AX4|Rep: Heat shock
           protein Hsp70 family protein - Dictyostelium discoideum
           AX4
          Length = 517

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MA    +GID GT ++CVG+F++ ++EI  N QGNRTTPS V+F   ++L+GD AK Q+ 
Sbjct: 1   MANNNIMGIDFGTHFACVGIFKNERIEICPNQQGNRTTPSVVSFVGDDKLVGDEAKAQMD 60

Query: 252 MTP 260
             P
Sbjct: 61  RNP 63



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 8/61 (13%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK--------KGTGERNVLIFDLG 671
           F + QR   K+A T +G+ V+R+I+E +A A+AYG D+          + E NV++FDLG
Sbjct: 154 FTEKQRNDLKEAATAAGITVVRMIHEHSAVALAYGYDQVKECSETTNESKESNVMVFDLG 213

Query: 672 G 674
           G
Sbjct: 214 G 214



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 24/71 (33%), Positives = 44/71 (61%), Gaps = 4/71 (5%)
 Frame = +1

Query: 337 LAFRVVS---DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYL-GKTVQNAVIT 504
           L+F+V +   +  K + +V YK    T  P E+++ +L ++K TAE ++ G++++ AVI+
Sbjct: 90  LSFKVTTYEDNNEKIEFQVNYKSNVVTLTPIEIATSILEQIKHTAETFIGGESIKKAVIS 149

Query: 505 VPRTSMTLKDK 537
           VP T  T K +
Sbjct: 150 VP-TDFTEKQR 159



 Score = 36.3 bits (80), Expect = 0.81
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEAN 370
           +P NTI+D KRL+GRK  D     ++K   F+++  E N
Sbjct: 62  NPLNTIYDVKRLLGRKTTDELFDHEVKKLSFKVTTYEDN 100


>UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4;
           Planctomycetaceae|Rep: Chaperone protein HscC -
           Rhodopirellula baltica
          Length = 587

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/57 (59%), Positives = 43/57 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND QR AT+ AG ++GLNV R+INEPTAAA+ YG   +   E+N+ + DLGGGT
Sbjct: 133 AYFNDHQRTATRLAGEMAGLNVRRMINEPTAAALVYGFHAR-EDEKNLCVIDLGGGT 188



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +3

Query: 54  TD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV-AFTDTERLIGD 230
           +D  +   +   +GIDLGTT+S V VF+ GK E+I+N  G + TPS V    D + ++G 
Sbjct: 6   SDSSFPTEEPVCIGIDLGTTHSLVSVFRDGKPELISNAHGEKLTPSIVGVLQDGQIVVGS 65

Query: 231 AAKNQVAMTP 260
           AA+      P
Sbjct: 66  AARELRVTAP 75



 Score = 39.5 bits (88), Expect = 0.086
 Identities = 18/37 (48%), Positives = 25/37 (67%)
 Frame = +1

Query: 400 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           DK F P E+SS+VL  +++ A A L   + +AVITVP
Sbjct: 96  DKEFTPHELSSLVLQSLRDDAAAQLNTEITDAVITVP 132


>UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: DnaK
           protein - Clostridium perfringens
          Length = 575

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           A FND QR+ATK+AG I+G  V RIINEPTAAA+AYG+D       N++++D GGGT   
Sbjct: 121 ANFNDIQRKATKNAGEIAGFKVERIINEPTAAAMAYGVDNLDK-NGNIIVYDFGGGTFDV 179

Query: 690 PSLPS-RRYLRGEIHRGDTHL 749
             L      L  ++ RG+ +L
Sbjct: 180 TILEMFNGVLDVKVSRGNNYL 200



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/50 (44%), Positives = 34/50 (68%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSMTLKDKPQK 546
           + K + PEE+S+++L K+KE AE +LG+ V+ AVITVP     ++ K  K
Sbjct: 83  QGKEYRPEEISALILKKLKEVAEYFLGEEVEEAVITVPANFNDIQRKATK 132



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIAN-DQGN-RTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTT S +   + GK  II N ++G+    PS V+    E  +G  AKNQ+ + P
Sbjct: 5   IGIDLGTTTSEIAYVKDGKPCIIRNIEEGDEHAIPSVVSIEGDEIKVGKKAKNQILLKP 63


>UniRef50_Q64YI6 Cluster: Chaperone protein DnaK; n=2; Bacteroides
           fragilis|Rep: Chaperone protein DnaK - Bacteroides
           fragilis
          Length = 529

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/57 (61%), Positives = 43/57 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF   +R  TK AG I+GLNVL IINEPTAAAI+YG+  K   ++ VL++DLGGGT
Sbjct: 130 AYFGTKERMQTKQAGEIAGLNVLSIINEPTAAAISYGV--KTDQKKTVLVYDLGGGT 184



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 2/59 (3%)
 Frame = +3

Query: 93  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMTPT 263
           GIDLGTTYSC+  V +  +  ++ N +G+ TTPS V F D +  ++G  AK  +A  PT
Sbjct: 9   GIDLGTTYSCIAQVDKFDQAIVLRNFEGDATTPSAVYFEDMDHVVVGKEAKGMLATEPT 67


>UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma
           marginale str. St. Maries|Rep: Heat shock protein -
           Anaplasma marginale (strain St. Maries)
          Length = 602

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 61/200 (30%), Positives = 96/200 (48%), Gaps = 2/200 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           A GIDLGTT S + V  H G V++  +  G    PS V +T D    +G  A N +    
Sbjct: 17  AFGIDLGTTNSLIAVVGHDGGVKVFEDPAGRSLIPSIVEYTRDGVVKVGHDA-NPLRALR 75

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFHGA 440
           +T+  M  ++ DV      C  T +    S      + DQ  +      + P        
Sbjct: 76  STKRLMGKLAKDVHHSQF-CGATVTDKNGSAA---LSIDQNKV------VTPVEVAAEVL 125

Query: 441 YENEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 620
                  +S + Q+         AYF++  R+AT+DA  ++G+ VLR++NEPTA+A++Y 
Sbjct: 126 KRLVELVKSCTGQDVTHAVITVPAYFDEIARKATRDAARMAGIEVLRLLNEPTASALSYK 185

Query: 621 LDKKGTGERNVLIFDLGGGT 680
           +++ G  E  V ++D GGGT
Sbjct: 186 VEQAGDAEVCV-VYDFGGGT 204


>UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1;
           Neorickettsia sennetsu str. Miyayama|Rep: Putative
           chaperone protein HscA - Neorickettsia sennetsu (strain
           Miyayama)
          Length = 593

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 32/57 (56%), Positives = 46/57 (80%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+++ R A KDA TI+GLNV+R+++EPTAAA+ YG+D+K   E   +++DLGGGT
Sbjct: 134 AYFDNASRTAIKDAATIAGLNVVRLLSEPTAAALFYGIDEK-KEEGRYIVYDLGGGT 189



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = +3

Query: 63  KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           + K+ +   +GID GTT S V +F   K  +I  + G+   PS +   D + +IG  AK
Sbjct: 10  RQKLDREVIIGIDFGTTNSLVCIFDGSKCVVIPQEGGDVLLPSVIGVKDKDIIIGKEAK 68



 Score = 32.7 bits (71), Expect = 9.9
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +1

Query: 427 SSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +S +   +K TAE YLG  V  AV+TVP
Sbjct: 106 ASRIFASLKRTAEKYLGHCVNMAVVTVP 133


>UniRef50_A4J964 Cluster: Heat shock protein 70; n=2;
           Clostridiales|Rep: Heat shock protein 70 -
           Desulfotomaculum reducens MI-1
          Length = 619

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/57 (61%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF D QR+ATK AG ++G  V RIINEPTAAA+A+GL      +R++LI+DLGGGT
Sbjct: 132 AYFTDEQRRATKQAGELAGFVVERIINEPTAAALAFGLAHM-EEDRHILIYDLGGGT 187



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 1/74 (1%)
 Frame = +3

Query: 42  TSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTER 218
           T+ K D   + +  P VGIDLGTT S V    + K EII + Q     PS V    + + 
Sbjct: 2   TNRKND-ATRQSFRPIVGIDLGTTNSAVAYIHNSKPEIIPSPQSKHIIPSVVLLDPEGKV 60

Query: 219 LIGDAAKNQVAMTP 260
           ++G+ A+  +   P
Sbjct: 61  VVGEDARAALIAMP 74


>UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Clostridium acetobutylicum|Rep: DnaK protein (Heat shock
           protein), C-terminal region has VWA type A domain -
           Clostridium acetobutylicum
          Length = 698

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 35/58 (60%), Positives = 47/58 (81%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 680
           AYFN+ QRQ+T +AG  +  NVL I+NEPTAAA+AYG+  K +GE +N+L++DLGGGT
Sbjct: 121 AYFNNIQRQSTINAGKRAEFNVLSILNEPTAAAMAYGM--KASGENKNILVYDLGGGT 176



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVF-QHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           ++GIDLGTT+S V +  ++G  +++ N +GN  TPS + F+  E ++GD AK   AM
Sbjct: 4   SLGIDLGTTFSVVSIIDENGAPKVLKNKEGNTLTPSVIYFSGEEIIVGDDAKEMQAM 60



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           ++K +  E++S +VL K+K+ AE +L   V++AVITVP
Sbjct: 83  QNKYYNAEDLSVIVLKKLKKDAEDFLKAEVKDAVITVP 120


>UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 586

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 34/57 (59%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+D QR AT+DAG ++GL+V+RIINEPT+AAIAY  D        +L++DLGGGT
Sbjct: 119 AYFDDRQRNATRDAGLLAGLDVVRIINEPTSAAIAY--DAGHPENHKLLVYDLGGGT 173



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/37 (54%), Positives = 27/37 (72%)
 Frame = +1

Query: 400 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +K F PEE+SS +L  +K+ AE YLG  ++ AVITVP
Sbjct: 82  EKEFRPEEISSFILLTLKKHAEKYLGSEIKKAVITVP 118



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI-GDAAKNQVAMTP-T 263
           VGIDLGTT S + + ++GK ++I  D  +   PS V    T +LI G  AKNQ   +P +
Sbjct: 5   VGIDLGTTNSEISILENGKPKVIPVDD-DLIMPSCVGIDITGKLIVGKTAKNQAVSSPES 63

Query: 264 TQYSMP-NVSSDVSSKM 311
           T +S+   +  DV  ++
Sbjct: 64  TIFSIKRKMGEDVKVRL 80


>UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter
           usitatus Ellin6076|Rep: Heat shock protein 70 -
           Solibacter usitatus (strain Ellin6076)
          Length = 619

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 33/58 (56%), Positives = 47/58 (81%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERN-VLIFDLGGGT 680
           AYF+D+QR AT++AG ++GL V+RI+NEPTAA++AYG      G R+ V+++DLGGGT
Sbjct: 120 AYFSDAQRNATREAGMLAGLEVVRILNEPTAASLAYGF---ADGSRHTVMVYDLGGGT 174



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           VGIDLGTT S V  F +G+V ++     ++  PS V  + + E ++G+AA NQ  + P
Sbjct: 6   VGIDLGTTNSEVAAFLNGRVRVL-GPNASKMLPSCVGISPSGELMVGEAALNQQRIYP 62



 Score = 37.5 bits (83), Expect = 0.35
 Identities = 17/36 (47%), Positives = 25/36 (69%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K F P E+S+++L ++   AE  LG+ V+ AVITVP
Sbjct: 84  KGFSPAEISALILKELAAWAERDLGRPVERAVITVP 119


>UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1;
           Methanospirillum hungatei JF-1|Rep: Heat shock protein
           70 - Methanospirillum hungatei (strain JF-1 / DSM 864)
          Length = 571

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 33/57 (57%), Positives = 45/57 (78%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A ++DSQRQA  DA  I+G+NV+R+INEPTAAA+AYG+  +   +R VL++D GGGT
Sbjct: 121 ANYSDSQRQAIMDAAEIAGINVVRLINEPTAAALAYGI--REDRDRKVLVYDFGGGT 175



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTP 260
           +GID GTT S +      +  +I NDQG++ TPS V F  + E  IG+ AK+   + P
Sbjct: 6   IGIDFGTTNSKMAYMLLDEPVVIENDQGSKITPSVVYFKNEKEFSIGEQAKHNQIIHP 63


>UniRef50_Q6F9S6 Cluster: Chaperone protein; n=2; Acinetobacter|Rep:
           Chaperone protein - Acinetobacter sp. (strain ADP1)
          Length = 566

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 36/57 (63%), Positives = 43/57 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND QRQAT  A  ++GL V R+INEPTAAA+AYGL +  + +   LIFDLGGGT
Sbjct: 122 AYFNDIQRQATISAAELAGLKVSRLINEPTAAALAYGLGQ--SDDSCFLIFDLGGGT 176



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 27/52 (51%), Positives = 37/52 (71%), Gaps = 1/52 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAA 236
           P +GIDLGT+ S VGVF++G+  +I N  GN+ TPS +A  + E+ LIG AA
Sbjct: 6   PLIGIDLGTSNSLVGVFENGQPRLIENAYGNKLTPSAIAMDEDEQILIGQAA 57



 Score = 33.9 bits (74), Expect = 4.3
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +1

Query: 400 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           D++F   E+SS++L  +K+ AE  L   +  AVITVP
Sbjct: 85  DRSFSAVELSSLILRSLKQDAEHALQCEIDEAVITVP 121


>UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 527

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 8/64 (12%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG--LDKKGT------GERNVLIFDL 668
           YFND +R+AT+DAG I+GLNV+ IINEPTAA +AY    D+ G       G+R +L++DL
Sbjct: 127 YFNDVRRKATQDAGRIAGLNVIDIINEPTAATLAYAWKRDELGNPDAMPDGDRTILVYDL 186

Query: 669 GGGT 680
           GGGT
Sbjct: 187 GGGT 190


>UniRef50_UPI0000D56BFD Cluster: PREDICTED: similar to CG8937-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8937-PA, isoform A - Tribolium castaneum
          Length = 767

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 31/57 (54%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFN++QR AT+DA  I+G  VL+++NEP+AAA+AY  + +    R +LI+DLGGGT
Sbjct: 148 AYFNNNQRAATRDAARIAGFEVLKLVNEPSAAALAYVRENRIKNGRVILIYDLGGGT 204



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/58 (50%), Positives = 40/58 (68%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           VGIDLGTT SC+ V ++GK+E+I N +GNRTT SYV + +   L+G  AK   +  P+
Sbjct: 6   VGIDLGTTNSCIAVERNGKIEVIPNREGNRTTLSYVYYGEDSILVGKTAKYMASANPS 63



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +1

Query: 322 SRHEALAFRVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAV 498
           S  ++L + +V    G+  I+V    E     PEEV + +L ++K  AE YLG+ V  AV
Sbjct: 84  SERKSLNYELVRGTNGEILIQVEQNSEKFHTLPEEVCARILHRLKIDAEMYLGQKVSKAV 143

Query: 499 ITVP 510
           +TVP
Sbjct: 144 VTVP 147


>UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=2; Bacteria|Rep: DnaK protein (Heat
           shock protein), HSP70/DnaK family - Clostridium
           acetobutylicum
          Length = 551

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 35/57 (61%), Positives = 45/57 (78%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF  ++R+ATK AG I+GLNV  IINEPTAAA+AYG+D     ++ VL++DLGGGT
Sbjct: 121 AYFGINEREATKLAGEIAGLNVKAIINEPTAAAVAYGVDY--DKDKVVLVYDLGGGT 175



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +3

Query: 93  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           GIDLGTTYSC+  V ++G+  ++ N +  R TPS V F     ++GD AK    M P
Sbjct: 6   GIDLGTTYSCISYVDEYGRPVVVPNAENERITPSVVFFDGDNVIVGDVAKENSKMYP 62



 Score = 33.9 bits (74), Expect = 4.3
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K +  EE+SS +L K+   AE  LG+ + + VIT P
Sbjct: 85  KNYHAEEISSFILRKLISDAENNLGQKINDVVITCP 120


>UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13;
           Rickettsiales|Rep: Heat shock protein Hsp70 - Ehrlichia
           canis (strain Jake)
          Length = 618

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 30/57 (52%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+++ R+ATKDA  ++ L VLR++NEPTAAA+AYG++K        +++DLGGGT
Sbjct: 150 AYFDEAARKATKDAAHLANLEVLRLLNEPTAAALAYGIEKPEYENNIYMVYDLGGGT 206



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 3/79 (3%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           A GIDLGTT S + +  + GK  I +++ G    PS V++ + +  +G    N   ++  
Sbjct: 17  AFGIDLGTTNSLISMIDNEGKTIIFSDENGRFLIPSTVSYINNQVEVGKNYSNDNTISSI 76

Query: 264 TQYSMPNVS--SDVSSKML 314
            +    ++   +++SS++L
Sbjct: 77  KRLMGKSIKDINELSSELL 95


>UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshimeri
           serovar 6b str. SLCC5334|Rep: Complete genome - Listeria
           welshimeri serovar 6b (strain ATCC 35897 / DSM 20650
           /SLCC5334)
          Length = 561

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 33/68 (48%), Positives = 48/68 (70%)
 Frame = +3

Query: 477 QNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL 656
           + C E      AYFN+SQR+AT DA  ++GL V R+I+EPTAAAIAYG+ ++   +  ++
Sbjct: 108 ETCTEAVISVPAYFNNSQRKATIDAAFLAGLKVERLISEPTAAAIAYGIHQQ--NDTTLM 165

Query: 657 IFDLGGGT 680
           + D+GGGT
Sbjct: 166 VIDIGGGT 173



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           +GIDLGT+ S V  ++  K  +I N  G+  TPS V   +  E LIG  A+ ++   P
Sbjct: 4   LGIDLGTSNSLVAYWKEDKAVLIPNVFGDVLTPSVVGIDENDELLIGKIARERLTSHP 61



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 21/44 (47%), Positives = 27/44 (61%)
 Frame = +1

Query: 379 KVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K  Y GE K F   ++SS VL  +K  AE +LG+T   AVI+VP
Sbjct: 76  KCYYLGEQK-FSATDLSSFVLKSLKADAENFLGETCTEAVISVP 118


>UniRef50_A5AUN6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 153

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 32/38 (84%), Positives = 34/38 (89%)
 Frame = +3

Query: 147 VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           V+ IANDQGNRT PSYV FT+TERLIGDAAKNQVAM P
Sbjct: 5   VDFIANDQGNRTMPSYVDFTNTERLIGDAAKNQVAMNP 42



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +3

Query: 531 RQATKDAGTISGLNVLRIINEPTAA 605
           RQATKDA  I+GL+V+RIINEP AA
Sbjct: 90  RQATKDARAIAGLDVVRIINEPIAA 114


>UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 708

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 55/203 (27%), Positives = 92/203 (45%), Gaps = 4/203 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGK-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           P +GIDLGTTY C+  F   K ++    D  +   PS+V+F + ER++G  A  Q+   P
Sbjct: 4   PHLGIDLGTTYCCIFAFDEKKNIKFSIRDGDSEQIPSFVSFANEERIVGRKAMAQMITNP 63

Query: 261 T-TQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*D-QGSI*G*RQNLFPRGSQFH 434
           T T Y    +        +  +   +   ++ +    + +   +I      L P     +
Sbjct: 64  TNTIYDSKRMIGRNFDNQIFQEDRKNWMFTTTRGMEGSININATINNQTITLLPEEISGY 123

Query: 435 GAYENEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAG-TISGLNVLRIINEPTAAAI 611
              ++  +   L   NC +      A FN+ QR+ T  A   I+G   + +++EP++AA+
Sbjct: 124 -ILKHLKDTAELVIGNCTDVVITIPAAFNERQREKTIFAAQEIAGFRSVILLDEPSSAAL 182

Query: 612 AYGLDKKGTGERNVLIFDLGGGT 680
            Y        +  VLIFD GGGT
Sbjct: 183 EYAQGLPSNADELVLIFDFGGGT 205



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPF 346
           +P NTI+D+KR+IGR F++   Q D K+W F
Sbjct: 62  NPTNTIYDSKRMIGRNFDNQIFQEDRKNWMF 92



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G   I      +  T  PEE+S  +L  +K+TAE  +G    + VIT+P
Sbjct: 100 GSININATINNQTITLLPEEISGYILKHLKDTAELVIGNCT-DVVITIP 147


>UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           Molecular chaperone DnaK - Syntrophomonas wolfei subsp.
           wolfei (strain Goettingen)
          Length = 498

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 30/57 (52%), Positives = 45/57 (78%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND+QRQAT  AG ++GL +L+++NEPTAAA+AY  ++    + ++L+ D+GGGT
Sbjct: 119 AYFNDNQRQATYMAGELAGLKILQLLNEPTAAALAYASEQ--AEKEHILVLDIGGGT 173



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 28/57 (49%), Positives = 38/57 (66%), Gaps = 2/57 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAM 254
           VGIDLGTT S V  + + GK EII N++G R TPS + F  + E L+G+ A+NQ  +
Sbjct: 3   VGIDLGTTNSLVAFINREGKAEIIINERGGRLTPSVIYFKNEQEVLVGEVARNQALL 59



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 15/36 (41%), Positives = 28/36 (77%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +T+ P E+S+++L K+ + A+ YLG+ ++ AV+TVP
Sbjct: 83  RTYSPVEISALILRKLSDYAKEYLGQEIEAAVVTVP 118


>UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: HEAT SHOCK RELATED 70kDa
           PROTEIN - Encephalitozoon cuniculi
          Length = 683

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +3

Query: 63  KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTE-RLIGDAAK 239
           K K   + A+GIDLGTT+SCV  +  GKVE+I N  G RTTPS V+F +    ++G AA+
Sbjct: 5   KAKSNTSRAIGIDLGTTFSCVAGYISGKVEVITNQDGERTTPSVVSFDENNCTVVGTAAR 64

Query: 240 NQVAMTP 260
           N V   P
Sbjct: 65  NMVGSDP 71



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 7/64 (10%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGL--NVLRIINEPTAAAIAYG-----LDKKGTGERNVLIFDL 668
           AYF + Q+  TK A TI+G   N +R++ EPTAAA+AYG      +   + + +VL+FDL
Sbjct: 174 AYFEEPQKDVTKAAATIAGFDPNKVRLLAEPTAAAMAYGHIQTQKNANFSAKEDVLVFDL 233

Query: 669 GGGT 680
           GGGT
Sbjct: 234 GGGT 237



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 19/35 (54%), Positives = 27/35 (77%)
 Frame = +2

Query: 248 GDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           G DP + IFDAKR+IGR+F+D  +Q  +K WPF++
Sbjct: 68  GSDPMSVIFDAKRMIGREFDDPKIQNAIKGWPFKV 102



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/45 (46%), Positives = 28/45 (62%)
 Frame = +1

Query: 376 IKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           IK+   G+   + P E+S  VL  +K  AEA LG TV +AV+TVP
Sbjct: 129 IKITRNGKTNYYAPVEISGKVLLYLKNAAEARLGGTVDSAVVTVP 173


>UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena CCY
           9414|Rep: DnaK protein - Nodularia spumigena CCY 9414
          Length = 578

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 32/57 (56%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F D+ R+AT +AG I+GLNVLR++NEPTAAA+A+G+ K    E  +++FD GGGT
Sbjct: 122 ANFPDAARKATFNAGEIAGLNVLRLLNEPTAAALAFGI-KNIASEEQLVVFDFGGGT 177



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 16/37 (43%), Positives = 28/37 (75%)
 Frame = +1

Query: 400 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           ++ + PEE+++++L K+KE AE  LG  +Q+ VI+VP
Sbjct: 85  EQDYRPEEIAALILRKLKENAEEALGHPIQDVVISVP 121


>UniRef50_A6C7U7 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=1; Planctomyces maris DSM 8797|Rep:
           DnaK protein (Heat shock protein), HSP70/DnaK family -
           Planctomyces maris DSM 8797
          Length = 557

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 33/57 (57%), Positives = 43/57 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF   Q++ATK AG I+GLNV  +I EPTAAAIAYG +++   +  VL++DLGGGT
Sbjct: 124 AYFGSRQKEATKKAGEIAGLNVRYVIPEPTAAAIAYGEEQE--NDDTVLVYDLGGGT 178



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 2/54 (3%)
 Frame = +3

Query: 93  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQV 248
           GIDLGTTYSC+  + +HG+  ++ N++G+ TTPS V F D E  ++G AAK+ +
Sbjct: 8   GIDLGTTYSCISYIDEHGQPVVVQNNEGDLTTPSVVFFEDMENVVVGKAAKDAI 61



 Score = 36.7 bits (81), Expect = 0.61
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + K + PEEVS+++L K+ + A    GKT+   VIT P
Sbjct: 86  DGKEYRPEEVSALILKKIVDDATLTTGKTISEVVITCP 123


>UniRef50_Q7M080 Cluster: DnaK-type molecular chaperone; n=1;
           Cricetulus griseus|Rep: DnaK-type molecular chaperone -
           Cricetulus griseus (Chinese hamster)
          Length = 137

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 33/41 (80%), Positives = 37/41 (90%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           AYFND+QR    DAGTI+GLNV+RIINEPTAAAIAYGLDK+
Sbjct: 46  AYFNDAQR----DAGTIAGLNVMRIINEPTAAAIAYGLDKR 82



 Score = 40.3 bits (90), Expect = 0.049
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           +P NT+FDAK LIGR + D +VQ D+K  PF+++
Sbjct: 6   NPENTVFDAK-LIGRTWNDPSVQQDIKFLPFKVT 38


>UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG31366-PA - Tribolium castaneum
          Length = 614

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 37/81 (45%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFN SQR+AT +A   +G  VL+++NEPTAAA  Y +D+    E   L++DLGGGT   
Sbjct: 148 AYFNVSQREATLEAAQKAGFTVLKLLNEPTAAAFCYYVDQNWGEESYSLVYDLGGGTFDV 207

Query: 690 PSLPSRRYLRGEIH-RGDTHL 749
             L + R     +   GDTHL
Sbjct: 208 AILKNCRQNIDIVGVDGDTHL 228



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/56 (42%), Positives = 33/56 (58%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F + S   KP + + +K       PEEVS++VL K+K   E+ LG+ V  AVITVP
Sbjct: 92  FTIESIENKPIVTINHKSGVCKKTPEEVSALVLQKVKTDVESKLGERVNKAVITVP 147



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI 224
           +GIDLGTT S    +   KV ++ N +G+R TPS V F D   +I
Sbjct: 6   IGIDLGTTNSSAAYYFKEKVRVVENKEGDRITPSCVYFRDQNTVI 50



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 12/32 (37%), Positives = 22/32 (68%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADMKHWPFELSVME 364
           +F  KR IG++F+D  ++ D++H PF +  +E
Sbjct: 67  VFGIKRFIGKQFDDPDLRNDLRHVPFTIESIE 98


>UniRef50_Q1CY00 Cluster: DnaK family protein; n=2;
           Cystobacterineae|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 1146

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 29/57 (50%), Positives = 46/57 (80%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AY+++ QR+A + +G ++GL V RI+NEPT+AA+AYGL+++    + VL++DLGGGT
Sbjct: 745 AYYSEPQREAVRKSGILAGLKVERILNEPTSAALAYGLNRE--LNKKVLVYDLGGGT 799



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 1/60 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTP 260
           P +GIDLGTT SCV +  +G+  ++ + +G  T PS ++     + L+   AKNQ+ + P
Sbjct: 604 PVIGIDLGTTNSCVALLSNGRPLVLRSREGYNTIPSVISLNAQNKLLVSHRAKNQLVLRP 663



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
 Frame = +1

Query: 331 EALAFRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           E   + +V D  G+  +++A    D     EEV +++L + KE AEA+L + V+ AV+TV
Sbjct: 688 ERFHYDIVPDSAGRAAVRLA----DTALSLEEVQALILRECKEMAEAHLNQKVERAVVTV 743

Query: 508 P 510
           P
Sbjct: 744 P 744


>UniRef50_A7BR82 Cluster: Heat shock protein Hsp70; n=1; Beggiatoa
           sp. PS|Rep: Heat shock protein Hsp70 - Beggiatoa sp. PS
          Length = 516

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 34/57 (59%), Positives = 42/57 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF++ +R+AT DA   +GL VLRIINEPTAAA+ Y   K G  +  VLI+DLGGGT
Sbjct: 121 AYFDEYRRKATMDAAEKAGLKVLRIINEPTAAALTYA--KTGQCKGKVLIYDLGGGT 175



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/62 (43%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           K  A+GIDLGTTYS +      GK EI+ N  G R T S V F     L+G  A +  A 
Sbjct: 2   KRHAIGIDLGTTYSALATLNSSGKPEIVPNLDGERVTASAVYFQGGSILVGQLAADAAAG 61

Query: 255 TP 260
            P
Sbjct: 62  DP 63


>UniRef50_A2ECF5 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 730

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 64/207 (30%), Positives = 94/207 (45%), Gaps = 10/207 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGK-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           +GIDLGTTY C+  +   K V     DQ +    SYV++   + + G  A+NQV   P  
Sbjct: 6   LGIDLGTTYCCIYYYDEKKHVAEAIKDQDSSQIASYVSYNKDDVVYGSVAQNQVMNNPE- 64

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFHGAYE 446
                N   D S +M+  K +        Q W     Q      R N+  RG + +   E
Sbjct: 65  -----NTVYD-SKRMIGKKFSNPDFQIDRQNWPFNTSQADDDSIRINVSARGKKLNLRPE 118

Query: 447 N-EGNC----RSLSWQNCAECS---YHGSAYFNDSQRQATKDAGT-ISGLNVLRIINEPT 599
              GN     ++ + +   ECS       A F++ QR+ T  A   I+G   + +++EP+
Sbjct: 119 EVSGNILRYLKATAEKVIGECSDVVITIPASFDEIQREKTIFAAKEIAGFKNVALLDEPS 178

Query: 600 AAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AAA+ Y  +     E  VLIFD GGGT
Sbjct: 179 AAALEYAQNLPPNSEEKVLIFDFGGGT 205



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 16/35 (45%), Positives = 26/35 (74%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           ++P NT++D+KR+IG+KF +   Q D ++WPF  S
Sbjct: 61  NNPENTVYDSKRMIGKKFSNPDFQIDRQNWPFNTS 95



 Score = 36.3 bits (80), Expect = 0.81
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = +1

Query: 355 SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +D    +I V+ +G+     PEEVS  +L  +K TAE  +G+   + VIT+P
Sbjct: 97  ADDDSIRINVSARGKKLNLRPEEVSGNILRYLKATAEKVIGE-CSDVVITIP 147


>UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_226_13599_12049 - Giardia lamblia
           ATCC 50803
          Length = 516

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 31/62 (50%), Positives = 44/62 (70%), Gaps = 1/62 (1%)
 Frame = -2

Query: 245 LVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDSYCGCFCH-F 69
           LVLGG++DETL + E ++   G  AL++GDDLH  VL + NA V G+++D+Y  C CH F
Sbjct: 452 LVLGGVADETLCIREGDVGGRGVRALLIGDDLHFFVLINANAGVSGSEVDAYSRCSCHDF 511

Query: 68  VF 63
           +F
Sbjct: 512 IF 513


>UniRef50_P77319 Cluster: Chaperone protein hscC; n=19;
           Gammaproteobacteria|Rep: Chaperone protein hscC -
           Escherichia coli (strain K12)
          Length = 556

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 32/57 (56%), Positives = 42/57 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+D QR+ T+ A  ++GLN +R+INEPTAAA+AYGL  +       L+FDLGGGT
Sbjct: 123 AYFSDEQRKHTRLAAELAGLNAVRLINEPTAAAMAYGLHTQ--QNTRSLVFDLGGGT 177



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMTP 260
           A+GIDLGTT S + V++ G  ++I N  G   TPS ++  +    L+G  A ++    P
Sbjct: 7   AIGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISMDENNHILVGKPAVSRRTSHP 65



 Score = 36.3 bits (80), Expect = 0.81
 Identities = 18/39 (46%), Positives = 27/39 (69%)
 Frame = +1

Query: 394 GEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G D TF   E+SS+VL  +KE AE +L + +++ VI+VP
Sbjct: 85  GSD-TFNAPELSSLVLRSLKEDAEEFLQRPIKDVVISVP 122


>UniRef50_A5MZQ7 Cluster: DnaK9; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK9 - Clostridium kluyveri DSM 555
          Length = 540

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/57 (52%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF   QR+ATK A   +GLNVLR++ EPTAAA+ YG+D++   ++ ++++DLGGGT
Sbjct: 118 AYFTSEQREATKRAAERAGLNVLRLMPEPTAAALDYGIDQQ--RDQIIMVYDLGGGT 172



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/59 (40%), Positives = 35/59 (59%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           VGIDLGTT S V   + G+ E+I  D G    PS ++  D E ++G  AK ++ ++P T
Sbjct: 5   VGIDLGTTNSVVSYLKRGRAEVIPID-GKNIFPSVLSIRDGEIIVGSQAKARMMLSPET 62



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 17/43 (39%), Positives = 26/43 (60%)
 Frame = +1

Query: 382 VAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +AY    + F PE+V+  +L  +KE A + L + +  AVITVP
Sbjct: 75  IAYDLGTEMFTPEDVAYYILKTIKEKAGSILEEKIDQAVITVP 117


>UniRef50_A3FQM0 Cluster: Heat shock 105kD; heat shock 105kD alpha;
           heat shock 105kD beta; heat shock 105kDa protein 1; n=2;
           Cryptosporidium|Rep: Heat shock 105kD; heat shock 105kD
           alpha; heat shock 105kD beta; heat shock 105kDa protein
           1 - Cryptosporidium parvum Iowa II
          Length = 806

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 56/198 (28%), Positives = 93/198 (46%), Gaps = 11/198 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA--KNQVAMTPT 263
           +G+D+GT  + V     G V I+ N+   RTTP  V +TDTERLIG+ A  K +     T
Sbjct: 4   IGLDIGTINAVVATINRGAVTIVRNELSERTTPILVGYTDTERLIGEPALTKMKSNYRNT 63

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQ----F 431
            +Y  P +    ++ +   K      +++C       + G+I G R N   +G+Q     
Sbjct: 64  CRYMKPLIGMLPNNVVETEKLYSLAEITTC-------ENGNI-GFRVNY--KGNQQVVSL 113

Query: 432 HGAYEN-----EGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
              Y +     + N    + Q+  +       Y+++  RQ   DA  I+G+N LR++NE 
Sbjct: 114 TSVYASFLKRLKENTEKSTGQSVRDLVISIPGYYDNVARQNVLDALHIAGINCLRLMNEE 173

Query: 597 TAAAIAYGLDKKGTGERN 650
           +A A+ YG+ +      N
Sbjct: 174 SAVALDYGIFRSNNFAEN 191



 Score = 33.1 bits (72), Expect = 7.5
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +1

Query: 334 ALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +LA     + G    +V YKG  +      V +  L ++KE  E   G++V++ VI++P
Sbjct: 86  SLAEITTCENGNIGFRVNYKGNQQVVSLTSVYASFLKRLKENTEKSTGQSVRDLVISIP 144


>UniRef50_A6EQS3 Cluster: Heat shock protein Hsp70; n=1;
           unidentified eubacterium SCB49|Rep: Heat shock protein
           Hsp70 - unidentified eubacterium SCB49
          Length = 730

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 30/58 (51%), Positives = 42/58 (72%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 680
           AYF + Q+ AT+ A  ++GL V +++ EPTAAAIAYG+D    G+ + VLI+D GGGT
Sbjct: 147 AYFTEKQKNATRIAAQLAGLKVQKLLAEPTAAAIAYGVDNLKVGDAKTVLIYDFGGGT 204



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 19/36 (52%), Positives = 26/36 (72%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           K + PE++SS +L K+K+ AE  LG  V +AVITVP
Sbjct: 111 KQYTPEQLSSEILKKIKKDAEEKLGDEVTHAVITVP 146



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A+GIDLGT+ S +  F+   V+II N +    T S +     E L+G  A   +   P
Sbjct: 4   AIGIDLGTSNSVI-AFKDTSVKIIRNKENEELTRSCIGLRKEEILVGRTAYQLLKTDP 60


>UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2;
           Anaeromyxobacter dehalogenans 2CP-C|Rep: Conserved
           region 2266 - Anaeromyxobacter dehalogenans (strain
           2CP-C)
          Length = 782

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/57 (52%), Positives = 42/57 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AY+N+ QR A + AG ++GL V RI+NEPTAAA+AY   +    ++ VL++DLGGGT
Sbjct: 368 AYYNERQRAAVRHAGALAGLKVERILNEPTAAALAYAFGRH--LDQRVLVYDLGGGT 422



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMTP 260
           +GIDLGT+ SC  V + G+  +I + +G  T PS VA     R+ +G  A+ Q+   P
Sbjct: 229 IGIDLGTSNSCAAVVRDGRPYVIPSREGYNTVPSIVALNARNRIVVGHLARAQLLTNP 286



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/36 (50%), Positives = 27/36 (75%)
 Frame = +1

Query: 403 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +T   E+VS++VL ++KE A+ +LG+ V  AVITVP
Sbjct: 332 ETLTLEQVSALVLAEVKEVAQNHLGEEVNRAVITVP 367


>UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 636

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 31/55 (56%), Positives = 39/55 (70%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           FND Q+QAT D   I+GL V+R+I+EP AA IAYG D   T + N+ +FD GGGT
Sbjct: 168 FNDIQKQATIDIAEIAGLKVVRLISEPNAAVIAYGRDYV-TEKTNIFVFDFGGGT 221



 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 32/63 (50%), Positives = 42/63 (66%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           P +GIDLGTTYS V +F+  KVEII N+ G ++TP+ VAF  T  LIG+ AK Q  + P 
Sbjct: 22  PIIGIDLGTTYSSVCIFRDDKVEIIPNEYGFKSTPTVVAFNGT-FLIGEEAKEQGIINPQ 80

Query: 264 TQY 272
             +
Sbjct: 81  NTF 83



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 23/62 (37%), Positives = 37/62 (59%), Gaps = 2/62 (3%)
 Frame = +1

Query: 331 EALAFRVVSDGGKPKIKVAY--KGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVIT 504
           + L F ++ +  K  IKV+      +K F  + + + VLTK+K  A +YLG  V+NAVI+
Sbjct: 104 KGLPFTIMQENDKICIKVSQPRNKSNKIFNIDYIQAKVLTKLKNIASSYLGVPVKNAVIS 163

Query: 505 VP 510
           +P
Sbjct: 164 IP 165



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 18/45 (40%), Positives = 25/45 (55%)
 Frame = +2

Query: 236 QEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEAN 370
           +E G  +P NT +D KRL GR + D  V    K  PF  ++M+ N
Sbjct: 72  KEQGIINPQNTFYDIKRLTGRTYLDPNVNRVKKGLPF--TIMQEN 114


>UniRef50_A2VD43 Cluster: Heat shock protein 14; n=3;
           Clupeocephala|Rep: Heat shock protein 14 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 504

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 25/51 (49%), Positives = 39/51 (76%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+  G T +CV VF+ G+ +++AND G+R TP+ VA+ DTE+++G AAK
Sbjct: 3   AIGVHFGYTCACVAVFKDGRADVVANDAGDRVTPAVVAYRDTEQIVGIAAK 53



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/54 (42%), Positives = 35/54 (64%)
 Frame = +1

Query: 349 VVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           VV+  G P+ ++      K   PE+V+ ++  KMKETA++ LG  V++AVITVP
Sbjct: 91  VVNKSGLPRYEIDTGATTKYVSPEDVAKLIFHKMKETAQSALGSDVKDAVITVP 144



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/54 (40%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-TGERNVLIFDLGG 674
           F++ Q+ A + A   +G NVLR+I+EP+AA +AY + +    G+ +VL++ LGG
Sbjct: 147 FDEMQKNALRQAAESAGFNVLRLIHEPSAALLAYDIGQDSPLGKSHVLVYKLGG 200


>UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera
           aphidicola str. Cc (Cinara cedri)|Rep: Molecular
           chaperone - Buchnera aphidicola subsp. Cinara cedri
          Length = 499

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 30/57 (52%), Positives = 40/57 (70%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFN+ Q+   + A     L +LR++NEPTAAAIAYGL+KK  G   + ++DLGGGT
Sbjct: 142 AYFNNIQKNIVRKAAETVNLKILRLLNEPTAAAIAYGLEKKKKG--IICVYDLGGGT 196



 Score = 33.9 bits (74), Expect = 4.3
 Identities = 18/52 (34%), Positives = 26/52 (50%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           M K   +GID GTT S V      K++II N    +  PS +  ++ +  IG
Sbjct: 1   MKKKTIIGIDFGTTNSLVSTILEKKIKIINNFNKKKFFPSIIHISNKKISIG 52


>UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacifica
           SIR-1|Rep: Chaperone DnaK - Plesiocystis pacifica SIR-1
          Length = 539

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 30/57 (52%), Positives = 42/57 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F DSQR AT+ A  ++GL+V+R+INEPTAAA+AYG  +    +R + ++D GGGT
Sbjct: 146 ANFTDSQRSATRIAARLAGLDVIRVINEPTAAALAYGYIE--DMDRRIAVYDFGGGT 200



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV-AFTDTERLIGDAAKNQVAMTPT 263
           +GIDLGTT S   V + G+  ++     +R  PS V A ++ +  +G+ AK   ++ PT
Sbjct: 8   LGIDLGTTNSACAVVRDGRASVVRRGD-DRIVPSVVAALSNGQFAVGNEAKQLRSVDPT 65



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +1

Query: 325 RH-EALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVI 501
           RH E + +R+V +G    + +   G   +    E+SS +L  +K+ AE  LG+ V+ AVI
Sbjct: 86  RHRETVPYRIV-EGPNESVMIELGGRRLSIV--EISSQILRYLKDMAEEALGQRVKKAVI 142

Query: 502 TVP 510
            VP
Sbjct: 143 AVP 145



 Score = 33.1 bits (72), Expect = 7.5
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           DP   ++ AKRLIGR+F    VQ   +  P+ +
Sbjct: 63  DPTQVVYSAKRLIGRRFSSPEVQRHRETVPYRI 95


>UniRef50_Q010Y3 Cluster: DNAK_GLOVI Chaperone protein dnaK; n=1;
           Ostreococcus tauri|Rep: DNAK_GLOVI Chaperone protein
           dnaK - Ostreococcus tauri
          Length = 412

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 28/57 (49%), Positives = 43/57 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF+D+Q++AT  AG ++GL  ++++ EP AAA+AYG+D +   +  V +FDLGGGT
Sbjct: 189 AYFDDAQQEATIRAGQLAGLTTVKLLKEPVAAALAYGIDVE--EDETVFVFDLGGGT 243



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 2/57 (3%)
 Frame = +3

Query: 75  AKAPAV-GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK 239
           A+A  + GIDLGTT S V + + GK EI+A  QG+RT PS V F +D    +G  A+
Sbjct: 41  ARASGICGIDLGTTNSAVAIVRDGKAEIVA-CQGHRTIPSVVCFASDGSFSVGREAR 96



 Score = 39.5 bits (88), Expect = 0.086
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 3/59 (5%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGED---KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +RVV+        +A +GE+   +   PEEVS+ VL  + + AE  LG ++  AVIT+P
Sbjct: 130 YRVVNHPETKYASIAIEGENGETRLVAPEEVSACVLRTLLDAAEKELGTSIDKAVITIP 188


>UniRef50_Q20752 Cluster: Putative uncharacterized protein stc-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein stc-1 - Caenorhabditis elegans
          Length = 450

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 32/57 (56%), Positives = 40/57 (70%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A FN+ QR  T  A  I+ + V R+I+EPTAAA+AYGL KK  G  NV++ DLGGGT
Sbjct: 183 AEFNEKQRNFTAKAAEIAEMEVRRVISEPTAAALAYGLHKK-QGVENVVVVDLGGGT 238



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 5/71 (7%)
 Frame = +3

Query: 63  KYKMAKAPA--VGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTER-LIG 227
           KY +   P    GIDLGTTYS +G++    G+  I+ +D G ++ PS VAF      LIG
Sbjct: 25  KYGLPPPPPKIAGIDLGTTYSSIGIYHAVTGETIILPDDLGKKSVPSVVAFLPNGTVLIG 84

Query: 228 DAAKNQVAMTP 260
             A  Q    P
Sbjct: 85  TRATEQQEHNP 95



 Score = 36.7 bits (81), Expect = 0.61
 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 2/37 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFE--DATVQADMKHWPFELSV 358
           +P  TI+DAKR IGR FE  +    +D K +PF++++
Sbjct: 94  NPKRTIYDAKRFIGRNFEKNNKDFLSDQKRYPFKINL 130



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F++  D  GK   ++      K  +PEE+ S+++  +K  A  +LG T+   VI+ P
Sbjct: 126 FKINLDSEGKAFFEIPLDSGTKNVYPEEIGSLIIGYLKSAAAKHLGVTLGQVVISCP 182


>UniRef50_Q8YNT4 Cluster: DnaK-type molecular chaperone; n=2;
           Nostocaceae|Rep: DnaK-type molecular chaperone -
           Anabaena sp. (strain PCC 7120)
          Length = 712

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 28/57 (49%), Positives = 37/57 (64%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND QR AT+ A   +GL  L ++ EPTAAAI+YG        + +L++D GGGT
Sbjct: 130 AYFNDQQRYATRTAALKAGLTPLELLPEPTAAAISYGFSPDSEDVKTILVYDFGGGT 186


>UniRef50_Q9VUC1 Cluster: CG6603-PA, isoform A; n=7;
           Endopterygota|Rep: CG6603-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 804

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 64/209 (30%), Positives = 90/209 (43%), Gaps = 15/209 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GID G     V   + G +E +AND   R TPS+VAF        D  K  + +    Q
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAF--------DGKKRIIGVAAKNQ 55

Query: 270 YSMPNVSSDVSS-KMLLCK----PT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFH 434
             + N+ + V   K LL +    P     L+S     +    GSI G + N       F 
Sbjct: 56  -QVTNMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSI-GIKVNYLGEDQHFG 113

Query: 435 GAYENEGNCRSLSWQNCA-------ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
                      L   + A       +C      +F +++R+A  DA  I+GLNVLR++NE
Sbjct: 114 PEQLTAMLFTKLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNE 173

Query: 594 PTAAAIAYGLDKKGTGE---RNVLIFDLG 671
            TA A+AYG  K    E   RNV+  D G
Sbjct: 174 TTATALAYGFYKNDLFEDKPRNVIFVDFG 202



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 3/65 (4%)
 Frame = +1

Query: 325 RHE--ALAFRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNA 495
           +HE  ++  RV + G G   IKV Y GED+ F PE++++M+ TK+KET+ A +   V + 
Sbjct: 81  QHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFTKLKETSAAAMQTQVNDC 140

Query: 496 VITVP 510
           VI  P
Sbjct: 141 VIACP 145


>UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG07033;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG07033 - Caenorhabditis
           briggsae
          Length = 547

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 28/68 (41%), Positives = 46/68 (67%), Gaps = 1/68 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPT 263
           ++GIDLGTT+SCV  +Q+G+V ++ N+ G RTTPS +A T D + LIG  AK+ +    +
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNVLENENGCRTTPSVLAMTEDGDCLIGQHAKDVITKATS 61

Query: 264 TQYSMPNV 287
           + + +  +
Sbjct: 62  SLFDVKRI 69



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +++FD KR+IGR+F+D  +Q DM  WPF +
Sbjct: 61  SSLFDVKRIIGRRFDDVLLQRDMPLWPFRV 90


>UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to heat shock protein - Nasonia vitripennis
          Length = 523

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 41/81 (50%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           A FN  QR+ATK AG ++ LNV  II+EP AAA+AYGL+ K      VLIFDLGGGT   
Sbjct: 159 ANFNTIQREATKFAGEMAVLNV-SIISEPIAAALAYGLNHKINYNDYVLIFDLGGGTFDV 217

Query: 690 PSLPSRR-YLRGEIHRGDTHL 749
             +  +   L  E   GD HL
Sbjct: 218 SVVTMQNDILIVEATSGDQHL 238



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 12/70 (17%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVF------------QHGKVEIIANDQGNRTTPSYVAFTDTE 215
           M++ P++GIDLGTT + +  +              G V IIAN +G+RTTPS VAF + E
Sbjct: 1   MSEVPSIGIDLGTTNTVIAAWIPETNKDLNSTKSSGTVNIIANSKGHRTTPSCVAFNEKE 60

Query: 216 RLIGDAAKNQ 245
           RLIG +A +Q
Sbjct: 61  RLIGTSALSQ 70



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/68 (38%), Positives = 43/68 (63%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSM 522
           F VV   G+P  +V +K E K + P++++SM+L  +K+ AE+YL K + + VITVP    
Sbjct: 103 FAVVDKEGRPFYEVNHKSEIKYYSPQDIASMILEYVKQFAESYLTKKITDVVITVPANFN 162

Query: 523 TLKDKPQK 546
           T++ +  K
Sbjct: 163 TIQREATK 170



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 22/59 (37%), Positives = 35/59 (59%)
 Frame = +2

Query: 245 GGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPR 421
           G  +  NTI+ +KRLIGR+F D  V+A+ +HWPF +   E       + + + K +SP+
Sbjct: 71  GQRNSKNTIYSSKRLIGREF-DNEVKAESEHWPFAVVDKEGRPFYEVNHKSEIKYYSPQ 128


>UniRef50_A4QNX8 Cluster: Zgc:162281 protein; n=6; Eumetazoa|Rep:
           Zgc:162281 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 438

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 33/57 (57%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F++ QR  T  A  ++GL+VLR+INEPTAAA+AYGL K      NVL+ DLGGGT
Sbjct: 176 AEFDERQRNYTIRAANLAGLDVLRVINEPTAAAMAYGLHKAEV--FNVLVVDLGGGT 230



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           K   +G+DLGTT+  VGVFQ   G++EII +D+G ++ PS V+FT T    G   +    
Sbjct: 30  KPRVIGLDLGTTFCSVGVFQPGTGEIEIIEDDKGRKSIPSVVSFTLTGVFAGHEGQELSD 89

Query: 252 MTP 260
           + P
Sbjct: 90  VNP 92



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 16/39 (41%), Positives = 27/39 (69%)
 Frame = +2

Query: 236 QEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           QE    +P NTI+DAKR IG+ F++ T++ +   +PF++
Sbjct: 85  QELSDVNPQNTIYDAKRFIGKIFDEETLEKESARYPFKV 123



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 21/56 (37%), Positives = 30/56 (53%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+ + G     V       T  PE + S +L KM++ AE  LG  V+ AVI+VP
Sbjct: 121 FKVIFNNGSADFLVN-TNSTFTVTPEFIGSRLLLKMRKMAEKQLGVPVEKAVISVP 175


>UniRef50_Q4XZF4 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 128

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
 Frame = +3

Query: 66  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKN 242
           +  A    +GIDLGTT SCV + +  + ++I N +G RTTPS VAFT D +RL+G  AK 
Sbjct: 36  HNRASGDIIGIDLGTTNSCVAIMEGKQGKVIENAEGFRTTPSVVAFTNDNQRLVGIVAKR 95

Query: 243 QVAMTP 260
           Q    P
Sbjct: 96  QAITNP 101


>UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera
           aphidicola (Baizongia pistaciae)|Rep: Chaperone protein
           hscA - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 511

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 30/57 (52%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A+FND QRQ  K +  ++ LN++R++NEPT+AAIAYGL       + V I+DLGGGT
Sbjct: 158 AHFNDLQRQEIKKSAELANLNIIRLLNEPTSAAIAYGLHL--NKNKIVAIYDLGGGT 212



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 1/59 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRT-TPSYVAFTDTERLIGDAAKNQVAMTP 260
           ++GID GTTYS V       + II  DQ NR   PS + +T  + ++G  A+ Q    P
Sbjct: 21  SIGIDFGTTYSLVASALEDNIYIIL-DQNNRALLPSIINYTSKKPIVGWEAQKQAINDP 78


>UniRef50_A2EAK8 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 615

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 31/60 (51%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG---LDKKGTGERNVLIFDLGGGT 680
           A FN +QR+AT +A T +GLN LR++NEPTAAA  Y    L K  T ++ V++FD G GT
Sbjct: 163 AKFNTNQRKATLNAATKAGLNCLRLVNEPTAAAFCYKVHCLGKDDTSKKTVIVFDFGAGT 222


>UniRef50_A5N5I5 Cluster: DnaK1; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK1 - Clostridium kluyveri DSM 555
          Length = 521

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 27/57 (47%), Positives = 44/57 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF   QR+ATK+A   +G NVLR++ EP+AAA++YG+++    ++ ++++DLGGGT
Sbjct: 118 AYFTSEQRKATKNAARKAGFNVLRLMAEPSAAAVSYGINQ--NKDQIIMVYDLGGGT 172



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/58 (43%), Positives = 35/58 (60%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           VGIDLGTT S +   + GKVE I  D G  T PS V+ ++ + + G  AK ++ M P+
Sbjct: 5   VGIDLGTTNSVISCVKRGKVETILLD-GKNTFPSVVSISNGKIITGYPAKAKLIMDPS 61


>UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;
           Orientia tsutsugamushi Boryong|Rep: Heat shock chaperone
           protein hscA - Orientia tsutsugamushi (strain Boryong)
           (Rickettsia tsutsugamushi)
          Length = 616

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 30/57 (52%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A+F+D+ R + K A  I+ L+VLR+I+EPTAAA +YGLDK   G    L++D GGGT
Sbjct: 155 AHFDDAARNSIKQAAKIADLDVLRLISEPTAAAYSYGLDKGSNGV--YLVYDFGGGT 209



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 2/58 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL--IGDAAKNQVAMT 257
           VGID GTT S V    + K  +IAN QG    PS V+F     +  IG   K+ +A+T
Sbjct: 21  VGIDFGTTNSLVAHSINSKAYVIANSQGLNKLPSIVSFNHEGNVISIGSKEKHYIAIT 78



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +1

Query: 400 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           DKT  P E+S+ ++ ++K  AE Y  + ++ AVI+VP
Sbjct: 118 DKTISPIEISAKIINQLKLQAEQYFNQKIKKAVISVP 154


>UniRef50_UPI0000499E28 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 480

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 34/81 (41%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYF+DSQ+  TK A  ++G +++R++ EP+AAA AYGL+   T ++  L FDLGGGT   
Sbjct: 149 AYFDDSQKDRTKKAVLMAGFSLIRLLAEPSAAAYAYGLE--STKDQMYLAFDLGGGTLDV 206

Query: 690 PSLPSR-RYLRGEIHRGDTHL 749
             L  +    +     GD HL
Sbjct: 207 TILEKKGEEFKFRATGGDVHL 227



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 22/46 (47%), Positives = 24/46 (52%), Gaps = 2/46 (4%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAF 203
           M +   VGIDLGTT+ C   F  Q  K E I    GN T PS V F
Sbjct: 1   MQQETVVGIDLGTTFCCCHFFNTQTNKYECINYLNGNSTIPSTVDF 46


>UniRef50_A6UND5 Cluster: 2-alkenal reductase; n=1; Methanococcus
           vannielii SB|Rep: 2-alkenal reductase - Methanococcus
           vannielii SB
          Length = 573

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/57 (50%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F +  R+AT + G ++GLNVL +INEPTAAA+A+G+    + E N+ +FD GGGT
Sbjct: 116 ANFAEPARKATYNIGKLAGLNVLGLINEPTAAALAFGIRNLSSNE-NIAVFDFGGGT 171



 Score = 40.3 bits (90), Expect = 0.049
 Identities = 16/38 (42%), Positives = 27/38 (71%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           E++ FF EE+ + +L K+ + AE YLG+ + + V+TVP
Sbjct: 78  ENQEFFAEELEAHILKKLVKNAEDYLGEKISDVVVTVP 115



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGK-VEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           P +GIDLGT+ S + VF+ GK + I   +  +   PS +A  ++E ++G  AK
Sbjct: 4   PIIGIDLGTSTSEIFVFKDGKQMPINDPESDSSVVPSIIAMQNSEIIVGSQAK 56


>UniRef50_P48723 Cluster: Stress 70 protein chaperone
           microsome-associated 60 kDa protein precursor; n=19;
           Tetrapoda|Rep: Stress 70 protein chaperone
           microsome-associated 60 kDa protein precursor - Homo
           sapiens (Human)
          Length = 471

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/57 (54%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGT 230



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 31/75 (41%), Positives = 42/75 (56%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSM 522
           F+V++  G  +  V    E  T  PE V S +L K+KE AEAYLG  V NAVI+VP    
Sbjct: 121 FKVLNKNGMVEFSVT-SNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVP-AEF 178

Query: 523 TLKDKPQKMQVPSLA 567
            LK +   ++  +LA
Sbjct: 179 DLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 15/38 (39%), Positives = 25/38 (65%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           E    +P NTI+DAKR IG+ F    ++A++  +PF++
Sbjct: 86  ELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKV 123


>UniRef50_UPI0000499681 Cluster: heat shock protein 70; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 527

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYF++SQ+  TK A  ++G +++R++ EP+AAA AYGL+   T ++  L+FDLGGGT   
Sbjct: 154 AYFDNSQKDRTKKAVLMAGFSLIRLLAEPSAAAYAYGLE--STKDQMYLVFDLGGGTLDV 211

Query: 690 PSLPSR------RYLRGEIHRG 737
             L  +      R + G++H G
Sbjct: 212 TILEKKGEEFKFRAIGGDVHLG 233



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 21/40 (52%), Positives = 22/40 (55%), Gaps = 2/40 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAF 203
           VGIDLGTT+ C   F  Q  K E I    GN T PS V F
Sbjct: 10  VGIDLGTTFCCCHFFNTQTNKYECIYYLNGNSTIPSTVDF 49


>UniRef50_A3BBU4 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 340

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/41 (73%), Positives = 35/41 (85%)
 Frame = +3

Query: 558 ISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           I+GL + RIINEPTA AIAY +DKKGT E++VLIFDLGG T
Sbjct: 99  IAGLTIDRIINEPTAGAIAYDIDKKGT-EKSVLIFDLGGNT 138



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 24/37 (64%), Positives = 30/37 (81%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTP 188
           +   +GI+LGTTYS VGV+++G VEIIANDQGN  TP
Sbjct: 40  RCTVIGINLGTTYSWVGVYRNGIVEIIANDQGNHITP 76


>UniRef50_A7RF55 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 391

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           MA   A+G+ LG T SCV V   G   IIAND G+R TP+ VAF+DTE+ +G  AK
Sbjct: 1   MADYLAIGVHLGATTSCVAVSADGNTTIIANDAGDRVTPAMVAFSDTEKNVGLPAK 56



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           F + +    ++A   +G ++LRIINEP AAA+AYG+         VL++ LGG +
Sbjct: 150 FQEKEVSLLREAAEEAGFHILRIINEPVAAALAYGM-----YNTTVLVYRLGGAS 199



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = +1

Query: 334 ALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           AL  +++   G P  +V     +    P+EV +M+  KM ETA+++ G +  + V+TVP
Sbjct: 89  ALQCKLIDKDGLPYYEVESNERNIQVSPKEVINMIYKKMLETAQSHCGSSSNHVVLTVP 147


>UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 759

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 29/57 (50%), Positives = 40/57 (70%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AY+N+ QR A + A  ++GL V RI+NEPTAAA+AY   +     + VL++DLGGGT
Sbjct: 333 AYYNERQRAAVRHAAALAGLQVERILNEPTAAALAYAYGRH--LNQRVLVYDLGGGT 387



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMTPTT 266
           VGIDLGTT SC  V + G+  +I + +G+ T PS VA     R ++G  AK Q+   P  
Sbjct: 194 VGIDLGTTNSCAAVVKDGRPYVIPSREGHNTVPSIVALNARHRVVVGHLAKAQLLTNPKA 253

Query: 267 QYS 275
             S
Sbjct: 254 TVS 256



 Score = 33.1 bits (72), Expect = 7.5
 Identities = 14/37 (37%), Positives = 27/37 (72%)
 Frame = +1

Query: 400 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           ++T   E++S++VL ++++ A+ +L + V  AVITVP
Sbjct: 296 EETVTLEQISALVLREVRDVAQNHLREEVNRAVITVP 332



 Score = 32.7 bits (71), Expect = 9.9
 Identities = 23/76 (30%), Positives = 36/76 (47%)
 Frame = +2

Query: 125 WCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCRQEPGGDDPNNTIFDAKRLIGRKF 304
           + +P+REG  H   P     S++    RHR       +     +P  T+  AKRLIGR +
Sbjct: 214 YVIPSREG--HNTVP-----SIVALNARHRVVVGHLAKAQLLTNPKATVSGAKRLIGRAW 266

Query: 305 EDATVQADMKHWPFEL 352
           +   VQ     +P+E+
Sbjct: 267 DTPVVQEIRAKFPYEI 282


>UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2;
           Pansporablastina|Rep: Mitochondrial-like Hsp70 -
           Trachipleistophora hominis
          Length = 543

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 29/57 (50%), Positives = 43/57 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFN +QR+ TK AG ++GL VLR++NEPT+AA+ + +    TG  ++ ++DLGGGT
Sbjct: 142 AYFNHTQREETKKAGELAGLKVLRVLNEPTSAALNHAI----TG--HIAVYDLGGGT 192



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 28/79 (35%), Positives = 44/79 (55%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K   VGIDLGTT SC+ + Q     II N +G RTTPS +  +    ++G  A+ ++ 
Sbjct: 1   MSKPAIVGIDLGTTNSCISIMQDNVATIIENQEGQRTTPSVINISGENVIVGKPAQRKLL 60

Query: 252 MTPTTQYSMPNVSSDVSSK 308
             P  ++++ NV   +  K
Sbjct: 61  TDP--EHTIFNVKRLIGRK 77



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F V+ D G+ KIKV    +DK + P ++SS VL+K++  AE++L + V+ AVITVP
Sbjct: 88  LPFSVIDDNGELKIKV----DDKRYEPAKLSSFVLSKLRSAAESFLSRPVKFAVITVP 141



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 25/57 (43%), Positives = 34/57 (59%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           DP +TIF+ KRLIGRK+ D  V+   K  PF  SV++ N   +  I+V  K + P K
Sbjct: 62  DPEHTIFNVKRLIGRKYAD--VKEYTKRLPF--SVIDDNGELK--IKVDDKRYEPAK 112


>UniRef50_UPI000038E267 Cluster: hypothetical protein Faci_03001788;
           n=1; Ferroplasma acidarmanus fer1|Rep: hypothetical
           protein Faci_03001788 - Ferroplasma acidarmanus fer1
          Length = 565

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 25/58 (43%), Positives = 40/58 (68%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTS 683
           AYFN++QR AT++A  I+G+ V + ++EP A AI+Y         +N+L+FD+G GT+
Sbjct: 125 AYFNNNQRNATREAAAIAGIKVKQFVSEPAAVAISYWNRASKAEAKNILVFDMGSGTT 182


>UniRef50_A2G573 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 621

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 31/60 (51%), Positives = 43/60 (71%), Gaps = 3/60 (5%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG---LDKKGTGERNVLIFDLGGGT 680
           A F+ +QR+ TK A  ++GL+V++ I+EPTAAAIAY     D+  TG++ VLIFD G GT
Sbjct: 145 ALFSPNQRECTKTAAELAGLDVIQFISEPTAAAIAYKDTIKDQGVTGKQTVLIFDFGAGT 204



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           P    + +KRLIGRKF D  VQ  +K  P+E+
Sbjct: 64  PERVAYGSKRLIGRKFNDPYVQNFIKTCPYEI 95


>UniRef50_A7QL81 Cluster: Chromosome chr3 scaffold_117, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr3 scaffold_117, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 103

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 27/34 (79%), Positives = 30/34 (88%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
           AYFNDSQRQATKDAG I+GLN++ IINEPT A I
Sbjct: 21  AYFNDSQRQATKDAGVITGLNLMHIINEPTTAEI 54


>UniRef50_A2DR00 Cluster: DnaK protein; n=7; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 615

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 31/73 (42%), Positives = 46/73 (63%)
 Frame = +3

Query: 462 RSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG 641
           +S + +   +C     A FND+QR ATK A  I+ LNV + ++EPTAAAIAY  + +   
Sbjct: 137 KSATGKEATDCVITVPANFNDAQRNATKTAARIANLNVRKFLSEPTAAAIAY-YNIEPKD 195

Query: 642 ERNVLIFDLGGGT 680
           + ++L+FD G GT
Sbjct: 196 KIHLLVFDFGAGT 208



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 17/38 (44%), Positives = 25/38 (65%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + K + PEE+SS +L  +KET ++  GK   + VITVP
Sbjct: 115 DGKKYMPEEISSFLLEHVKETYKSATGKEATDCVITVP 152



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           ++P+  IF AKRLIG K+ D  VQ   ++  FE+
Sbjct: 69  NNPSRVIFGAKRLIGHKYHDRPVQELFENVGFEI 102


>UniRef50_A6NJU0 Cluster: Uncharacterized protein HSPA14; n=2;
           Eutheria|Rep: Uncharacterized protein HSPA14 - Homo
           sapiens (Human)
          Length = 143

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53


>UniRef50_Q0VDF9 Cluster: Heat shock 70 kDa protein 14; n=25;
           Euteleostomi|Rep: Heat shock 70 kDa protein 14 - Homo
           sapiens (Human)
          Length = 509

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 1/54 (1%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-TGERNVLIFDLGG 674
           F + Q+ A  +A   +G NVLR+I+EP+AA +AYG+ +   TG+ N+L+F LGG
Sbjct: 147 FGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGG 200



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 349 VVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           V+   GK + ++    E K   PE+V+ ++ +KMKETA + LG    + VITVP
Sbjct: 91  VIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVVITVP 144


>UniRef50_A6NYB9 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 437

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 32/66 (48%), Positives = 43/66 (65%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYF+D+QRQAT  A  ++GL+V+ +INEPTAAAI     ++       L+FDLGGGT   
Sbjct: 93  AYFSDNQRQATIKAAQLAGLDVVGLINEPTAAAIYASKSRQALS----LVFDLGGGTFDV 148

Query: 690 PSLPSR 707
             + SR
Sbjct: 149 SVVDSR 154


>UniRef50_A5MZQ6 Cluster: DnaK8; n=2; Clostridium kluyveri DSM
           555|Rep: DnaK8 - Clostridium kluyveri DSM 555
          Length = 530

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 27/57 (47%), Positives = 41/57 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F D+ ++AT +A  I+GL VL ++ EP AAAI YG +   + ++N+L++DLGGGT
Sbjct: 131 ANFTDNAKRATMEAAEIAGLEVLYLLEEPVAAAIRYGFN--SSKDQNILVYDLGGGT 185



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI-GDAAKNQ 245
           +GIDLGT+ S   V+  GK  II  D G    PS V+F D+E +I G  AK +
Sbjct: 12  LGIDLGTSTSIASVYTKGKSRIIKID-GKEYIPSVVSFLDSETIIVGSQAKGR 63


>UniRef50_A5B0E9 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 318

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 1/39 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEP-TAAAIAYGL 623
           AYFND+QRQATKD G ISGL+V RIINEP TAAA  +GL
Sbjct: 97  AYFNDAQRQATKDVGRISGLDVQRIINEPTTAAARGHGL 135


>UniRef50_Q54GD7 Cluster: Heat shock protein Hsp70 family protein;
           n=2; Dictyostelium discoideum|Rep: Heat shock protein
           Hsp70 family protein - Dictyostelium discoideum AX4
          Length = 772

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 30/74 (40%), Positives = 51/74 (68%), Gaps = 2/74 (2%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--GTGERNVLIFDLGGGTST 686
           ++ND QR+A  +AG+I+GLN++R+INE TA A++YG+ K+   T   NVL  D+G    +
Sbjct: 148 FWNDYQRRAILNAGSIAGLNIIRLINETTATALSYGIYKEWSETDPTNVLFVDVG---DS 204

Query: 687 CPSLPSRRYLRGEI 728
             S+ + +Y +G++
Sbjct: 205 ATSVSAVQYKKGQL 218



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           VG D GT    + V Q G V++IAN+  NR TPS V+F + ER +G++A
Sbjct: 5   VGFDFGTKNCTIAVAQKGGVDVIANEVSNRLTPSMVSFGEKERYLGESA 53



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +1

Query: 358 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           D G     V Y GE  +F  E +  M+  K+K+T EA++   V++ VI+VP
Sbjct: 96  DNGFVGYNVTYAGEQCSFSSEAILGMLFGKLKKTTEAFVNNPVRDVVISVP 146



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVME 364
           NTI + KR IG++F+  TVQ ++KH  F+   M+
Sbjct: 63  NTITNIKRFIGQEFKTDTVQEELKHEMFQSYEMD 96


>UniRef50_Q3W504 Cluster: Heat shock protein Hsp70; n=3;
           Actinomycetales|Rep: Heat shock protein Hsp70 - Frankia
           sp. EAN1pec
          Length = 586

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 12/69 (17%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERN------------V 653
           AYF D +R+AT  AG  +GLNV+ +INEPTAAA++YG  +   G R              
Sbjct: 92  AYFGDEERRATVLAGEYAGLNVVDVINEPTAAALSYGFARFEVGSRRTLTGPGTIAEEVA 151

Query: 654 LIFDLGGGT 680
           L++DLGGGT
Sbjct: 152 LVYDLGGGT 160


>UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14;
           Rickettsia|Rep: Chaperone protein hscA homolog -
           Rickettsia felis (Rickettsia azadi)
          Length = 637

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 31/57 (54%), Positives = 38/57 (66%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A+FND+ R     A  I+G  VLR+I EPTAAA AYGL+K   G    L++DLGGGT
Sbjct: 150 AHFNDAARGEVMLAAKIAGFEVLRLIAEPTAAAYAYGLNKNQKG--CYLVYDLGGGT 204



 Score = 39.5 bits (88), Expect = 0.086
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +3

Query: 66  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD 230
           +K  +  AVGID GTT S + +  + KV++I +       P+ + FT+   +IG+
Sbjct: 14  FKQERQIAVGIDFGTTNSLIAIATNRKVKVIKSRDDKELIPTTIDFTNENFIIGN 68


>UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia
           burgdorferi group|Rep: Heat shock protein 70 - Borrelia
           burgdorferi (Lyme disease spirochete)
          Length = 491

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GIDLGTT +    F     +II N++G R TPS V+F+D + L+G AAKNQ+ + P  Q
Sbjct: 7   IGIDLGTTNTVASYFDVSS-KIILNERGERITPSIVSFSDKDVLVGSAAKNQILVNP--Q 63

Query: 270 YSMPNVSSDVSS 305
            +  N  +++ S
Sbjct: 64  KTFYNFKTNIGS 75



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 29/57 (50%), Positives = 39/57 (68%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF++ QR+   +A   +GLN   I+NEPTAAAIAY  +++  G    LI+DLGGGT
Sbjct: 120 AYFSEIQRRCVVEAANFAGLNCKAILNEPTAAAIAYAFERQIDG--IFLIYDLGGGT 174



 Score = 36.7 bits (81), Expect = 0.61
 Identities = 16/41 (39%), Positives = 27/41 (65%)
 Frame = +1

Query: 388 YKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           YK + + +  E +S+ +L  +K  AE +L + ++NAVITVP
Sbjct: 79  YKVDGEFYKAEYISAHLLASVKRNAEKFLDEEIENAVITVP 119


>UniRef50_A2F432 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 629

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY--GLDKKGTGE-RNVLIFDLGGGT 680
           A FN +QR+AT++A   +GLN LR++NEPTAAA AY   LD+    E + +++FD G GT
Sbjct: 158 ANFNTNQRRATQNAAQKAGLNCLRLVNEPTAAAFAYKQSLDEVTLRENQTIIVFDFGAGT 217



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 2/56 (3%)
 Frame = +1

Query: 349 VVSDGGKPKIKVAYKGEDKTFF--PEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +V+   KP  K+ ++  +KT++  PE+VSS +L  ++ET     G  +   VITVP
Sbjct: 102 IVNQDNKPLYKITFEDYNKTYYKKPEDVSSDLLGFVRETFAKCHGSQIDACVITVP 157


>UniRef50_Q9XZM1 Cluster: Heat shock protein HSP70-2; n=3; Entamoeba
           histolytica|Rep: Heat shock protein HSP70-2 - Entamoeba
           histolytica
          Length = 244

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/39 (66%), Positives = 31/39 (79%)
 Frame = +3

Query: 564 GLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           GL V+ IINEPTAAAIAYG DKK    + +L+FD+GGGT
Sbjct: 1   GLEVIGIINEPTAAAIAYGYDKKYCEGKTILVFDIGGGT 39


>UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2;
           Actinomycetales|Rep: Heat shock protein HSP70 -
           Saccharopolyspora erythraea (strain NRRL 23338)
          Length = 555

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYF   +R ATK+AG I+GL+V+ I+ EP AAA+ Y        +R +L++DLGGGT
Sbjct: 125 AYFGMLERTATKNAGQIAGLDVIGIVPEPVAAALHYEATTDAE-DRTILVYDLGGGT 180



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 93  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTPTT 266
           GIDLGTTYS +  V + G+  +  N     TTPS V F  ++  ++G  AKN     P  
Sbjct: 10  GIDLGTTYSAIAYVDETGRPAVCRNTDSLETTPSVVFFENESNVVVGSVAKNSAITYPDQ 69

Query: 267 QYSM 278
             S+
Sbjct: 70  VVSL 73



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +1

Query: 379 KVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +  Y     T+ PE +S+++L ++ + A  + G     AVITVP
Sbjct: 81  EAVYDYHGTTYTPESISALILKQLAQDAATHTGGPATRAVITVP 124


>UniRef50_Q2QXK2 Cluster: DnaK protein, expressed; n=2; Oryza
           sativa|Rep: DnaK protein, expressed - Oryza sativa
           subsp. japonica (Rice)
          Length = 461

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 2/81 (2%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGTSTC 689
           YF+D  R+A  +A  ++GL  +RII+EPTAAA+++GL      +  NVL+  +GGGTS  
Sbjct: 187 YFSDGPREAAMNAARMAGLTTVRIIDEPTAAAVSHGLHHGRLRDGGNVLVLHVGGGTSAA 246

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L            R D HL
Sbjct: 247 TVLTYDNAVFEAVASRHDAHL 267



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 3/42 (7%)
 Frame = +1

Query: 394 GEDKTFFPEEVSSMVLTKMKETAEAYL---GKTVQNAVITVP 510
           G  ++ +  +V+SMV+ ++K  AEA L   GK V NAV+TVP
Sbjct: 144 GAARSVYASDVASMVIAELKARAEARLAGGGKKVHNAVVTVP 185



 Score = 33.1 bits (72), Expect = 7.5
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA 251
           + +DLG T SCV  +     E  A        P+ VAFT D + L+G+AAKN  A
Sbjct: 47  IAVDLGNTNSCVAGYGD---EADAPPLFRLCIPTSVAFTGDGDALVGEAAKNHPA 98


>UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: 70 kD heat
           shock protein - Saccharopolyspora erythraea (strain NRRL
           23338)
          Length = 538

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 28/58 (48%), Positives = 43/58 (74%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY-GLDKKGTGERNVLIFDLGGGT 680
           AYF  ++++AT+ AG I+GLNVL ++ EP AAA+ + GL+      R++L++DLGGGT
Sbjct: 125 AYFGVAEKEATRRAGEIAGLNVLDVLAEPVAAALHHQGLESTDRA-RHLLVYDLGGGT 181



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 30/66 (45%), Positives = 36/66 (54%), Gaps = 3/66 (4%)
 Frame = +3

Query: 72  MAKAPAV-GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKN 242
           MA  P   GIDLGTT+SCV  V + G+  I  N     TTPS V F    R L+G +AKN
Sbjct: 1   MAAPPTTFGIDLGTTHSCVAYVDESGRPVIARNAVSEDTTPSVVYFEGPGRVLVGSSAKN 60

Query: 243 QVAMTP 260
              + P
Sbjct: 61  SALLAP 66



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 19/54 (35%), Positives = 34/54 (62%)
 Frame = +1

Query: 349 VVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           V  D G+  ++  Y G  + + PEE+S+++L ++  +AE   G+ V++ VITVP
Sbjct: 73  VKRDMGRQGVEFGYHG--RAYTPEEISALILRELARSAEESTGRQVRDVVITVP 124


>UniRef50_A4AEG2 Cluster: Putative uncharacterized protein; n=1;
           marine actinobacterium PHSC20C1|Rep: Putative
           uncharacterized protein - marine actinobacterium
           PHSC20C1
          Length = 98

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = -3

Query: 256 VIATWFLAASPMRRSVS-VNAT*DGVVLLPWSLAMISTFPCWKTPTQEYVVPRSIPTAGA 80
           ++  W  A SP R S S VNAT DGVV +P + AM    P  +T T E+VVPRSIPTA A
Sbjct: 10  LVTAWRFAVSPTRTSPSLVNATTDGVVRIPSAFAMTVGSPPSRTATTEFVVPRSIPTARA 69


>UniRef50_Q4SW20 Cluster: Chromosome undetermined SCAF13693, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF13693,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 857

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 29/57 (50%), Positives = 40/57 (70%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F++ QR  T  A  ++GL VLR+I+EPTAAA+AYG+ +      +VL+ DLGGGT
Sbjct: 171 ADFDERQRNYTVKAAQLAGLEVLRVISEPTAAAMAYGVHRAEV--LSVLVVDLGGGT 225



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +G+DLGTT+  VGVF    G+VE++A+ +G R+ PS V+FT    L+G  A  Q    P
Sbjct: 32  IGLDLGTTFCSVGVFYPGSGEVEVLADAEGRRSIPSCVSFTAAAVLVGHEAAEQADRNP 90



 Score = 32.7 bits (71), Expect = 9.9
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQAD 328
           E    +P NTI+DAKR IG+ FE   ++ +
Sbjct: 84  EQADRNPRNTIYDAKRFIGKLFEPGVLERE 113


>UniRef50_Q22CW2 Cluster: Heat shock protein 70 homolog; n=1;
           Tetrahymena thermophila SB210|Rep: Heat shock protein 70
           homolog - Tetrahymena thermophila SB210
          Length = 146

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVA-FTDTERLIGDAAKNQVA 251
           +GIDLGTT SCV + +    +II N +G RTTPS VA   D  RL+G  AK QV+
Sbjct: 27  IGIDLGTTNSCVAIMEGSAPKIIENAEGFRTTPSVVAILPDGSRLVGAPAKRQVS 81


>UniRef50_UPI0000499AA8 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 757

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGERNVLI 659
           +C      YF ++QR A  DA  I+G++ LR++NE TA A+AYG+   D   T  R V+I
Sbjct: 140 DCVISVPGYFTENQRIAMLDAAKIAGISCLRLMNEHTATALAYGIYKTDLSETEPRPVVI 199

Query: 660 FDLGGGTSTC 689
            D+G   +TC
Sbjct: 200 LDVGHCNTTC 209



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 22/49 (44%), Positives = 32/49 (65%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDA 233
           AVGID+G     V V +   ++I+ N+  NR TP++V+F D ER IG+A
Sbjct: 4   AVGIDIGNRNITVAVVRKKGIDIVVNEVSNRQTPTFVSFNDKERAIGEA 52



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/51 (35%), Positives = 30/51 (58%)
 Frame = +1

Query: 358 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + G   +KV  +GE K F PE++ +M+L ++K+  E Y      + VI+VP
Sbjct: 96  EDGMIGMKVMMRGEQKVFRPEQIIAMLLIQIKQFTEEYTKDIFTDCVISVP 146



 Score = 36.7 bits (81), Expect = 0.61
 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFE-LSVMEANLRSR*HIRVKTKPFSPRKSV 430
           NT+ D KRLIGR+++   VQ ++K  P++ + + +  +  +  +R + K F P + +
Sbjct: 63  NTVVDVKRLIGRQYDCPDVQTELKELPYQTVKLEDGMIGMKVMMRGEQKVFRPEQII 119


>UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 605

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 31/81 (38%), Positives = 42/81 (51%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           A F+  QR AT  A  I+G+ V+ ++NEPTAAAIAY   +        ++ D GGGT   
Sbjct: 152 ANFSSEQRDATAAAAEIAGIEVIELVNEPTAAAIAYDKSQTLINGGKYIVIDFGGGTFDV 211

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             +  S +        GDTHL
Sbjct: 212 SIVTVSDKEFTVNATDGDTHL 232


>UniRef50_UPI0000498597 Cluster: chaperone protein dnaK; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: chaperone protein
           dnaK - Entamoeba histolytica HM-1:IMSS
          Length = 523

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 28/57 (49%), Positives = 36/57 (63%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F D Q+ AT  A  + GL+V++I+ EPTAAA AYG+D+      N   FD GGGT
Sbjct: 144 ATFTDQQKDATLCAAQLGGLDVIQILPEPTAAAYAYGVDQ---NNGNFFAFDFGGGT 197


>UniRef50_A6CBP2 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 671

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           M K  AVGIDLGTTYSC+  + +HG+   I N +G  +TPS   F   E ++G  A    
Sbjct: 1   MQKIQAVGIDLGTTYSCIAHLNEHGEPVTIPNQEGELSTPSVAMFDGAEVIVGTEALRHA 60

Query: 249 AMTP 260
            + P
Sbjct: 61  IVNP 64



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 29/63 (46%), Positives = 39/63 (61%), Gaps = 6/63 (9%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG------TGERNVLIFDLG 671
           A F+D QRQ T  AG  +GL  + +INEP AAA+ Y L  +G        E+ +L++DLG
Sbjct: 122 AQFSDLQRQETIAAGKQAGLKQVDLINEPVAAALCYVLGAEGMWFAELAEEQRILVYDLG 181

Query: 672 GGT 680
           GGT
Sbjct: 182 GGT 184


>UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena
           thermophila SB210|Rep: dnaK protein - Tetrahymena
           thermophila SB210
          Length = 1213

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/58 (41%), Positives = 36/58 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           +GID G TYS V + Q G++ II N+ GN  TPS V+F + +  +G+ A +Q    P+
Sbjct: 28  IGIDFGNTYSSVAIVQEGQLIIIPNEYGNTETPSVVSFAEDKIFVGEQAIHQYQNNPS 85



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/56 (39%), Positives = 35/56 (62%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           Y +D+Q+Q   +A +I+GL V R  N+  AA  +Y L+ +   ++N L+F LGG T
Sbjct: 747 YLSDAQKQTMVNAASIAGLEVKRFFNDYKAAIHSYDLEDQN--DKNALVFHLGGAT 800



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/57 (38%), Positives = 37/57 (64%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AY + SQ+Q+  +A +I+GL V  ++N+  AA  +Y L+ +   ++N L+F LGG T
Sbjct: 167 AYLSYSQKQSIVNAASIAGLEVQFVLNDYKAAIHSYDLEDQN--DKNALVFHLGGAT 221



 Score = 37.9 bits (84), Expect = 0.26
 Identities = 18/50 (36%), Positives = 33/50 (66%)
 Frame = +1

Query: 418 EEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSMTLKDKPQKMQVPSLA 567
           EEV++M+L+KMK+ AE +LG  ++ A+++ P T ++   K   +   S+A
Sbjct: 715 EEVTAMILSKMKQIAENFLGNEIKYAILSFP-TYLSDAQKQTMVNAASIA 763



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 13/31 (41%), Positives = 25/31 (80%)
 Frame = +1

Query: 418 EEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           EEV++ +L+KMK+ AE +LG  ++ A++++P
Sbjct: 136 EEVTAKILSKMKQIAENFLGTEIKYAILSIP 166


>UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia
           intestinalis|Rep: GLP_54_20127_18205 - Giardia lamblia
           ATCC 50803
          Length = 640

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNV-LIFDLGGGT 680
           AYFN+ QR+AT+ AG ++ L+V+R+++EPTAAA+ Y  +       E  + ++ D GGGT
Sbjct: 156 AYFNNDQRRATELAGQLANLDVIRVLSEPTAAALLYNYNSSSNKIKENEIFVVIDAGGGT 215



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 4/56 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER----LIGDAAKNQ 245
           +G DLGTT SCV     G   ++    G+RT PS V +   E     L+G  A+ Q
Sbjct: 9   LGFDLGTTNSCVSTMVSGVPTVLPMLDGSRTVPSVVGYLPLEARDTPLVGAEAERQ 64



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           NTI  +KRLIGR+F DA V+   KH  +++
Sbjct: 71  NTINASKRLIGRRFTDAEVKRAAKHVSYDI 100


>UniRef50_Q9Y4L1 Cluster: Hypoxia up-regulated protein 1 precursor;
           n=39; Deuterostomia|Rep: Hypoxia up-regulated protein 1
           precursor - Homo sapiens (Human)
          Length = 999

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 22/62 (35%), Positives = 43/62 (69%), Gaps = 3/62 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGGGTS 683
           +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G G++
Sbjct: 179 FFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGST 238

Query: 684 TC 689
            C
Sbjct: 239 VC 240



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93



 Score = 33.9 bits (74), Expect = 4.3
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F PEEV  MVL   +  AE +  + +++AVITVP
Sbjct: 144 FSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVP 177


>UniRef50_UPI00015B551B Cluster: PREDICTED: similar to
           ENSANGP00000015293; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000015293 - Nasonia
           vitripennis
          Length = 822

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERNV 653
           +C     +YF  ++RQA  DA  I+GLNVLR+ NE TA A+ YG+ K+         RNV
Sbjct: 142 DCVISVPSYFTQAERQALLDAARIAGLNVLRLFNETTATALTYGIYKQDLPPPDAAPRNV 201

Query: 654 LIFDLG 671
           +  D G
Sbjct: 202 VFVDCG 207



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 27/59 (45%), Positives = 35/59 (59%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           MA    +GID G     + V + G +E IAND   R TPS VAF+   R++G AAKNQ+
Sbjct: 1   MAAMSVIGIDFGNDNCYIAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQL 59



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/62 (38%), Positives = 39/62 (62%), Gaps = 2/62 (3%)
 Frame = +1

Query: 331 EALAFRV--VSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVIT 504
           ++L +R   ++DGG   I V Y  ED  F PE++++M+ TK+K+T+   L   V + VI+
Sbjct: 88  QSLPYRTSQLADGGIG-IHVQYLNEDHVFTPEQITAMLFTKLKDTSVTALQTAVNDCVIS 146

Query: 505 VP 510
           VP
Sbjct: 147 VP 148



 Score = 33.1 bits (72), Expect = 7.5
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           NTI+  KRL+GRK+ D   Q +++  P+  S
Sbjct: 65  NTIYGFKRLLGRKYNDPFAQKELQSLPYRTS 95


>UniRef50_Q96269 Cluster: Heat-shock protein; n=14;
           Magnoliophyta|Rep: Heat-shock protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 831

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 3/64 (4%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGERNVLI 659
           +C      YF D QR+A  DA TI+GL+ LR+I+E TA A+AYG+   D   + + NV  
Sbjct: 139 DCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALAYGIYKTDLPESDQLNVAF 198

Query: 660 FDLG 671
            D+G
Sbjct: 199 IDIG 202



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/62 (35%), Positives = 30/62 (48%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +G D G     V V +   ++++ ND+ NR TP+ V F D ER IG A      M P   
Sbjct: 4   IGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDNERFIGTAGAASTMMNPKNS 63

Query: 270 YS 275
            S
Sbjct: 64  IS 65



 Score = 39.5 bits (88), Expect = 0.086
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           +P N+I   KRLIGR+F D  +Q D+K +PF ++
Sbjct: 59  NPKNSISQIKRLIGRQFSDPELQRDIKSFPFSVT 92


>UniRef50_Q05036 Cluster: Uncharacterized protein C30C11.4; n=2;
           Caenorhabditis|Rep: Uncharacterized protein C30C11.4 -
           Caenorhabditis elegans
          Length = 776

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RN 650
           ++C     +YF D QR+A   A   +GLN LRI+NE TA A+AYG+ K+   E     RN
Sbjct: 140 SDCVLAVPSYFTDVQRRAVLSAIQYAGLNSLRIVNETTAIALAYGIYKQDLPEEDAKSRN 199

Query: 651 VLIFDLGGGTSTCPSLPSRRYLRGEIHRGDT 743
           V+  D+ G +ST  SL +  + RG++   +T
Sbjct: 200 VVFLDI-GHSSTQASLVA--FNRGKLQMVNT 227



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           +G D+G     +GV + G +E+I ND     TP+ V+F   +R +G AA+  V
Sbjct: 4   LGFDIGNLNCYIGVARQGGIEVITNDYSLHATPACVSFGPKDRSMGVAARQAV 56



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 2/47 (4%)
 Frame = +1

Query: 376 IKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG--KTVQNAVITVP 510
           ++V+Y GE  TF PE+V + +LTK++   E+ L   K V + V+ VP
Sbjct: 101 VQVSYLGEPHTFTPEQVLAALLTKLRTIVESQLSDVKKVSDCVLAVP 147


>UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM
           555|Rep: DnaK7 - Clostridium kluyveri DSM 555
          Length = 496

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 30/59 (50%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGERNVLIFDLGGGT 680
           YF   Q Q T +A   +GL +L II EP AAA+AYG    +K    E  +LIFDLGGGT
Sbjct: 131 YFKAHQFQNTSEAAKEAGLKLLGIIQEPIAAALAYGFHHSNKHLNREEKLLIFDLGGGT 189


>UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n=2;
            Eukaryota|Rep: NAD-specific glutamate dehydrogenase -
            Achlya klebsiana
          Length = 1063

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 24/54 (44%), Positives = 37/54 (68%)
 Frame = -2

Query: 254  HRHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDS 93
            H +LVL GI+++T  V E N+R  G V L+VG++ +  VL DT+ R+  T+ID+
Sbjct: 981  HGNLVLSGITNKTFAVSESNVRWGGTVTLIVGNNFNTIVLPDTDTRISRTEIDT 1034



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 23/55 (41%), Positives = 41/55 (74%)
 Frame = -2

Query: 677  TAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEV 513
            T  +++++ I+F+ TL VKTV N  +SRF++D+++V+  +GT I   L+LRV+E+
Sbjct: 839  TTTKIENENIAFT-TLLVKTVGNGGTSRFVNDTKDVKTSNGTSILGSLTLRVVEI 892



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = -3

Query: 349  LERPVLHVGLHSSIFELTSDETFGIEYCV 263
            LE PVL++GL S + E T+D+T  IE+ V
Sbjct: 949  LEWPVLNIGLSSWVVEFTTDQTLSIEHSV 977


>UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK6 - Clostridium kluyveri DSM 555
          Length = 490

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 2/58 (3%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG--LDKKGTGERNVLIFDLGGGT 680
           +F  ++   T  A  ++GLN++ II EP AAA+AYG  L      + N+L+FDLGGGT
Sbjct: 129 HFRANEISNTIKAAKMAGLNLIGIIQEPIAAALAYGLHLSSDALKDENILVFDLGGGT 186



 Score = 36.7 bits (81), Expect = 0.61
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = +3

Query: 66  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           Y    +P VGIDLGTT+S +  +   K E+ +  +G    PS V    ++ +IG  A  +
Sbjct: 3   YDSVHSPVVGIDLGTTFSSIARWTGTKAEVYSL-KGEYNIPSVVYNDGSQFVIGKIAFMK 61

Query: 246 VAMTP 260
             M P
Sbjct: 62  GIMNP 66


>UniRef50_Q7M2S5 Cluster: DnaK-type molecular chaperone; n=1; Sus
           scrofa domestica|Rep: DnaK-type molecular chaperone -
           Sus scrofa domestica (domestic pig)
          Length = 167

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
           AYFND      +DAGTI+GLNV+RIINEPTAAAIAY
Sbjct: 52  AYFND------RDAGTIAGLNVMRIINEPTAAAIAY 81


>UniRef50_Q1D211 Cluster: DnaK family protein; n=1; Myxococcus
           xanthus DK 1622|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 504

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/64 (45%), Positives = 37/64 (57%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           EC     A+ +  QR A + A   +GL V  IINEPTAAA+ Y        E+ V++FDL
Sbjct: 140 ECVLTVPAHASSRQRAAVRHAAEQAGLQVRAIINEPTAAALYYA--NLRNPEQTVMVFDL 197

Query: 669 GGGT 680
           GGGT
Sbjct: 198 GGGT 201



 Score = 33.9 bits (74), Expect = 4.3
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           DDP +T+F AKR +GR+F+   V      + F L
Sbjct: 63  DDPRHTVFGAKRFLGRRFQSEYVTQHKDKYAFGL 96


>UniRef50_A4ZY06 Cluster: Putative uncharacterized protein; n=1;
           Rhodococcus sp. DK17|Rep: Putative uncharacterized
           protein - Rhodococcus sp. DK17
          Length = 316

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 26/51 (50%), Positives = 35/51 (68%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           AVGIDLGTT S +  +Q  +  +IAN +G RTTPS VAFT++    G +A+
Sbjct: 4   AVGIDLGTTNSAIACWQGSEPVVIANAEGARTTPSVVAFTESGEPPGRSAR 54


>UniRef50_UPI0000E474BD Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 488

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 21/36 (58%), Positives = 29/36 (80%)
 Frame = +3

Query: 132 FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           F  GK E++AND G+RTTP+ VAFTD E+++G +AK
Sbjct: 15  FSDGKTEVVANDAGDRTTPTAVAFTDNEKIVGLSAK 50



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLD-KKGTGERNVLIFDLGGGT 680
           F+D QR A + A   +G  +LR+I++P+AA +AY +   K     NVL++ LGG +
Sbjct: 144 FSDGQRAAVRKAAEAAGFKILRLISDPSAAVLAYEIGVTKPHDPCNVLVYRLGGSS 199



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+   K ++GRKFED  +Q   +  PF++
Sbjct: 56  NPVNTVMQVKHIVGRKFEDQVIQDLKRQSPFKV 88



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV   G    ++    +       EV+ +V  K+KE AE   GK ++N V+T P
Sbjct: 86  FKVVESKGLAGFEIEANNKKNIVSSLEVAGLVFRKLKEIAEHQGGKDMKNTVLTCP 141


>UniRef50_Q7ZUM5 Cluster: Heat shock protein 4; n=20;
           Euteleostomi|Rep: Heat shock protein 4 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 840

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERN 650
           A+C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISVPCFYTDAERRSVIDAAQIAGLNCLRLMNETTAVALAYGIYKQDLPAPEEKPRN 197

Query: 651 VLIFDLG 671
           V+  D+G
Sbjct: 198 VVFVDIG 204



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 25/49 (51%), Positives = 35/49 (71%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G   +KV Y  E+K F  E+V++M+LTK+KETAE+ L K V + VI+VP
Sbjct: 97  GTTGLKVMYMEEEKVFSIEQVTAMLLTKLKETAESALKKPVADCVISVP 145



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/53 (41%), Positives = 32/53 (60%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VG D+G     V V + G +E +AN+  +R TP+ V+F    R IG AAK+Q+
Sbjct: 4   VGFDVGFLNCYVAVARAGGIETVANEYSDRCTPACVSFGPRNRSIGAAAKSQM 56


>UniRef50_Q0WM51 Cluster: HSP like protein; n=11; Magnoliophyta|Rep:
           HSP like protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 701

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 21/58 (36%), Positives = 38/58 (65%), Gaps = 1/58 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-GTGERNVLIFDLGGGTS 683
           YF  ++R+    A  ++G+NVL ++NE + AA+ YG+DK    G R+V+ +D+G  ++
Sbjct: 6   YFGQAERRGLIQASQLAGVNVLSLVNEHSGAALQYGIDKDFANGSRHVIFYDMGSSST 63


>UniRef50_O23508 Cluster: Growth regulator like protein; n=6;
           Magnoliophyta|Rep: Growth regulator like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 912

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 21/58 (36%), Positives = 38/58 (65%), Gaps = 1/58 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-GTGERNVLIFDLGGGTS 683
           YF  ++R+    A  ++G+NVL ++NE + AA+ YG+DK    G R+V+ +D+G  ++
Sbjct: 600 YFGQAERRGLIQASQLAGVNVLSLVNEHSGAALQYGIDKDFANGSRHVIFYDMGSSST 657



 Score = 36.3 bits (80), Expect = 0.81
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 4/71 (5%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGV--FQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           +++  + +DLG+ +  V V   + G+  + +  N+   R +P+ VAF   +RL+G+ A  
Sbjct: 450 SESAVLSVDLGSEWVKVAVVNLKRGQSPISVAINEMSKRKSPALVAFQSGDRLLGEEAAG 509

Query: 243 QVAMTPTTQYS 275
             A  P   YS
Sbjct: 510 ITARYPNKVYS 520


>UniRef50_A2DWC1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 649

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 2/57 (3%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNV--LRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           F+ +QR+ TK+A  ++G N+  L ++ EPTAAAI Y          ++LI+D GGGT
Sbjct: 151 FSTNQRKTTKEAAELAGFNINKLALLAEPTAAAIKYAYSADPNQRHHILIYDFGGGT 207



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           +GIDLGTT+S   ++       E+I  D G +  PS VAF  +  ++G+ AK Q+ + PT
Sbjct: 8   LGIDLGTTFSSAAIYNPDTKTTEVIEID-GKKELPSMVAFNVSPHVVGEPAKGQLLIEPT 66



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = +1

Query: 343 FRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTS 519
           FRV S     P+I VA  G++++  P +VS+ +L  +K   E  +G  + +AVITVP   
Sbjct: 92  FRVESSSENDPEIVVACNGKEESVSPVQVSAEILKYIKSKVEVKVGHPIDSAVITVPEGF 151

Query: 520 MTLKDKPQK 546
            T + K  K
Sbjct: 152 STNQRKTTK 160


>UniRef50_UPI0000498BE2 Cluster: chaperone protein dnaK; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: chaperone protein
           dnaK - Entamoeba histolytica HM-1:IMSS
          Length = 697

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 28/67 (41%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLI 659
           N  +C     A FND QR  TK A   + L V+ I+NEPTAAA      +       +LI
Sbjct: 134 NNIKCILTVPAQFNDEQRNQTKKAALSANLEVIDILNEPTAAAYYCSKTQNYNDGDKILI 193

Query: 660 FDLGGGT 680
           FD G GT
Sbjct: 194 FDFGAGT 200


>UniRef50_A5N5I8 Cluster: DnaK4; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK4 - Clostridium kluyveri DSM 555
          Length = 604

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 2/58 (3%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG--LDKKGTGERNVLIFDLGGGT 680
           YF D Q    K+   ++G+ ++  I EP AAA+AYG  L      E N+L+FD GGG+
Sbjct: 129 YFQDEQCNIIKEGAKLAGIELIGTIQEPVAAALAYGMYLPLNKKREENILVFDFGGGS 186



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           P +GID GTTYS V  +   K EI     G    PS V F   +  +G+ A
Sbjct: 9   PVIGIDFGTTYSSVSKWDGKKAEIYGK-MGEYAIPSVVYFKQGKFDVGNGA 58


>UniRef50_Q5C1F3 Cluster: SJCHGC04997 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC04997 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 252

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/62 (40%), Positives = 36/62 (58%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D+GT  S +GV + G +E+I N+   R TP+ VAF+    L+G AAK Q  M     
Sbjct: 5   VGFDIGTLTSYIGVARGGGIEVITNEYSERATPTCVAFSGELVLVGTAAKLQQVMNTRNT 64

Query: 270 YS 275
           ++
Sbjct: 65  FT 66



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 18/52 (34%), Positives = 30/52 (57%)
 Frame = +1

Query: 355 SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           S  G+  +     GE  +F PE++ ++ + K+KE AEA +G  V + V+ VP
Sbjct: 95  SSDGRITLSAVLNGEKTSFVPEQILAIQMNKLKEVAEATIGSKVVDVVVNVP 146



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 16/39 (41%), Positives = 27/39 (69%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK 629
           Y+ D++R+A  DA  ++GLN ++++N+ TA   AYG  K
Sbjct: 148 YYTDTERRAVLDATKVAGLNCVKVVNDITAIGTAYGFYK 186


>UniRef50_Q4CS27 Cluster: Putative uncharacterized protein; n=3;
           Trypanosoma|Rep: Putative uncharacterized protein -
           Trypanosoma cruzi
          Length = 722

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTY-SCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           A A  +GID G+ Y    G      V+I+ N+Q +R T +Y+ F + ER IGD AK   A
Sbjct: 17  ASANVLGIDFGSEYIEVAGPHNGNNVDIVLNEQSHRKTDNYIGFKNGERYIGDQAKALAA 76

Query: 252 MTPTTQYSMPN 284
             P    +M N
Sbjct: 77  RFPLNMVTMIN 87



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/50 (40%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = +3

Query: 528 QRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER--NVLIFDLG 671
           +RQA  +A  + G+NVL +++  TAAA  YG+ ++G G +  N+L++D+G
Sbjct: 169 KRQAILEAARLVGMNVLGLMHSTTAAAFYYGIRRRGLGNKTMNLLVYDIG 218


>UniRef50_O15797 Cluster: CG4; n=10; Plasmodium|Rep: CG4 -
           Plasmodium falciparum
          Length = 855

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           +GID+G   S V     G + ++ ND   R TP+ V FT+ ERLIGD+A +++
Sbjct: 4   LGIDIGNDNSVVATINKGAINVVRNDISERLTPTLVGFTEKERLIGDSALSKL 56



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 3/74 (4%)
 Frame = +3

Query: 477 QNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK-KGTGERN- 650
           + C E        F + Q++    A  I   NVLRII++ TA A+ YG+ + K   E N 
Sbjct: 135 KECKEIVLSYPPTFTNCQKECLLAATKIINANVLRIISDNTAVALDYGMYRMKEFKEDNG 194

Query: 651 -VLIFDLGGGTSTC 689
            +L+F   G  +TC
Sbjct: 195 SLLVFVNIGYANTC 208



 Score = 33.1 bits (72), Expect = 7.5
 Identities = 19/63 (30%), Positives = 30/63 (47%)
 Frame = +1

Query: 328 HEALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           HEA    +  +      +V YK E   F    V S +L+ + + AE Y+GK  +  V++ 
Sbjct: 85  HEAYGDLIPCEYNYLGYEVEYKNEKVVFSAVRVLSALLSHLIKMAEKYIGKECKEIVLSY 144

Query: 508 PRT 516
           P T
Sbjct: 145 PPT 147


>UniRef50_UPI0000498B17 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 543

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 26/57 (45%), Positives = 40/57 (70%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F D +R+AT+ A  ++G+  +R++NEPTAAA+AY  +KK   +  + +FD GGGT
Sbjct: 155 AAFGDEERKATEQAIKMAGIEPIRMVNEPTAAAMAY--EKK---DGVLYVFDFGGGT 206



 Score = 33.1 bits (72), Expect = 7.5
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           VGIDLGTT+S      +G+  I  ++    +  S VAFT ++ L+G   K+
Sbjct: 10  VGIDLGTTFSSACEIINGRPFIYKSEFERDSIRSCVAFTGSQCLVGTNDKS 60


>UniRef50_Q1VU26 Cluster: Heat shock protein Hsp70; n=2;
           Bacteroidetes|Rep: Heat shock protein Hsp70 -
           Psychroflexus torquis ATCC 700755
          Length = 838

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 25/57 (43%), Positives = 36/57 (63%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F  +Q  AT+ AG ++G   + ++ EP AA++AYGLD  G  +   L+FD GGGT
Sbjct: 130 AAFKINQIDATRRAGKLAGFEHIEVLQEPVAASMAYGLD-SGKKDGFWLVFDFGGGT 185



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +3

Query: 93  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           GIDLGTT S +   + GK  II  ++   T  S VA+     ++GD A
Sbjct: 9   GIDLGTTNSAISRIEKGKATIIQTNKRRDTMASCVAYNKKGVIVGDDA 56


>UniRef50_Q92598 Cluster: Heat shock protein 105 kDa; n=92;
           Eumetazoa|Rep: Heat shock protein 105 kDa - Homo sapiens
           (Human)
          Length = 858

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 1/61 (1%)
 Frame = +1

Query: 331 EALAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           E L++ +V    G   IKV Y GE+  F  E++++M+LTK+KETAE  L K V + VI+V
Sbjct: 85  ENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISV 144

Query: 508 P 510
           P
Sbjct: 145 P 145



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQ 186


>UniRef50_A2G8T1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 591

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 26/57 (45%), Positives = 36/57 (63%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F+ +QR+ T  A   SG+  L++INEPTAAA +Y   +  T  + +LIFD G GT
Sbjct: 157 AKFDSNQRRDTISAIEKSGIKCLKLINEPTAAAFSY-FSEHQTNNQKILIFDYGAGT 212


>UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 707

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY-GLDKKGTGERNVLIFDLGGGT 680
           AYF+D Q+  TK A   +G     ++NEPTAAA+ Y    +K +    +L++D GGGT
Sbjct: 147 AYFDDRQKAETKLAAKFAGFGDFELMNEPTAAALCYMHTFQKFSDSSKILVYDFGGGT 204



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/56 (39%), Positives = 35/56 (62%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V   GG P I+   K + + + P E+SS +L+ +K+ +E  LG  ++ AVITVP
Sbjct: 91  FKVNDYGGAPSIQAVLKRQIREYRPYEISSYILSYLKKKSEDQLGVPIKKAVITVP 146



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEI-IANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           M + P VGIDLGTT+S V V++  +    +    G+   PS +AF D E + G  AK+ +
Sbjct: 1   MNEGPFVGIDLGTTFSTVAVYKPAQKSFDVLKIDGDTQVPSVIAFGD-ELVYGQRAKSLM 59

Query: 249 AMTP-TTQYSMPNVSSDVSSKM 311
           A  P  T Y    +   + S++
Sbjct: 60  ANIPQNTVYDSKRMIGKMYSEL 81


>UniRef50_A2ECV1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 650

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 2/57 (3%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGL--NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           F+D+QR+ATK+A  I+G   N +  + EPT+AAI +          ++LI+D GGGT
Sbjct: 148 FSDAQRKATKNAAIIAGFDPNKIHFLPEPTSAAIKFAHKASADHRHHILIYDFGGGT 204



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 1/59 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEI-IANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           VGIDLGTT+  V V++    E  +   +G++T PS V +  T    G  AK+Q+ +TPT
Sbjct: 7   VGIDLGTTFCSVAVYRPSTQETEVLEIEGSKTIPSQV-YYGTPTYFGQKAKDQLQITPT 64


>UniRef50_O14992 Cluster: HS24/P52; n=8; Eutheria|Rep: HS24/P52 -
           Homo sapiens (Human)
          Length = 474

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           LA+ +V    G   IKV Y  E++ F  E+V++M+L+K+KETAE+ L K V + V++VP
Sbjct: 87  LAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 653
           +C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 654 LIFDLG 671
           +  D+G
Sbjct: 199 VFVDMG 204



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>UniRef50_UPI0000660D8E Cluster: Homolog of Homo sapiens "heat shock
           70kDa protein 2 (HSPA2), mRNA; n=1; Takifugu
           rubripes|Rep: Homolog of Homo sapiens "heat shock 70kDa
           protein 2 (HSPA2), mRNA - Takifugu rubripes
          Length = 180

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/58 (41%), Positives = 37/58 (63%)
 Frame = -2

Query: 683 RSTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEVR 510
           +  +++VKD+ + FS    V+TV    S R +DD ++VQ+ D   +F  LSLRV+EVR
Sbjct: 2   KGASSQVKDQDVVFSRLTIVQTVRKGCSRRLVDDPQDVQSGDDAGVFGRLSLRVVEVR 59



 Score = 37.5 bits (83), Expect = 0.35
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = -2

Query: 248 HLVLGGISDETLGVCERNIRRSGPVALVVGDD 153
           HLVL  + DE L V E +I   GPVALVVG+D
Sbjct: 148 HLVLCRVPDEPLRVSEGHIAGGGPVALVVGND 179


>UniRef50_Q1D082 Cluster: DnaK family protein; n=2;
            Cystobacterineae|Rep: DnaK family protein - Myxococcus
            xanthus (strain DK 1622)
          Length = 1293

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = +3

Query: 513  YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGG 677
            +F D Q  A ++A T++GL+  RI+  P AAA+AY    +G   + VL+ DLGGG
Sbjct: 916  HFTDRQCAALREAATLAGLDAQRILIAPAAAALAYA-HGRGLARKRVLVVDLGGG 969


>UniRef50_Q06068 Cluster: 97 kDa heat shock protein; n=3;
           Strongylocentrotus|Rep: 97 kDa heat shock protein -
           Strongylocentrotus purpuratus (Purple sea urchin)
          Length = 889

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 23/50 (46%), Positives = 35/50 (70%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPR 513
           G   ++V Y GE +TF PE++ +M+LTK+K TAE  L + V + VI+VP+
Sbjct: 97  GNVGMQVQYLGETETFTPEQIYAMILTKLKSTAEINLCRKVVDCVISVPQ 146



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG--TGE---RNV 653
           +C      Y+ D +R+    A  I+GLN LR+I++ TA A+AYG+ K+   T E   RNV
Sbjct: 139 DCVISVPQYYTDLERRGVIHAAEIAGLNCLRVISDTTAVALAYGIYKQDLPTPEEKPRNV 198

Query: 654 LIFDLG 671
           +  D G
Sbjct: 199 VFVDCG 204



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG D+G   S + V + G +E +AN+  +R TPS V+F +  R  G AA++Q
Sbjct: 4   VGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQ 55



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVM-EANLRSR*HIRVKTKPFSPRK 424
           NT+   KR I R+F D +VQ D K  P++++ +   N+  +     +T+ F+P +
Sbjct: 62  NTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQ 116


>UniRef50_UPI0000F1F58C Cluster: PREDICTED: similar to Heat shock
           protein 4, partial; n=1; Danio rerio|Rep: PREDICTED:
           similar to Heat shock protein 4, partial - Danio rerio
          Length = 298

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 5/58 (8%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNVLIFDLG 671
           ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV+  D+G
Sbjct: 4   FYTDAERRSVIDAAQIAGLNCLRLMNETTAVALAYGIYKQDLPAPEEKPRNVVFVDIG 61


>UniRef50_Q00YD5 Cluster: Heat shock protein 91-Arabidopsis
           thaliana; n=1; Ostreococcus tauri|Rep: Heat shock
           protein 91-Arabidopsis thaliana - Ostreococcus tauri
          Length = 779

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 34/57 (59%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           VGID G   + V + +   ++++ ND+  R TPS V F + +R IG AA +++ M P
Sbjct: 32  VGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKINMKP 88



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 3/64 (4%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG--TGER-NVLI 659
           +C      Y  D+ R+A  DA ++ GLNVLR+++E TA A++YG+ K    T E  NV  
Sbjct: 167 DCVISVPVYATDAHRRAMLDAASMCGLNVLRLLHETTATALSYGIFKTAEFTDEPVNVAF 226

Query: 660 FDLG 671
            D+G
Sbjct: 227 VDVG 230



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 13/26 (50%), Positives = 18/26 (69%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMK 334
           P NT+   KRL+GR F+D  VQ D++
Sbjct: 88  PRNTVTQVKRLVGRAFDDPEVQRDLR 113



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 17/49 (34%), Positives = 28/49 (57%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G+   ++ Y G+ K F PE+  + +L+ +K  AE   G  V + VI+VP
Sbjct: 125 GEVLCEMEYLGKKKEFTPEQCVASILSDLKRIAEKDNGTKVTDCVISVP 173


>UniRef50_Q2H062 Cluster: Putative uncharacterized protein; n=2;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Chaetomium globosum (Soil fungus)
          Length = 763

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 5/64 (7%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG---LDKKGTGE--RNVLIFDLGGG 677
           +F D+QR+A  DA  I+GL +LR+IN+ TAAA+ YG   LD     E  R V   D+G  
Sbjct: 146 WFTDAQRRAIIDAAEIAGLRLLRLINDTTAAALGYGITKLDLPAADEKPRRVAFVDVGYS 205

Query: 678 TSTC 689
             +C
Sbjct: 206 DYSC 209



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D G+  + V V ++  V++I N+  NR TPS V F    R +G++AK Q
Sbjct: 4   VGVDFGSLNTVVAVARNRGVDVITNEVSNRATPSLVGFGPKSRYLGESAKTQ 55


>UniRef50_O59838 Cluster: Heat shock protein homolog pss1; n=21;
           Fungi|Rep: Heat shock protein homolog pss1 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 720

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/59 (33%), Positives = 38/59 (64%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           ++   VGID G + + + V ++  +++I N+  NR+TPS V++ +  R +G+AAK+  A
Sbjct: 3   SRTNVVGIDFGNSKTVIAVARNRAIDVIVNEVSNRSTPSLVSYGERSRFLGEAAKSAEA 61



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 4/78 (5%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE----RNVLIFDLGGG 677
           A+F D QR+A  +A  I+GLN LR++N+  AAA+ YG+ K    E    R V I D G  
Sbjct: 150 AWFTDIQRRALLEAANIAGLNPLRLMNDNAAAALTYGITKTDLPEPESPRRVAIVDFGHS 209

Query: 678 TSTCPSLPSRRYLRGEIH 731
                S+    + RG+ H
Sbjct: 210 NY---SVSIVEFSRGQFH 224


>UniRef50_P32590 Cluster: Heat shock protein homolog SSE2; n=20;
           Saccharomycetales|Rep: Heat shock protein homolog SSE2 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 693

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 5/71 (7%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGE--RNVLIFDLGGG 677
           ++++ QR    DA  I+GLN +RI+N+ TAAA++YG+   D  G  E  R + + D+G  
Sbjct: 148 WYSEEQRYNIADAARIAGLNPVRIVNDVTAAAVSYGVFKNDLPGPEEKPRIIGLVDIGHS 207

Query: 678 TSTCPSLPSRR 710
           T TC  +  R+
Sbjct: 208 TYTCSIMAFRK 218



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 17/51 (33%), Positives = 31/51 (60%)
 Frame = +3

Query: 93  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           G+DLG   S + V ++  ++++ N+  NR+TPS V F    R +G++ K +
Sbjct: 6   GLDLGNNNSVLAVARNRGIDVVVNEVSNRSTPSLVGFGPRNRYLGESGKTK 56


>UniRef50_A0ZXN0 Cluster: Heat shock protein 70-like; n=1; Fig leaf
           mottle-associated virus 2|Rep: Heat shock protein
           70-like - Fig leaf mottle-associated virus 2
          Length = 208

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/57 (38%), Positives = 33/57 (57%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A +N  +R     A    G+N   ++NEPTAAA+   +  K T  R++L++D GGGT
Sbjct: 150 ADYNSYKRTFISLASQEVGVNTAGVVNEPTAAALFSSMSSKSTPTRSILVYDFGGGT 206


>UniRef50_Q86JV8 Cluster: Similar to heat shock protein; n=2;
           Dictyostelium discoideum|Rep: Similar to heat shock
           protein - Dictyostelium discoideum (Slime mold)
          Length = 926

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +3

Query: 465 SLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE 644
           S +  +  +C+     YF   QRQA  DA  ++GLNVL +I++  AAA+++ +D+    +
Sbjct: 156 SYAGSSIKDCAITIPPYFTQQQRQALLDAAQLAGLNVLSLIHDVNAAALSFAMDRTFLEK 215

Query: 645 -RNVLIFDLG 671
             +V+ +D+G
Sbjct: 216 NESVIFYDMG 225



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 17/58 (29%), Positives = 36/58 (62%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F+V +D  +  + + Y  +D  +  EE++ M+L ++K+ A +Y G ++++  IT+P
Sbjct: 114 LGFKVKNDTVRNTVSIVYD-DDTNYSAEELTGMLLRRVKDMASSYAGSSIKDCAITIP 170



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A +  +GIDLG+    V + + G  E + N+Q  R T S V +   ERL    + +  A 
Sbjct: 24  ANSMVIGIDLGSQTFKVSLIKPGAFETVLNEQSGRKTISSVGWFKDERLFSSDSFSVWAR 83

Query: 255 TPTTQYSM 278
            P   Y++
Sbjct: 84  NPKQNYNL 91


>UniRef50_Q57VU9 Cluster: Heat shock 70 kDa protein, putative; n=4;
           Trypanosoma|Rep: Heat shock 70 kDa protein, putative -
           Trypanosoma brucei
          Length = 870

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 11/90 (12%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG--------TGERNV---L 656
           A+F   Q+ AT+DA   +G +VL +I+EP+AA +A+ + +          +G + +   L
Sbjct: 213 AFFTPQQKVATEDAALAAGFDVLEVIDEPSAACLAHTVLQPSNASSREHLSGSKRIVRSL 272

Query: 657 IFDLGGGTSTCPSLPSRRYLRGEIHRGDTH 746
           +FDLGGGT  C  + + R  RG      TH
Sbjct: 273 VFDLGGGTLDCAVMENDR-RRGTFTLVATH 301


>UniRef50_UPI00006CA81B Cluster: dnaK protein; n=1; Tetrahymena
           thermophila SB210|Rep: dnaK protein - Tetrahymena
           thermophila SB210
          Length = 811

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 4/58 (6%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK----GTGERNVLIFDLG 671
           +Y+ + +R+A +DA  I+GLN LR+ NE +A  ++YGL +K     T  R+V   DLG
Sbjct: 153 SYYTEQERKALRDACRIAGLNPLRLFNESSAICLSYGLFRKAELDATTPRHVAFVDLG 210



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/53 (37%), Positives = 32/53 (60%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           A+GID G++ S + V + G V++IAN+   R T + V +   +R  G+AA  Q
Sbjct: 11  AIGIDFGSSRSVIAVAKRGGVDVIANEASLRETRNIVGYGPAQRFTGEAANAQ 63


>UniRef50_Q4RM18 Cluster: Chromosome 10 SCAF15019, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10
           SCAF15019, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 892

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/53 (41%), Positives = 34/53 (64%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGID+G     + V + G +E IAN+  +R TP+ V+     R+IG+AAK+Q+
Sbjct: 4   VGIDVGFQSCYIAVARSGGIETIANEYSDRCTPACVSLATKNRIIGNAAKSQI 56



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/49 (46%), Positives = 34/49 (69%)
 Frame = +1

Query: 364 GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G   IKV Y  ++K F  E+++ M+L+K+KET+EA L K V + VI+VP
Sbjct: 97  GSTGIKVRYLDDNKMFTVEQITGMLLSKLKETSEAALKKPVVDCVISVP 145



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 17/45 (37%), Positives = 29/45 (64%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
           +C     ++F D++R++  DA  I+GLN LR+IN+ TA    +G+
Sbjct: 139 DCVISVPSFFTDAERRSVFDATQIAGLNCLRLINDTTAGECLFGV 183


>UniRef50_A2F0R7 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 995

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           +GID G     +    +G V++IAN   +R TP+ V +T+  R +GD AK Q
Sbjct: 5   IGIDFGNKNCIISAEVNGSVDVIANQNASRATPAIVTYTNKRRFVGDLAKMQ 56


>UniRef50_UPI0000DC15CB Cluster: UPI0000DC15CB related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC15CB UniRef100 entry -
           Rattus norvegicus
          Length = 490

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 35/81 (43%), Positives = 40/81 (49%)
 Frame = +3

Query: 507 SAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTST 686
           +AYF+D Q QATKD G    LNVLRII E T A IAY        E  +L FDL   T  
Sbjct: 98  AAYFSDLQCQATKDRGATK-LNVLRIIKETTTATIAY--------EFVLLFFDLSRSTFN 148

Query: 687 CPSLPSRRYLRGEIHRGDTHL 749
                    +  +   GDTHL
Sbjct: 149 VVLTILAGVIEVKATSGDTHL 169



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 14/26 (53%), Positives = 20/26 (76%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHW 340
           + +FDAKRLI  KF +ATVQ + +H+
Sbjct: 51  HAVFDAKRLISSKFTEATVQPEKEHF 76


>UniRef50_A6EMR6 Cluster: Heat shock protein Hsp70; n=1;
           unidentified eubacterium SCB49|Rep: Heat shock protein
           Hsp70 - unidentified eubacterium SCB49
          Length = 847

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           A F ++Q  AT++AG  +G + + II EP AAA  YG++ +   +   L+FD GGGT   
Sbjct: 133 AAFKNNQIDATREAGREAGFDQVGIITEPEAAAWVYGMNSENK-DGFWLVFDFGGGTFDA 191

Query: 690 PSLPSRRYLRGEIH-RGDTHL 749
             L     +R  I   GD +L
Sbjct: 192 ALLKITDGIRQVIDTEGDNYL 212



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = +3

Query: 93  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMTPTTQ 269
           GIDLGTT S +   ++G  E I       T PS V     + + +GDAA N  A+     
Sbjct: 9   GIDLGTTNSAISKMENGNPESIRTQTLKDTMPSCVYINRKKAIQVGDAAYN--ALKDEKL 66

Query: 270 YSMPNVSSDVSSKMLLCKPT 329
            +M N  S   +  +  K T
Sbjct: 67  KAMKNWDSSKDNSFIEFKRT 86


>UniRef50_A7QHP2 Cluster: Chromosome chr8 scaffold_99, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_99, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 84

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/33 (60%), Positives = 28/33 (84%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           F PEE+++MVLTKMKE AEA+LGK +++ V+ V
Sbjct: 24  FNPEEINAMVLTKMKEIAEAFLGKKIKDVVVPV 56


>UniRef50_A3LSS8 Cluster: Stress-seventy subfamily A; n=1; Pichia
           stipitis|Rep: Stress-seventy subfamily A - Pichia
           stipitis (Yeast)
          Length = 348

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/57 (36%), Positives = 34/57 (59%)
 Frame = +1

Query: 340 AFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           AF +  +     IKV Y G DK    + +SSM++ K+K  AE+YLG+ +++A+   P
Sbjct: 35  AFTIEENNEITIIKVKYHGPDKDIINDGISSMIVRKLKADAESYLGRNIKDAIFISP 91


>UniRef50_UPI0000D55C7E Cluster: PREDICTED: similar to CG2918-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG2918-PA - Tribolium castaneum
          Length = 872

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 3/79 (3%)
 Frame = +3

Query: 477 QNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK-KGTGE--R 647
           Q   EC      YFN  +R++   A  ++GL VL++IN+ TA A+ YG+ + K   E  +
Sbjct: 155 QPIKECVLTVPGYFNQIERKSLLQAANLAGLKVLQLINDYTAVALNYGIFRSKDFNETAQ 214

Query: 648 NVLIFDLGGGTSTCPSLPS 704
            V+ +D+ G TST  +L S
Sbjct: 215 YVMFYDM-GATSTTATLVS 232



 Score = 33.9 bits (74), Expect = 4.3
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +1

Query: 382 VAYKGEDKTFF-PEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + +K +D  F+ PEE+ + +L K KE AE    + ++  V+TVP
Sbjct: 122 ILFKHDDNVFYSPEELIAQLLGKAKEFAEQGARQPIKECVLTVP 165


>UniRef50_Q3WFH0 Cluster: Heat shock protein Hsp70; n=1; Frankia sp.
           EAN1pec|Rep: Heat shock protein Hsp70 - Frankia sp.
           EAN1pec
          Length = 832

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 34/86 (39%), Positives = 45/86 (52%), Gaps = 6/86 (6%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV--LIFDLGGGTS 683
           A F  +Q  AT+ A   +GL +  ++ EPTAAA+AY   +    E N+  L+FDLGGGT 
Sbjct: 126 AAFELNQTDATRRAAEAAGLGLSPLLQEPTAAALAYSFQR---DEDNIYRLVFDLGGGTF 182

Query: 684 TCPSLPSRRYLRGEI----HRGDTHL 749
               +  R    GE     HRGD  L
Sbjct: 183 DASVVHIR---DGEFDIVNHRGDNFL 205



 Score = 36.7 bits (81), Expect = 0.61
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = +3

Query: 93  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMTP 260
           GIDLGTT S + V    +  I+ N   + TTPS V      R+ +G+ A+ +V   P
Sbjct: 9   GIDLGTTNSAIAVLDGTEARIVKNAFQHDTTPSAVYADRNGRIHVGERARERVESDP 65


>UniRef50_Q22758 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 925

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/61 (36%), Positives = 42/61 (68%), Gaps = 3/61 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLGGGTS 683
           YF  ++R A + A  ++GL VL++IN+ TAAA+++G+  +K  GE+   ++++D+G   +
Sbjct: 171 YFTPAERLAVERAAQMAGLTVLQLINDGTAAALSHGIFRRKEIGEKPQRLMVYDMGAAKT 230

Query: 684 T 686
           T
Sbjct: 231 T 231



 Score = 36.7 bits (81), Expect = 0.61
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           A+ IDLGT +  +G+ + G  ++I  N +  R TP+ V   D  R   DAA
Sbjct: 26  AMTIDLGTQFLKIGIVKPGIPMDIALNTESRRKTPNVVMIQDGHRTFADAA 76


>UniRef50_A2DZ76 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 641

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 23/55 (41%), Positives = 35/55 (63%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           FN  Q +  K A  ++GL+++  I EPTAAAI+ G+      ++ ++IFD GGGT
Sbjct: 154 FNVEQCERIKTAAKVAGLDIIATIYEPTAAAISSGM--MTDKDKKLMIFDFGGGT 206



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           MAK   V ID GTT SC+ +  H G+  +     GN   P+ + F D    I     + +
Sbjct: 1   MAKKSGVAIDFGTTNSCIAIALHTGQDTMPILIDGNNYVPTNLTFVDEGPPIACFDTSSL 60

Query: 249 AMTPTTQYSMPNVSSDVSSKM 311
             TP    S+ N+   +  ++
Sbjct: 61  VYTPGN--SLHNIKRIIGKRL 79


>UniRef50_A0C553 Cluster: Chromosome undetermined scaffold_15, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_15,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 898

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 22/52 (42%), Positives = 33/52 (63%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLG 671
           +N SQR A K A  ++ L VL IINE TAAA+ Y L+++   +   L +++G
Sbjct: 171 WNISQRSALKSAAQLAELEVLGIINENTAAALYYALERQDENKHTALFYNIG 222


>UniRef50_Q4RRT3 Cluster: Chromosome 16 SCAF15002, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 16 SCAF15002, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 52

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/26 (80%), Positives = 21/26 (80%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIA 161
           P V I LGTTYSCVGVFQ GKVEI A
Sbjct: 1   PVVAIGLGTTYSCVGVFQRGKVEIRA 26


>UniRef50_UPI0000499107 Cluster: 70 kDa heat shock protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 70 kDa heat shock
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 559

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 5/76 (6%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQH-GKVEIIANDQ-GNRTTPSYVAFTDTER---LIGDAAKNQVAM 254
           VGID GTT+S +  +    K +   ND+ GN+  PS+V+F   E    +IG+ AKN++  
Sbjct: 9   VGIDFGTTFSSIAYYNPLNKTDCTINDEGGNKQIPSWVSFAQMENSGVIIGNGAKNEIFG 68

Query: 255 TPTTQYSMPNVSSDVS 302
                 S   + SD+S
Sbjct: 69  ECVLYDSKRIIGSDIS 84



 Score = 40.3 bits (90), Expect = 0.049
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 2/57 (3%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG--TGERNVLIFDLGGGT 680
           F+D +R AT  A  ++G+  + ++NEP AA + Y        + +  V++ D GGGT
Sbjct: 158 FDDKKRNATLAACKLAGIENVTLVNEPVAALVEYKRTHNDVLSNDSKVVVIDFGGGT 214



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 4/60 (6%)
 Frame = +1

Query: 343 FRVV-SDGGKPKIKV--AYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT-VQNAVITVP 510
           F V+ ++ GK  ++V   +K +D+ F PEE+S MVL  +   A++ L  T + N V+TVP
Sbjct: 96  FTVIGNNNGKACMEVYNPFKQKDEIFEPEEISGMVLKNLILMAKSKLDNTEIGNIVVTVP 155


>UniRef50_A6GJQ9 Cluster: Heat shock protein Hsp70; n=1;
           Plesiocystis pacifica SIR-1|Rep: Heat shock protein
           Hsp70 - Plesiocystis pacifica SIR-1
          Length = 826

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQV 248
           M KA  VG DLGTT S   VF   +  ++ N QG+  TPS V     ER+ +G  A+  +
Sbjct: 1   MEKALYVGFDLGTTNSAAAVFDGEQTRVVRNSQGSTLTPSVVRIDGRERVTVGAKARRFL 60

Query: 249 AMTP 260
              P
Sbjct: 61  ERDP 64



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV-LIFDLGGGTST 686
           A F   Q  AT DA  ++G   + ++ EP A+A+A G     T +    L++DLGGGT  
Sbjct: 124 ALFELPQSSATSDAARMAGFESVELLQEPIASALAAGWS--ATEDPGAWLVYDLGGGTFD 181

Query: 687 CPSLPSR-RYLRGEIHRGDTHL 749
              L +   +LR   H GD  L
Sbjct: 182 ASLLETADGFLRVVGHDGDNFL 203


>UniRef50_A0NUH2 Cluster: Putative uncharacterized protein; n=1;
           Stappia aggregata IAM 12614|Rep: Putative
           uncharacterized protein - Stappia aggregata IAM 12614
          Length = 98

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 2/66 (3%)
 Frame = -3

Query: 265 VVGVIATWFLAASPMRRSVSVN-AT*DGVVLLPWSLAM-ISTFPCWKTPTQEYVVPRSIP 92
           +VG +  W LA  P RRS S   AT DGVV  P + ++ + + P   T T E+VVPRSIP
Sbjct: 2   LVGFVTAWRLAGWPTRRSPSSEKATIDGVVRAPSAFSITLESLPSM-TATHEFVVPRSIP 60

Query: 91  TAGAFA 74
              A +
Sbjct: 61  MTFAIS 66


>UniRef50_A2R006 Cluster: Contig An12c0210, complete genome; n=1;
           Aspergillus niger|Rep: Contig An12c0210, complete genome
           - Aspergillus niger
          Length = 513

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/51 (43%), Positives = 32/51 (62%)
 Frame = +3

Query: 519 NDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLG 671
           +D++R  T+DAG   GL V R++N PTAAAIA   D   +    +L+ D+G
Sbjct: 100 HDAERAETRDAGHQVGLKVHRLLNTPTAAAIAQWTDSPTSDAHLMLVLDIG 150



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTP-SYVAFTDTERLIGDAAKNQV 248
           A+GIDLG +Y  + V Q GKV +I + QG +  P SY+  T     +G A +++V
Sbjct: 4   AIGIDLGISYVSIAVAQDGKVHVIPDTQGRQRIPSSYLLRTSVAPSVGPAIRDRV 58


>UniRef50_Q52V38 Cluster: Heat shock protein 70-like; n=4; Mint
           virus 1|Rep: Heat shock protein 70-like - Mint virus 1
          Length = 604

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/57 (40%), Positives = 33/57 (57%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A F  +QR    +  ++SG +   IINEP+AAA +    K    ER V+++D GGGT
Sbjct: 155 AAFTSTQRNFIMECVSLSGFHCSHIINEPSAAAFS-AFRKLSPSERFVMVYDFGGGT 210


>UniRef50_A7PZE7 Cluster: Chromosome chr15 scaffold_40, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr15 scaffold_40, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 92

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 26/52 (50%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = +3

Query: 597 TAAAIAYGLDKKGTGERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           ++AAIAYGLDKKG GE+N+L+F LGGG      L             GDTHL
Sbjct: 3   SSAAIAYGLDKKG-GEKNILVFYLGGGICDVSVLTIDNGVFEVLATNGDTHL 53


>UniRef50_A7AN53 Cluster: DnaK family protein; n=1; Babesia
           bovis|Rep: DnaK family protein - Babesia bovis
          Length = 755

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           P +GID+G   + V     G ++++ N+   R TP   +FT   RL GD A  Q+
Sbjct: 2   PVLGIDIGDANATVATIAKGSIDVVLNEVSQRYTPVCASFTQKRRLFGDQATPQM 56


>UniRef50_A2EPF1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 657

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/47 (48%), Positives = 28/47 (59%)
 Frame = +1

Query: 370 PKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           P+I V YKG  K   P EVSS +L  +K  AE  L   ++ AVITVP
Sbjct: 103 PEIIVNYKGNQKVLKPVEVSSQILAYLKSQAERRLRTKIKRAVITVP 149



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 20/55 (36%), Positives = 32/55 (58%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           F   Q Q TKDA   +GL  + +++EP ++ + Y        ++NV+I+D GGGT
Sbjct: 152 FKKIQTQFTKDAAEAAGLESV-LLSEPESSVLYYKTKIDTDAKQNVIIYDFGGGT 205



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTT+S +  +   +  V +I  D GN++ PS V + D  +L+G+ A  +  + P
Sbjct: 10  LGIDLGTTFSSIAYYDKNRQMVHLIEID-GNKSIPSVVYYGD-PKLVGNQAYERAKIEP 66



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 17/33 (51%), Positives = 23/33 (69%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +PN  I+D+KRLIG K++D  VQ   K  PFE+
Sbjct: 65  EPNLVIYDSKRLIGCKYQD--VQEICKTMPFEI 95


>UniRef50_A2UL28 Cluster: Glutamate dehydrogenase; n=5;
           Enterobacteriaceae|Rep: Glutamate dehydrogenase -
           Escherichia coli B
          Length = 678

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/56 (41%), Positives = 36/56 (64%)
 Frame = -2

Query: 680 STAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEV 513
           ST  +V ++  + +ST FV+TVS RS  RF+DD+   Q  D  C+F  L+L +++V
Sbjct: 467 STTTQVINRDSTVAST-FVQTVSQRSCGRFVDDTFYFQTSDTACVFGCLTLSIVKV 521


>UniRef50_A2EVQ1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 1135

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           FN  Q +  K A   + +++L  I EPTAAAIA  +   G  ++ ++IFD GGGT
Sbjct: 153 FNAEQCERIKSAAKAAKIDILSTIYEPTAAAIASNVMSSGKNQK-LMIFDFGGGT 206


>UniRef50_UPI000049A3E9 Cluster: 70 kDa heat shock protein; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: 70 kDa heat shock
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 674

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/55 (40%), Positives = 33/55 (60%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           F+DSQR AT+ A  ++G+  + IINEP+A  + Y  +        V++ D GGGT
Sbjct: 156 FSDSQRLATERAVRLAGVKDVNIINEPSATILLYQNEFHIKEGNRVVVIDFGGGT 210



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 4/61 (6%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER----LIGDAAKNQ 245
           K  +VGIDLGTT   V   + G    I         PS+++ ++ +     +IG+AAKN 
Sbjct: 5   KIVSVGIDLGTTCCYVACIEDGNEPKILLMNNEDYLPSWISLSNVKNGLGVIIGEAAKNN 64

Query: 246 V 248
           +
Sbjct: 65  I 65


>UniRef50_A4RY30 Cluster: Heat Shock Protein 70, ER lumen; n=2;
           Ostreococcus|Rep: Heat Shock Protein 70, ER lumen -
           Ostreococcus lucimarinus CCE9901
          Length = 884

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/53 (37%), Positives = 37/53 (69%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLG 671
           + + SQR+A +DA  I+GLNVL + ++ + AA+ +G+DK+    + V++ D+G
Sbjct: 146 FASQSQRRALRDAAEIAGLNVLAMKSDLSCAALQWGIDKEFPEPKWVILVDVG 198



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           +GIDLG  +    +   G+  + I  N+   R T + V+F + ER IG+ A + +  +PT
Sbjct: 1   MGIDLGGEFLKASLVAPGRTPIAITLNEVSKRKTTAAVSFFNDERAIGEPANDLMPRSPT 60


>UniRef50_Q4QDQ2 Cluster: Heat shock protein, putative; n=5;
           Trypanosomatidae|Rep: Heat shock protein, putative -
           Leishmania major
          Length = 823

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +3

Query: 93  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD 230
           GID G   S V + ++G V+I+ N+   R T + V+F D ER IG+
Sbjct: 5   GIDFGNVNSTVAITRYGGVDIVTNEVSKRETTTIVSFVDDERFIGE 50



 Score = 36.3 bits (80), Expect = 0.81
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 6/63 (9%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK----KGTGERN--VLIFDLGG 674
           Y+   QR+    A  ++GL+ + +INE TA+A+ YG+ +    K T E    V I D+G 
Sbjct: 153 YYTAEQRRLMYQAAEVAGLHCMSLINETTASAVDYGIFRGASLKETMEEGQVVGILDIGY 212

Query: 675 GTS 683
           G +
Sbjct: 213 GAT 215



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 7/65 (10%)
 Frame = +1

Query: 337 LAFRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKE------TAEAYLGKTVQNA 495
           L   ++ D  G+    V Y GE+K F+PE+V +M+L +++       T +  +   V++ 
Sbjct: 87  LTCNIIGDTSGRLMFSVNYCGEEKHFYPEQVLAMMLQRLRSYVNEAATTDPRVKADVRDF 146

Query: 496 VITVP 510
           VITVP
Sbjct: 147 VITVP 151


>UniRef50_Q4Q9A4 Cluster: Heat shock 70 protein-like protein; n=3;
           Leishmania|Rep: Heat shock 70 protein-like protein -
           Leishmania major
          Length = 944

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG-LDKKGTGERN 650
           AYF   Q+ AT+DA   +G +VL II+EP+AA +AY  L+K    ER+
Sbjct: 236 AYFTPQQKVATEDAALCAGFDVLEIIDEPSAACLAYTVLEKLKREERD 283



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 4/67 (5%)
 Frame = +3

Query: 51  KTD*KYKMAKAPAVGIDLGTTYSCVGVFQHG--KVEIIANDQGNRTTPSYVAFTDTE--R 218
           K D + K  +   +GIDLGTT SC+        + +II +  G+   P+ + F      R
Sbjct: 81  KEDTREKRGRGRVIGIDLGTTNSCICYIDAATRRPKIIPSPTGSWVYPTAITFDKNHQIR 140

Query: 219 LIGDAAK 239
           + G+ A+
Sbjct: 141 MFGEEAR 147


>UniRef50_A7SM46 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 938

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/61 (36%), Positives = 39/61 (63%), Gaps = 4/61 (6%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK----GTGERNVLIFDLGGGT 680
           +FN ++R+A   A  + GLNVL+I+N  TA A+ YGL ++     T E++ + +D+G  +
Sbjct: 173 FFNQAERRALLRAAELVGLNVLQIMNSNTAVALNYGLFQQKSFNDTLEKHFMFYDMGASS 232

Query: 681 S 683
           +
Sbjct: 233 T 233


>UniRef50_A4IC10 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania infantum
          Length = 724

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 2/51 (3%)
 Frame = +3

Query: 525 SQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER--NVLIFDLG 671
           ++R+A  DA  +SGL+VL +++  TAAA  YG+  +G G     V++FDLG
Sbjct: 175 AERRAILDAARLSGLSVLGLMHSTTAAAFYYGVRHRGFGNNTLRVVVFDLG 225



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A  +G+DLG+ Y  V    HG   V+I+ N+Q  R T +++ F  ++  IGD AK+  A 
Sbjct: 25  AHVIGVDLGSEYIKVAG-PHGDKGVDIVLNEQSRRKTDNFIGFRRSDLYIGDTAKSLAAR 83

Query: 255 TPTTQYSMPN 284
            P    S  N
Sbjct: 84  FPLCTASAVN 93


>UniRef50_A2DHP3 Cluster: Heat shock protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Heat shock protein,
           putative - Trichomonas vaginalis G3
          Length = 266

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 6/64 (9%)
 Frame = +3

Query: 87  AVGIDLGTT-----YSCVGVFQHGKVEIIANDQ-GNRTTPSYVAFTDTERLIGDAAKNQV 248
           A+GIDLGT      Y+  G  +    E++ NDQ G  TTP+ V+FTD   LIG+ A+   
Sbjct: 3   AIGIDLGTNNSRIAYNTSGPNEIPSFELLLNDQTGKSTTPTLVSFTDDSILIGEEARKVY 62

Query: 249 AMTP 260
           A  P
Sbjct: 63  ADKP 66



 Score = 37.9 bits (84), Expect = 0.26
 Identities = 21/52 (40%), Positives = 27/52 (51%)
 Frame = +3

Query: 525 SQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           SQR A K    ISG NVL++I EP AA + Y L +       +L+   G  T
Sbjct: 154 SQRAAMKRVAEISGFNVLKVITEPVAATV-YALHQVPFQNGKILVCYFGAST 204


>UniRef50_A1FNI8 Cluster: Glutamate dehydrogenase; n=1; Pseudomonas
           putida W619|Rep: Glutamate dehydrogenase - Pseudomonas
           putida W619
          Length = 710

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/38 (52%), Positives = 26/38 (68%)
 Frame = -2

Query: 626 VKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEV 513
           V  +  RSS RF+DD+  VQ RD T +F GL+L V+EV
Sbjct: 523 VHAIGQRSSGRFVDDAFYVQTRDATGVFGGLTLAVVEV 560


>UniRef50_Q9SAB1 Cluster: F25C20.19 protein; n=3; core
           eudicotyledons|Rep: F25C20.19 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 763

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/62 (30%), Positives = 33/62 (53%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D+G     + V +   ++++ ND+ NR  P+ V+F + +R +G AA     M P + 
Sbjct: 4   VGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHPKST 63

Query: 270 YS 275
            S
Sbjct: 64  IS 65



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 5/93 (5%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK----KGTGERNV 653
           ++C     +YF +SQR A  DA  I+GL  LR++++ TA A+ YG+ K      +    +
Sbjct: 138 SDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATALGYGIYKTDLVANSSPTYI 197

Query: 654 LIFDLGG-GTSTCPSLPSRRYLRGEIHRGDTHL 749
           +  D+G   T  C +      +R   H  D +L
Sbjct: 198 VFIDIGHCDTQVCVASFESGSMRVRSHAFDRNL 230



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFELSV-MEANLRSR*HIRVKTKPFSP 418
           P +TI   KRLIGRKF +  VQ D++ +PFE S   +  ++ R     + + FSP
Sbjct: 60  PKSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEIQSFSP 114


>UniRef50_Q9S8V5 Cluster: ATP-binding HSP70 homolog; n=4; cellular
           organisms|Rep: ATP-binding HSP70 homolog - Zea mays
           (Maize)
          Length = 33

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 18/23 (78%), Positives = 21/23 (91%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEII 158
           +GIDLGTTYSCVG++QH  VEII
Sbjct: 11  IGIDLGTTYSCVGLWQHDXVEII 33


>UniRef50_Q6L4S6 Cluster: Putative uncharacterized protein
           P0663C08.2; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0663C08.2 - Oryza sativa subsp. japonica (Rice)
          Length = 437

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 17/34 (50%), Positives = 26/34 (76%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F PE+V+ +++  +K TAEA+LG  + NAV+TVP
Sbjct: 153 FLPEDVAGILIAHLKSTAEAHLGHRIDNAVVTVP 186



 Score = 40.3 bits (90), Expect = 0.049
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGT-ISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTS 683
           +FN +QRQ      T   G   + +++E  AAA A+GL +     + +L+F LGG T+
Sbjct: 188 HFNGNQRQEVSSGSTEYGGFRYVSVVDEQVAAAAAHGLHEDRGDGKVILVFHLGGRTA 245


>UniRef50_Q01M68 Cluster: OSIGBa0114M03.5 protein; n=4; Oryza
           sativa|Rep: OSIGBa0114M03.5 protein - Oryza sativa
           (Rice)
          Length = 581

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/57 (36%), Positives = 37/57 (64%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           ++FN+ QR+    AG  +GL +L++I+EP AAA++    K+G     V++F +G G+
Sbjct: 110 SFFNEQQREDIMSAGRRAGLEILQLIDEPIAAALSSTTIKEGV----VVVFGMGAGS 162



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           P++ +F+ K LIG+ F D+ VQ   K  PF +
Sbjct: 28  PSDVVFNVKNLIGKHFNDSCVQEMRKRLPFSI 59


>UniRef50_A2XF45 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 59

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 17/21 (80%), Positives = 20/21 (95%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQH 140
           + PA+GIDLGTTYSCVGV+QH
Sbjct: 7   EGPAIGIDLGTTYSCVGVWQH 27


>UniRef50_Q9GYV8 Cluster: 70-kDa heat shock protein; n=5; Entamoeba
           histolytica|Rep: 70-kDa heat shock protein - Entamoeba
           histolytica
          Length = 558

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 5/83 (6%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT---GERNVLIFDLGGGT-- 680
           FND QR AT  A  ++ +  + ++NEPTAA + Y  +   +   G+R +L+ D GGGT  
Sbjct: 160 FNDRQRDATLLACKLAEIKNVELVNEPTAAIVEYKREYPNSLKDGDR-ILVIDFGGGTLD 218

Query: 681 STCPSLPSRRYLRGEIHRGDTHL 749
             C  + +   ++ E   GD  L
Sbjct: 219 VACCKIINDNNIKVESSGGDQDL 241



 Score = 37.5 bits (83), Expect = 0.35
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 6/59 (10%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTER----LIGDAAKNQ 245
           ++GIDLGTTYS +  +    G+  I+ ++ G     S+V+ +  ++    +IG++AKN+
Sbjct: 9   SIGIDLGTTYSSIAYYDITRGESVIVQDELGKEQVASWVSLSRLDKSGYTIIGNSAKNE 67


>UniRef50_Q22515 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 921

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/61 (36%), Positives = 42/61 (68%), Gaps = 3/61 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLGGGTS 683
           + N ++R+A   A  I+GLN+L+++N+ +AAA+ YG+  +K   E+  ++LI+D+G   +
Sbjct: 171 FLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMGAVKT 230

Query: 684 T 686
           T
Sbjct: 231 T 231



 Score = 33.5 bits (73), Expect = 5.7
 Identities = 15/43 (34%), Positives = 27/43 (62%)
 Frame = +1

Query: 382 VAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           V +  +++ +  E + +M+L   K+  EAY  +TV++ VITVP
Sbjct: 127 VVFPYKEEKYNVETLLAMILWNAKKVTEAYADQTVKDVVITVP 169


>UniRef50_A2EFJ4 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 719

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/55 (40%), Positives = 34/55 (61%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           FN  Q +  K A   +G++++  I EPTAAAI+ G+      ++ ++IFD GGGT
Sbjct: 157 FNVEQCERIKLAARAAGIDIIATIYEPTAAAISSGM--MAATDKKLMIFDFGGGT 209


>UniRef50_Q8RH06 Cluster: Putative uncharacterized protein FN0115;
           n=2; Bacteria|Rep: Putative uncharacterized protein
           FN0115 - Fusobacterium nucleatum subsp. nucleatum
          Length = 98

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 26/58 (44%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -3

Query: 262 VGVIATWFLAASPMRRS-VSVNAT*DGVVLLPWSLAMISTFPCWKTPTQEYVVPRSIP 92
           VG +     A SP   S +S+  T DGVVL P    +I   P   T TQE+VVP+SIP
Sbjct: 8   VGFVTACLFAISPTTTSPLSLIFTTDGVVLAPSEFGIIVALPPSITATQEFVVPKSIP 65


>UniRef50_Q4ETY1 Cluster: Putative uncharacterized protein; n=2;
           Listeria monocytogenes|Rep: Putative uncharacterized
           protein - Listeria monocytogenes str. 1/2a F6854
          Length = 79

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 25/62 (40%), Positives = 33/62 (53%)
 Frame = -3

Query: 277 IEYCVVGVIATWFLAASPMRRSVSVNAT*DGVVLLPWSLAMISTFPCWKTPTQEYVVPRS 98
           +E  V G++     A SP  RS  +  T +GVV  P  L +I   P   T T E+VVP+S
Sbjct: 1   MELIVFGLVIAARFATSPTWRSPFLKPTTEGVVRAPSGLGIILASPPSNTATAEFVVPKS 60

Query: 97  IP 92
           IP
Sbjct: 61  IP 62


>UniRef50_A2FKE2 Cluster: DnaK protein; n=3; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 573

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           F+  Q++  + A   +G+ V+  + E +AAAIAYGL      E+ +LIFD GGGT
Sbjct: 136 FSRIQKEKIQIAAKAAGIQVVSFLPESSAAAIAYGL--LNNTEQKLLIFDFGGGT 188



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFELSVME 364
           N  I+D KR +G+ + D  +Q D K WPF++S  E
Sbjct: 49  NQVIYDTKRALGKMYNDPVIQDDKKSWPFQISADE 83


>UniRef50_Q66239 Cluster: 65-kDa protein; n=19; Citrus tristeza
           virus|Rep: 65-kDa protein - Citrus tristeza virus
          Length = 594

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/57 (38%), Positives = 37/57 (64%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A +N  QR  T+ + ++SG + + IINEP+AAA +  L K  + ++ + ++D GGGT
Sbjct: 153 AGYNTLQRAFTQQSISMSGYSCVYIINEPSAAAYS-TLPKLNSADKYLAVYDFGGGT 208


>UniRef50_Q655N4 Cluster: Putative heat-shock protein; n=2; Oryza
           sativa|Rep: Putative heat-shock protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 753

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG 641
           ++C      YF  +QRQA  DA  ++GL  LR++++  A A+ YGL +   G
Sbjct: 142 SDCVISVPCYFTQAQRQAYLDAAAVAGLRPLRLMHDLAATALGYGLYRSDLG 193



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 15/49 (30%), Positives = 26/49 (53%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           VG D+G         +   ++++ N + NR +P+ VAF+   RL+G  A
Sbjct: 4   VGFDVGNDTLVAAAARQRGIDVLLNAESNRESPAAVAFSHNARLLGPHA 52


>UniRef50_A2E407 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 693

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +3

Query: 462 RSLSWQNCAECSYHGSAYFNDSQRQAT-KDAGTISGLNVLRIINEPTAAAIAYGLDKKGT 638
           ++L+   C++      A F+  QR+ T   A  I+G   + +++EP+AAA+ Y       
Sbjct: 134 KTLTSGECSDVVVTVPAAFDSIQREKTILAAKEIAGFKHVALLDEPSAAALEYAQGLPKH 193

Query: 639 GERNVLIFDLGGGT 680
            +  VLIFD GGGT
Sbjct: 194 TQEKVLIFDFGGGT 207



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 2/55 (3%)
 Frame = +2

Query: 266 TIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTK--PFSPRK 424
           T++D+KR+IG+KF++   Q D K+W FE +V  AN     +I  K K  P +P +
Sbjct: 66  TVYDSKRMIGKKFDNKDFQIDRKNWMFE-TVRGANNSININIEYKGKIIPLAPEE 119



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLGTTY CV ++   K  I++   D      PSYV++     L G  A NQ+
Sbjct: 6   VGIDLGTTYCCVHIYDE-KRHIVSPILDGSTSQIPSYVSYCGDNILYGAVAMNQI 59


>UniRef50_Q1E6G2 Cluster: Heat shock protein 70 homolog; n=17;
           Pezizomycotina|Rep: Heat shock protein 70 homolog -
           Coccidioides immitis
          Length = 577

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP- 260
           A+GI  G + S +  +   GK ++IAN++G+R  PS +++ + E   G  AK Q+   P 
Sbjct: 17  AIGISFGNSNSSIAHISPEGKPQVIANEEGDRHIPSVLSYVEGEEYHGAQAKAQLVRNPK 76

Query: 261 -TTQYSMPNVSSDVSS 305
            T  Y    +  D  S
Sbjct: 77  NTIAYFRDYLGKDFKS 92



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 1/65 (1%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY-GLDKKGTGERNVLIFDLGGGTSTCP 692
           F+++QR A K A   +G++V++ ++EP AA +AY  + +    ++ V++ D GG  S   
Sbjct: 162 FSEAQRTALKVAAKEAGVDVIQFVHEPVAALLAYDAIPEAQVKDKLVVVADFGGTRSDIA 221

Query: 693 SLPSR 707
            + SR
Sbjct: 222 IIASR 226



 Score = 33.9 bits (74), Expect = 4.3
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           E  T    E+++  L ++K++A  +LGK V  AV+TVP
Sbjct: 122 EPNTITVSEITTRHLRRLKQSASDFLGKDVNAAVVTVP 159


>UniRef50_A4EA23 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 516

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 23/55 (41%), Positives = 35/55 (63%)
 Frame = -2

Query: 677 TAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEV 513
           TAA+VKD+  +    L V+ +   SS R +DD+ +V+A D T +  GL+L V+EV
Sbjct: 321 TAAQVKDQN-TLVGALLVQAIGQSSSGRLVDDTLDVEAGDLTGVLGGLTLGVVEV 374


>UniRef50_A0NRW0 Cluster: Heat shock protein Hsp70; n=1; Stappia
           aggregata IAM 12614|Rep: Heat shock protein Hsp70 -
           Stappia aggregata IAM 12614
          Length = 815

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA-YGLDKKGTGERNVLIFDLGGGT 680
           A FN  Q +AT  A  ++GL  + ++ EP AAA+A     KK  G    L++DLGGGT
Sbjct: 96  AAFNQMQNEATISAAKMAGLKRVSLLQEPVAAAMASIAHSKKRDGV--FLVYDLGGGT 151


>UniRef50_Q1NR74 Cluster: Heat shock protein Hsp70; n=3;
           Proteobacteria|Rep: Heat shock protein Hsp70 - delta
           proteobacterium MLMS-1
          Length = 832

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 23/57 (40%), Positives = 33/57 (57%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           A FN  Q+ AT  A +++GL  + I+ EP AA ++    +   G    LI+DLGGGT
Sbjct: 123 AAFNQMQKDATMQAASMAGLGKVAIMQEPVAAVMSVMRARNTDG--MFLIYDLGGGT 177


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 834,355,344
Number of Sequences: 1657284
Number of extensions: 18536844
Number of successful extensions: 58800
Number of sequences better than 10.0: 390
Number of HSP's better than 10.0 without gapping: 55072
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58570
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 61734884250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -