SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20055
         (759 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2VA67 Cluster: Putative heat schock protein 70; n=1; T...   163   3e-39
UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=23...   163   4e-39
UniRef50_Q9UQC1 Cluster: Heat shock protein 72; n=10; Fungi/Meta...   161   1e-38
UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931; roo...   161   1e-38
UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precur...   146   4e-34
UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome sho...   144   2e-33
UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9; ...   144   3e-33
UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock...   137   2e-31
UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago...   137   3e-31
UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|R...   134   2e-30
UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Re...   132   1e-29
UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial precur...   132   1e-29
UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular ...   131   2e-29
UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonosp...   130   4e-29
UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole gen...   130   5e-29
UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular...   130   5e-29
UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial ...   129   6e-29
UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular ...   129   6e-29
UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2; ...   129   8e-29
UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular...   128   1e-28
UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellula...   128   2e-28
UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n...   127   3e-28
UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular...   126   6e-28
UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock...   126   8e-28
UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock...   125   1e-27
UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella nata...   125   1e-27
UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 7...   124   2e-27
UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38; Bacteria|...   124   3e-27
UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep: ...   123   6e-27
UniRef50_P02826 Cluster: Heat shock 70 kDa protein cognate 1; n=...   122   1e-26
UniRef50_UPI000058655A Cluster: PREDICTED: similar to heat shock...   121   2e-26
UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2; Enta...   120   3e-26
UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter ...   120   3e-26
UniRef50_A0DHP4 Cluster: Chromosome undetermined scaffold_50, wh...   120   3e-26
UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum fer...   120   4e-26
UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular ...   120   4e-26
UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3; Planctomyc...   120   5e-26
UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n...   116   8e-25
UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia stip...   116   8e-25
UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia stip...   115   1e-24
UniRef50_Q1CWT5 Cluster: DnaK family protein; n=2; Cystobacterin...   114   2e-24
UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella natan...   112   8e-24
UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:...   111   2e-23
UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188; Bacteria...   111   2e-23
UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4; Cystobacterin...   110   3e-23
UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29; Proteobac...   110   3e-23
UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera a...   110   3e-23
UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas vaginali...   110   4e-23
UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27; P...   110   4e-23
UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3; Psychrobacter...   109   1e-22
UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gamb...   109   1e-22
UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodosp...   108   1e-22
UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular or...   108   2e-22
UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26; Bacteria|...   107   2e-22
UniRef50_A3CIL0 Cluster: Putative uncharacterized protein; n=2; ...   107   2e-22
UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus...   107   3e-22
UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2; Gammapro...   107   3e-22
UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1; ...   106   5e-22
UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13; Rickett...   106   7e-22
UniRef50_A2Y3V8 Cluster: Putative uncharacterized protein; n=4; ...   105   9e-22
UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1; Aca...   105   9e-22
UniRef50_Q6F9S6 Cluster: Chaperone protein; n=2; Acinetobacter|R...   105   1e-21
UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas s...   105   1e-21
UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago...   105   2e-21
UniRef50_Q73CC4 Cluster: Dnak protein, truncation; n=1; Bacillus...   104   2e-21
UniRef50_A7HBX9 Cluster: 2-alkenal reductase precursor; n=7; Cys...   104   3e-21
UniRef50_A4J964 Cluster: Heat shock protein 70; n=2; Clostridial...   104   3e-21
UniRef50_A2WTX8 Cluster: Putative uncharacterized protein; n=1; ...   104   3e-21
UniRef50_UPI0000D56BFD Cluster: PREDICTED: similar to CG8937-PA,...   103   5e-21
UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1; N...   103   5e-21
UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone...   103   5e-21
UniRef50_A2Y4X8 Cluster: Putative uncharacterized protein; n=1; ...   103   5e-21
UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=...   102   8e-21
UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep...   102   1e-20
UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3; ...   102   1e-20
UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4; Planctomyc...   101   3e-20
UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus ...   101   3e-20
UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1; Methanospir...   101   3e-20
UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma marg...    99   6e-20
UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter ...    99   6e-20
UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshime...    99   6e-20
UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2; Anaeromyxob...    99   1e-19
UniRef50_Q4P628 Cluster: Putative uncharacterized protein; n=1; ...    99   1e-19
UniRef50_Q64YI6 Cluster: Chaperone protein DnaK; n=2; Bacteroide...    99   1e-19
UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera a...    99   1e-19
UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: Dna...    98   2e-19
UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2; Panspora...    98   2e-19
UniRef50_Q1CY00 Cluster: DnaK family protein; n=2; Cystobacterin...    97   3e-19
UniRef50_A6C7U8 Cluster: DnaK protein (Heat shock protein), C-te...    97   4e-19
UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera aphi...    97   5e-19
UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena ...    96   7e-19
UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    95   1e-18
UniRef50_UPI0000510557 Cluster: COG0443: Molecular chaperone; n=...    95   2e-18
UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein), C-te...    95   2e-18
UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1; Syntroph...    95   2e-18
UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock...    95   2e-18
UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacif...    94   4e-18
UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14; R...    94   4e-18
UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;...    93   5e-18
UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone...    93   9e-18
UniRef50_Q010Y3 Cluster: DNAK_GLOVI Chaperone protein dnaK; n=1;...    92   1e-17
UniRef50_A6EQS3 Cluster: Heat shock protein Hsp70; n=1; unidenti...    91   2e-17
UniRef50_A6C7U7 Cluster: DnaK protein (Heat shock protein), HSP7...    91   2e-17
UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1; Planctom...    91   2e-17
UniRef50_P77319 Cluster: Chaperone protein hscC; n=19; Gammaprot...    91   2e-17
UniRef50_A5MZQ7 Cluster: DnaK9; n=1; Clostridium kluyveri DSM 55...    91   4e-17
UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein), HSP7...    90   5e-17
UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1; Enta...    89   8e-17
UniRef50_A2DR00 Cluster: DnaK protein; n=7; Trichomonas vaginali...    89   8e-17
UniRef50_Q20752 Cluster: Putative uncharacterized protein stc-1;...    88   2e-16
UniRef50_A4QNX8 Cluster: Zgc:162281 protein; n=6; Eumetazoa|Rep:...    87   6e-16
UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA...    86   1e-15
UniRef50_O88687 Cluster: Heat shock protein 70; n=2; Euteleostom...    86   1e-15
UniRef50_UPI0000499E28 Cluster: hsp70 family protein; n=1; Entam...    85   1e-15
UniRef50_A2EAK8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    85   1e-15
UniRef50_A3BBU4 Cluster: Putative uncharacterized protein; n=2; ...    85   2e-15
UniRef50_A6UND5 Cluster: 2-alkenal reductase; n=1; Methanococcus...    85   2e-15
UniRef50_A5N5I5 Cluster: DnaK1; n=1; Clostridium kluyveri DSM 55...    84   3e-15
UniRef50_P48723 Cluster: Stress 70 protein chaperone microsome-a...    84   4e-15
UniRef50_Q8YNT4 Cluster: DnaK-type molecular chaperone; n=2; Nos...    83   7e-15
UniRef50_A7BR82 Cluster: Heat shock protein Hsp70; n=1; Beggiato...    83   7e-15
UniRef50_A2DWC1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    83   7e-15
UniRef50_UPI0000499681 Cluster: heat shock protein 70; n=1; Enta...    83   1e-14
UniRef50_Q1VU26 Cluster: Heat shock protein Hsp70; n=2; Bacteroi...    82   1e-14
UniRef50_UPI000038E267 Cluster: hypothetical protein Faci_030017...    81   2e-14
UniRef50_Q3W504 Cluster: Heat shock protein Hsp70; n=3; Actinomy...    81   3e-14
UniRef50_A6NYB9 Cluster: Putative uncharacterized protein; n=1; ...    81   4e-14
UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2; Actinomy...    81   4e-14
UniRef50_UPI00005A2730 Cluster: PREDICTED: similar to heat shock...    80   5e-14
UniRef50_Q3SD91 Cluster: Cytosol-type hsp70; n=1; Paramecium tet...    80   5e-14
UniRef50_Q9M7S4 Cluster: Heat shock protein 70; n=1; Triticum ae...    80   7e-14
UniRef50_A2F432 Cluster: DnaK protein; n=1; Trichomonas vaginali...    80   7e-14
UniRef50_A7PZE7 Cluster: Chromosome chr15 scaffold_40, whole gen...    79   9e-14
UniRef50_Q1D211 Cluster: DnaK family protein; n=1; Myxococcus xa...    79   1e-13
UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia intest...    79   1e-13
UniRef50_UPI0000498B17 Cluster: hsp70 family protein; n=1; Entam...    78   2e-13
UniRef50_A2G573 Cluster: DnaK protein; n=2; Trichomonas vaginali...    78   2e-13
UniRef50_Q4SW20 Cluster: Chromosome undetermined SCAF13693, whol...    78   3e-13
UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia bu...    77   4e-13
UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila aurari...    77   5e-13
UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    77   6e-13
UniRef50_A7PR73 Cluster: Chromosome chr14 scaffold_26, whole gen...    76   8e-13
UniRef50_Q0VDF9 Cluster: Heat shock 70 kDa protein 14; n=25; Eut...    76   8e-13
UniRef50_A6EMR6 Cluster: Heat shock protein Hsp70; n=1; unidenti...    75   1e-12
UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1; Saccharo...    75   1e-12
UniRef50_UPI0000498597 Cluster: chaperone protein dnaK; n=1; Ent...    75   2e-12
UniRef50_Q2QXK2 Cluster: DnaK protein, expressed; n=2; Oryza sat...    75   2e-12
UniRef50_A2G8T1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    75   3e-12
UniRef50_UPI0000DC15CB Cluster: UPI0000DC15CB related cluster; n...    74   3e-12
UniRef50_A5MZQ6 Cluster: DnaK8; n=2; Clostridium kluyveri DSM 55...    74   3e-12
UniRef50_Q9XZM1 Cluster: Heat shock protein HSP70-2; n=3; Entamo...    74   3e-12
UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168, w...    74   3e-12
UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1; ...    74   3e-12
UniRef50_A2ECV1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    74   4e-12
UniRef50_Q52V38 Cluster: Heat shock protein 70-like; n=4; Mint v...    73   6e-12
UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n...    73   6e-12
UniRef50_UPI0000498BE2 Cluster: chaperone protein dnaK; n=2; Ent...    73   8e-12
UniRef50_Q3WFH0 Cluster: Heat shock protein Hsp70; n=1; Frankia ...    73   8e-12
UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    73   8e-12
UniRef50_A2ECF5 Cluster: DnaK protein; n=1; Trichomonas vaginali...    72   1e-11
UniRef50_UPI00015B551B Cluster: PREDICTED: similar to ENSANGP000...    72   2e-11
UniRef50_Q7M080 Cluster: DnaK-type molecular chaperone; n=1; Cri...    72   2e-11
UniRef50_Q54GD7 Cluster: Heat shock protein Hsp70 family protein...    72   2e-11
UniRef50_Q06068 Cluster: 97 kDa heat shock protein; n=3; Strongy...    72   2e-11
UniRef50_Q66239 Cluster: 65-kDa protein; n=19; Citrus tristeza v...    71   2e-11
UniRef50_A6CBP2 Cluster: Dnak protein, truncation; n=1; Planctom...    71   2e-11
UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein...    71   2e-11
UniRef50_O14992 Cluster: HS24/P52; n=8; Eutheria|Rep: HS24/P52 -...    71   2e-11
UniRef50_O59838 Cluster: Heat shock protein homolog pss1; n=21; ...    71   3e-11
UniRef50_Q7ZUM5 Cluster: Heat shock protein 4; n=20; Euteleostom...    71   4e-11
UniRef50_Q9VUC1 Cluster: CG6603-PA, isoform A; n=7; Endopterygot...    70   5e-11
UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM 55...    70   7e-11
UniRef50_Q7YUE0 Cluster: Hsp70 protein; n=1; Milnesium tardigrad...    70   7e-11
UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM 55...    69   1e-10
UniRef50_A2EPF1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    69   1e-10
UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena t...    69   2e-10
UniRef50_Q9SAB1 Cluster: F25C20.19 protein; n=3; core eudicotyle...    69   2e-10
UniRef50_Q96269 Cluster: Heat-shock protein; n=14; Magnoliophyta...    69   2e-10
UniRef50_A2R006 Cluster: Contig An12c0210, complete genome; n=1;...    69   2e-10
UniRef50_A2E407 Cluster: DnaK protein; n=1; Trichomonas vaginali...    68   3e-10
UniRef50_Q3UYY6 Cluster: 13 days embryo forelimb cDNA, RIKEN ful...    67   4e-10
UniRef50_Q92598 Cluster: Heat shock protein 105 kDa; n=92; Eumet...    67   4e-10
UniRef50_UPI0000499AA8 Cluster: hsp70 family protein; n=1; Entam...    67   5e-10
UniRef50_A2VD43 Cluster: Heat shock protein 14; n=3; Clupeocepha...    67   5e-10
UniRef50_Q2H062 Cluster: Putative uncharacterized protein; n=2; ...    67   5e-10
UniRef50_Q05036 Cluster: Uncharacterized protein C30C11.4; n=2; ...    66   7e-10
UniRef50_P32590 Cluster: Heat shock protein homolog SSE2; n=20; ...    66   7e-10
UniRef50_UPI0000F1F58C Cluster: PREDICTED: similar to Heat shock...    66   9e-10
UniRef50_A5AUN6 Cluster: Putative uncharacterized protein; n=1; ...    66   9e-10
UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lambl...    66   9e-10
UniRef50_A0MBW7 Cluster: HSP 70h; n=6; Closterovirus|Rep: HSP 70...    66   1e-09
UniRef50_P37092 Cluster: Heat shock protein 70 homolog; n=5; Clo...    66   1e-09
UniRef50_Q9QCV8 Cluster: Heat shock 70 protein; n=2; Plum bark n...    65   2e-09
UniRef50_A2FKE2 Cluster: DnaK protein; n=3; Trichomonas vaginali...    65   2e-09
UniRef50_A7QL81 Cluster: Chromosome chr3 scaffold_117, whole gen...    65   2e-09
UniRef50_Q1D082 Cluster: DnaK family protein; n=2; Cystobacterin...    64   3e-09
UniRef50_A4ZIR9 Cluster: Heat shock protein 70; n=12; Closterovi...    64   4e-09
UniRef50_A5B0E9 Cluster: Putative uncharacterized protein; n=1; ...    64   5e-09
UniRef50_UPI0000E474BD Cluster: PREDICTED: hypothetical protein;...    63   6e-09
UniRef50_A5N5I8 Cluster: DnaK4; n=1; Clostridium kluyveri DSM 55...    63   6e-09
UniRef50_Q4RM18 Cluster: Chromosome 10 SCAF15019, whole genome s...    63   8e-09
UniRef50_A7RF55 Cluster: Predicted protein; n=1; Nematostella ve...    63   8e-09
UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG070...    62   1e-08
UniRef50_A2EVQ1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    62   1e-08
UniRef50_A6GJQ9 Cluster: Heat shock protein Hsp70; n=1; Plesiocy...    62   1e-08
UniRef50_Q4XZF4 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_A2DHP3 Cluster: Heat shock protein, putative; n=1; Tric...    62   1e-08
UniRef50_A0CZG2 Cluster: Chromosome undetermined scaffold_32, wh...    62   1e-08
UniRef50_Q8SWH2 Cluster: Similarity to HSP70-RELATED PROTEIN; n=...    62   1e-08
UniRef50_A7DID8 Cluster: Glutamate dehydrogenase; n=14; Alphapro...    61   3e-08
UniRef50_A4EA23 Cluster: Putative uncharacterized protein; n=1; ...    61   3e-08
UniRef50_A2DZ76 Cluster: DnaK protein; n=1; Trichomonas vaginali...    61   3e-08
UniRef50_Q1NQZ1 Cluster: Glutamate dehydrogenase precursor; n=1;...    61   3e-08
UniRef50_Q01M68 Cluster: OSIGBa0114M03.5 protein; n=4; Oryza sat...    60   4e-08
UniRef50_A0PTC6 Cluster: Chaperone protein DnaK1; n=3; Mycobacte...    60   6e-08
UniRef50_Q00YD5 Cluster: Heat shock protein 91-Arabidopsis thali...    60   6e-08
UniRef50_Q98159 Cluster: ORF1 protein; n=2; Little cherry virus ...    60   8e-08
UniRef50_A6NJU0 Cluster: Uncharacterized protein HSPA14; n=2; Eu...    60   8e-08
UniRef50_P38788 Cluster: Ribosome-associated complex subunit SSZ...    60   8e-08
UniRef50_A7BCD2 Cluster: Putative uncharacterized protein; n=1; ...    59   1e-07
UniRef50_UPI000049A3E9 Cluster: 70 kDa heat shock protein; n=2; ...    59   1e-07
UniRef50_UPI0000499107 Cluster: 70 kDa heat shock protein; n=1; ...    59   1e-07
UniRef50_Q9GYV8 Cluster: 70-kDa heat shock protein; n=5; Entamoe...    59   1e-07
UniRef50_Q86JV8 Cluster: Similar to heat shock protein; n=2; Dic...    59   1e-07
UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative g...    58   2e-07
UniRef50_Q8NN35 Cluster: Molecular chaperone; n=3; Corynebacteri...    58   2e-07
UniRef50_A5VT75 Cluster: Putative NAD-specific glutamate dehydro...    58   2e-07
UniRef50_A2EFJ4 Cluster: DnaK protein; n=1; Trichomonas vaginali...    58   2e-07
UniRef50_P87142 Cluster: Heat shock protein 70 homolog C57A7.12;...    58   2e-07
UniRef50_O71192 Cluster: 59 kDa protein; n=26; Grapevine leafrol...    58   3e-07
UniRef50_A0ZXN0 Cluster: Heat shock protein 70-like; n=1; Fig le...    58   3e-07
UniRef50_Q1YJU7 Cluster: Possible chaperone protein; n=1; Aurant...    58   3e-07
UniRef50_Q57VU9 Cluster: Heat shock 70 kDa protein, putative; n=...    58   3e-07
UniRef50_Q9Y4L1 Cluster: Hypoxia up-regulated protein 1 precurso...    58   3e-07
UniRef50_Q7T733 Cluster: P60; n=2; Little cherry virus 2|Rep: P6...    57   4e-07
UniRef50_A0NRW0 Cluster: Heat shock protein Hsp70; n=1; Stappia ...    57   4e-07
UniRef50_Q7M2S5 Cluster: DnaK-type molecular chaperone; n=1; Sus...    57   4e-07
UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginali...    57   4e-07
UniRef50_Q3VZ88 Cluster: Heat shock protein Hsp70; n=1; Frankia ...    57   5e-07
UniRef50_Q5C1F3 Cluster: SJCHGC04997 protein; n=1; Schistosoma j...    57   5e-07
UniRef50_Q805J2 Cluster: Heat shock protein 70-like protein; n=1...    56   7e-07
UniRef50_Q22CW2 Cluster: Heat shock protein 70 homolog; n=1; Tet...    56   7e-07
UniRef50_A2EMY0 Cluster: DnaK protein; n=4; Trichomonas vaginali...    56   7e-07
UniRef50_Q2INJ2 Cluster: Putative NAD-specific glutamate dehydro...    56   9e-07
UniRef50_A7CRR2 Cluster: Glutamate dehydrogenase; n=1; Opitutace...    56   9e-07
UniRef50_A2E4A6 Cluster: DnaK protein; n=2; Trichomonas vaginali...    56   9e-07
UniRef50_Q1E6G2 Cluster: Heat shock protein 70 homolog; n=17; Pe...    56   9e-07
UniRef50_A4AEG2 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_Q0WM51 Cluster: HSP like protein; n=11; Magnoliophyta|R...    56   1e-06
UniRef50_O23508 Cluster: Growth regulator like protein; n=6; Mag...    56   1e-06
UniRef50_Q22E65 Cluster: DnaK protein; n=1; Tetrahymena thermoph...    56   1e-06
UniRef50_UPI00006CA81B Cluster: dnaK protein; n=1; Tetrahymena t...    54   3e-06
UniRef50_Q4JX13 Cluster: Molecular chaperone protein; n=1; Coryn...    54   3e-06
UniRef50_Q6QCI1 Cluster: HSP70h; n=1; Mint vein banding virus|Re...    54   4e-06
UniRef50_A1FNI8 Cluster: Glutamate dehydrogenase; n=1; Pseudomon...    54   4e-06
UniRef50_A0C553 Cluster: Chromosome undetermined scaffold_15, wh...    54   4e-06
UniRef50_Q6CM78 Cluster: Similarities with sp|Q12355 Saccharomyc...    54   4e-06
UniRef50_Q9VSI1 Cluster: CG7182-PA; n=2; Sophophora|Rep: CG7182-...    54   5e-06
UniRef50_Q4QDQ2 Cluster: Heat shock protein, putative; n=5; Tryp...    54   5e-06
UniRef50_A3FQM0 Cluster: Heat shock 105kD; heat shock 105kD alph...    54   5e-06
UniRef50_UPI0000660D8E Cluster: Homolog of Homo sapiens "heat sh...    53   7e-06
UniRef50_Q1NCH4 Cluster: Putative NAD-specific glutamate dehydro...    53   7e-06
UniRef50_Q9Q6Q1 Cluster: HSP70-like protein; n=47; Grapevine lea...    53   9e-06
UniRef50_Q1NR74 Cluster: Heat shock protein Hsp70; n=3; Proteoba...    52   1e-05
UniRef50_A4ZY06 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q1EWS0 Cluster: Heat shock protein Hsp70; n=1; Clostrid...    52   2e-05
UniRef50_A0GV00 Cluster: Putative NAD-specific glutamate dehydro...    52   2e-05
UniRef50_UPI00004995BC Cluster: hsp70 family protein; n=1; Entam...    52   2e-05
UniRef50_Q9SKY8 Cluster: 70kD heat shock protein; n=6; Magnoliop...    52   2e-05
UniRef50_Q655N4 Cluster: Putative heat-shock protein; n=2; Oryza...    52   2e-05
UniRef50_O15797 Cluster: CG4; n=10; Plasmodium|Rep: CG4 - Plasmo...    52   2e-05
UniRef50_Q6CFA8 Cluster: Yarrowia lipolytica chromosome B of str...    51   3e-05
UniRef50_Q2A073 Cluster: Heat shock protein 70; n=11; Viruses|Re...    51   4e-05
UniRef50_A4FEW4 Cluster: Putative surface layer protein; n=1; Sa...    51   4e-05
UniRef50_A0UQH1 Cluster: Glutamate dehydrogenase; n=14; Proteoba...    51   4e-05
UniRef50_UPI0000D55C7E Cluster: PREDICTED: similar to CG2918-PA;...    50   5e-05
UniRef50_Q0EST2 Cluster: Heat shock protein 70; n=3; Thermoanaer...    50   5e-05
UniRef50_Q4CS27 Cluster: Putative uncharacterized protein; n=3; ...    50   5e-05
UniRef50_Q22758 Cluster: Putative uncharacterized protein; n=2; ...    50   6e-05
UniRef50_A2F7Z8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    50   6e-05
UniRef50_A6VWZ8 Cluster: Molecular chaperone; n=2; Marinomonas|R...    50   8e-05
UniRef50_A4FJJ3 Cluster: Putative uncharacterized protein; n=1; ...    50   8e-05
UniRef50_Q9X1N0 Cluster: Rod shape-determining protein MreB; n=1...    49   1e-04
UniRef50_Q9Q1X6 Cluster: Heat shock protein 70-like; n=2; Olive ...    49   1e-04
UniRef50_Q6L4S6 Cluster: Putative uncharacterized protein P0663C...    49   1e-04
UniRef50_Q4Q9A4 Cluster: Heat shock 70 protein-like protein; n=3...    49   1e-04
UniRef50_A4IC10 Cluster: Putative uncharacterized protein; n=3; ...    49   1e-04
UniRef50_A2UL28 Cluster: Glutamate dehydrogenase; n=5; Enterobac...    48   2e-04
UniRef50_A4RY30 Cluster: Heat Shock Protein 70, ER lumen; n=2; O...    48   2e-04
UniRef50_A7SM46 Cluster: Predicted protein; n=1; Nematostella ve...    48   2e-04
UniRef50_A1TTJ9 Cluster: Putative chaperone heat-shock protein; ...    48   3e-04
UniRef50_A2F0R7 Cluster: DnaK protein; n=2; Trichomonas vaginali...    48   3e-04
UniRef50_Q04E70 Cluster: Actin-like ATPase for cell morphogenesi...    48   3e-04
UniRef50_UPI0000DB7485 Cluster: PREDICTED: similar to CG2918-PA;...    47   4e-04
UniRef50_Q9DQ89 Cluster: Heat shock protein 70; n=3; Ampelovirus...    47   4e-04
UniRef50_Q22515 Cluster: Putative uncharacterized protein; n=3; ...    47   4e-04
UniRef50_Q0RLI8 Cluster: Putative uncharacterized protein; n=2; ...    47   6e-04
UniRef50_A1R9R9 Cluster: Putative DnaK family protein; n=1; Arth...    47   6e-04
UniRef50_UPI000049A5EA Cluster: hsp70 family protein; n=1; Entam...    46   8e-04
UniRef50_Q8XIE1 Cluster: Cell shape determining protein; n=7; Fi...    46   8e-04
UniRef50_Q08P77 Cluster: Chaperone protein DnaK, putative; n=1; ...    46   8e-04
UniRef50_A0DJC4 Cluster: Chromosome undetermined scaffold_53, wh...    46   8e-04
UniRef50_A3LSS8 Cluster: Stress-seventy subfamily A; n=1; Pichia...    46   8e-04
UniRef50_Q4RRT3 Cluster: Chromosome 16 SCAF15002, whole genome s...    46   0.001
UniRef50_A7QHP2 Cluster: Chromosome chr8 scaffold_99, whole geno...    46   0.001
UniRef50_O46067 Cluster: CG2918-PA; n=3; Diptera|Rep: CG2918-PA ...    46   0.001
UniRef50_A2FVJ6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    46   0.001
UniRef50_Q392G1 Cluster: Molecular chaperone-like; n=20; Proteob...    45   0.002
UniRef50_Q0LE46 Cluster: Molecular chaperone; n=4; Chloroflexi (...    45   0.002
UniRef50_A7AN53 Cluster: DnaK family protein; n=1; Babesia bovis...    45   0.002
UniRef50_A2DQ03 Cluster: DnaK protein; n=1; Trichomonas vaginali...    45   0.002
UniRef50_Q6MMA0 Cluster: Rod shape-determining protein; n=1; Bde...    44   0.003
UniRef50_A6FHN6 Cluster: Heat shock protein 70; n=1; Moritella s...    44   0.003
UniRef50_A3TFM0 Cluster: Rod shape-determining protein; n=1; Jan...    44   0.003
UniRef50_A2YAM2 Cluster: Putative uncharacterized protein; n=3; ...    44   0.003
UniRef50_Q9HHC0 Cluster: Putative glutamate dehydrogenase; n=1; ...    44   0.003
UniRef50_Q6MDN4 Cluster: Putative heat shock protein 70; n=1; Ca...    44   0.004
UniRef50_A1WC34 Cluster: DnaK-related protein; n=3; Comamonadace...    44   0.004
UniRef50_Q9S8V5 Cluster: ATP-binding HSP70 homolog; n=4; cellula...    44   0.004
UniRef50_A2XF45 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q609C9 Cluster: DnaK-related protein; n=4; cellular org...    44   0.005
UniRef50_A7BVW1 Cluster: Heat shock protein, Hsp70 family protei...    43   0.007
UniRef50_A0NUH2 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_Q4P629 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_Q8KEY5 Cluster: Rod shape-determining protein MreB; n=4...    43   0.009
UniRef50_Q5P643 Cluster: DnaK-related protein; n=15; Bacteria|Re...    43   0.009
UniRef50_A0W7A3 Cluster: Heat shock protein, HSP70 family; n=4; ...    43   0.009
UniRef50_Q13YJ4 Cluster: Putative chaperone protein, HscA/DnaK; ...    42   0.013
UniRef50_A4FPH4 Cluster: Molecular chaperone; n=1; Saccharopolys...    42   0.013
UniRef50_A2QXA7 Cluster: Similarity to Neisseria meningitidis Hs...    42   0.013
UniRef50_Q0I7V4 Cluster: DnaK family protein; n=12; Cyanobacteri...    42   0.017
UniRef50_A6VWZ7 Cluster: Heat shock protein 70; n=2; Marinomonas...    42   0.017
UniRef50_Q17291 Cluster: Heat shock protein 70A; n=1; Bursaphele...    42   0.017
UniRef50_Q06YR5 Cluster: Possibile polyglycylated protein 1; n=2...    42   0.017
UniRef50_Q4PG59 Cluster: Putative uncharacterized protein; n=1; ...    42   0.017
UniRef50_O57013 Cluster: Hsp-70 protein; n=2; Grapevine leafroll...    42   0.022
UniRef50_Q609D0 Cluster: DnaK-related protein; n=48; cellular or...    42   0.022
UniRef50_A2DQX2 Cluster: DnaK protein; n=1; Trichomonas vaginali...    42   0.022
UniRef50_A2DMZ9 Cluster: Putative uncharacterized protein; n=5; ...    42   0.022
UniRef50_Q8RH06 Cluster: Putative uncharacterized protein FN0115...    41   0.029
UniRef50_Q894U0 Cluster: Ethanolamine utilization protein eutJ; ...    41   0.029
UniRef50_Q7URC4 Cluster: Probable chaperone protein DnaK; n=2; P...    41   0.029
UniRef50_Q6MB40 Cluster: Putative heat shock protein 70, dnaK; n...    41   0.029
UniRef50_Q4ETY1 Cluster: Putative uncharacterized protein; n=2; ...    41   0.029
UniRef50_A1I8W6 Cluster: Molecular chaperone-like; n=1; Candidat...    41   0.029
UniRef50_A0LQM4 Cluster: Cell shape determining protein, MreB/Mr...    41   0.029
UniRef50_A2F6W8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    41   0.029
UniRef50_Q55Y28 Cluster: Putative uncharacterized protein; n=2; ...    41   0.029
UniRef50_A1CNT3 Cluster: Hsp70 family protein; n=15; Pezizomycot...    41   0.029
UniRef50_Q63ML7 Cluster: Rod shape-determining protein; n=25; Bu...    41   0.038
UniRef50_Q1MP88 Cluster: Actin-like ATPase involved in cell morp...    41   0.038
UniRef50_A0VAV7 Cluster: Molecular chaperone, HSP70 class; n=4; ...    41   0.038
UniRef50_A0PZG5 Cluster: Rod shape-determining protein mreB; n=3...    41   0.038
UniRef50_Q8YXE9 Cluster: DnaK-type molecular chaperone; n=13; Cy...    40   0.050
UniRef50_Q5E4N4 Cluster: Heat shock protein 70; n=7; Proteobacte...    40   0.050
UniRef50_Q5B9Y4 Cluster: Putative uncharacterized protein; n=2; ...    40   0.050
UniRef50_Q2GU23 Cluster: Putative uncharacterized protein; n=1; ...    40   0.050
UniRef50_A7U5U4 Cluster: Hsp70; n=4; Pezizomycotina|Rep: Hsp70 -...    40   0.050
UniRef50_P44474 Cluster: Rod shape-determining protein mreB; n=3...    40   0.050
UniRef50_UPI00004999A1 Cluster: 70 kDa heat shock protein; n=4; ...    40   0.067
UniRef50_Q9KS86 Cluster: DnaK-related protein; n=32; Gammaproteo...    40   0.067
UniRef50_Q7M9F2 Cluster: PUTATIVE ROD SHAPE-DETERMINING PROTEIN;...    40   0.067
UniRef50_Q1YQP4 Cluster: Heat shock protein, Hsp70 family protei...    40   0.067
UniRef50_A4A0F9 Cluster: Probable chaperone protein DnaK; n=1; B...    40   0.067
UniRef50_A2TZ62 Cluster: Chaperone protein dnaK; n=1; Polaribact...    40   0.067
UniRef50_A1G644 Cluster: Heat shock protein 70; n=2; Salinispora...    40   0.067
UniRef50_A2FYV4 Cluster: DnaK protein; n=1; Trichomonas vaginali...    40   0.067
UniRef50_A6SF40 Cluster: Putative uncharacterized protein; n=1; ...    40   0.067
UniRef50_Q0AZY0 Cluster: Molecular chaperone-like protein; n=1; ...    40   0.088
UniRef50_Q02AE3 Cluster: Heat shock protein 70; n=1; Solibacter ...    40   0.088
UniRef50_A6DQF5 Cluster: Putative heat shock protein 70, dnaK; n...    40   0.088
UniRef50_A0FN26 Cluster: DnaK-related protein; n=2; Burkholderia...    40   0.088
UniRef50_Q9TX41 Cluster: 200 kDa wall antigen; n=1; Cryptosporid...    40   0.088
UniRef50_Q7RDM0 Cluster: Putative HSP protein; n=9; Plasmodium|R...    40   0.088
UniRef50_A2FS75 Cluster: DnaK protein; n=1; Trichomonas vaginali...    40   0.088
UniRef50_Q4P3F6 Cluster: Putative uncharacterized protein; n=1; ...    40   0.088
UniRef50_Q8G2E7 Cluster: Heat shock protein, Hsp70 family; n=6; ...    39   0.12 
UniRef50_O51657 Cluster: Rod shape-determining protein; n=4; Bac...    39   0.12 
UniRef50_Q0VMR6 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_Q0SK53 Cluster: Rod shaping protein, MreB; n=1; Rhodoco...    39   0.12 
UniRef50_A6E8E9 Cluster: Probable heat shock protein; n=1; Pedob...    39   0.12 
UniRef50_A6DQF6 Cluster: Molecular chaperone; n=1; Lentisphaera ...    39   0.12 
UniRef50_Q7URC3 Cluster: Probable chaperone protein DnaK; n=1; P...    39   0.15 
UniRef50_Q5CTE6 Cluster: APG-1 like HSP70 domain containing prot...    39   0.15 
UniRef50_A6SIT8 Cluster: Putative uncharacterized protein; n=1; ...    39   0.15 
UniRef50_A1XM67 Cluster: Heat shock protein Hsp70-6; n=1; Blasto...    39   0.15 
UniRef50_Q2JLE2 Cluster: DnaK family protein; n=2; Synechococcus...    38   0.20 
UniRef50_Q7SBZ8 Cluster: Putative uncharacterized protein NCU094...    38   0.20 
UniRef50_A6R3U1 Cluster: Predicted protein; n=1; Ajellomyces cap...    38   0.20 
UniRef50_A2QH62 Cluster: Similarity to dnaK-type molecular chape...    38   0.20 
UniRef50_P36016 Cluster: Heat shock protein 70 homolog LHS1 prec...    38   0.20 
UniRef50_UPI000023CEA8 Cluster: hypothetical protein FG00850.1; ...    38   0.27 
UniRef50_Q7NES6 Cluster: Gll3802 protein; n=1; Gloeobacter viola...    38   0.27 
UniRef50_A3ITC3 Cluster: DnaK family protein; n=1; Cyanothece sp...    38   0.27 
UniRef50_Q4Q5R6 Cluster: Putative uncharacterized protein; n=3; ...    38   0.27 
UniRef50_A7AWJ8 Cluster: Tetratricopeptide repeat domain contain...    38   0.27 
UniRef50_A2FG21 Cluster: Putative uncharacterized protein; n=1; ...    38   0.27 
UniRef50_UPI00005A5FFD Cluster: PREDICTED: similar to heat shock...    38   0.36 
UniRef50_Q11T56 Cluster: Probable heat shock protein; n=1; Cytop...    38   0.36 
UniRef50_A2ET78 Cluster: Putative uncharacterized protein; n=1; ...    38   0.36 
UniRef50_Q89YX8 Cluster: Chaperone protein dnaK; n=1; Bacteroide...    37   0.47 
UniRef50_Q15RJ7 Cluster: Putative heat shock protein 70 family p...    37   0.47 
UniRef50_A1SY38 Cluster: Heat shock protein 70; n=1; Psychromona...    37   0.47 
UniRef50_Q92CP6 Cluster: Lin1125 protein; n=13; Listeria|Rep: Li...    37   0.62 
UniRef50_Q6MI83 Cluster: Molecular chaperone, Hsp70 family; n=1;...    37   0.62 
UniRef50_Q5YZY6 Cluster: Putative uncharacterized protein; n=1; ...    37   0.62 
UniRef50_Q3J7W0 Cluster: Rare lipoprotein A; n=1; Nitrosococcus ...    37   0.62 
UniRef50_Q3XWY0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.62 
UniRef50_Q07UL1 Cluster: Molecular chaperone, HSP70 class; n=4; ...    37   0.62 
UniRef50_A5GV47 Cluster: Molecular chaperone DnaK; n=1; Synechoc...    37   0.62 
UniRef50_A3HFZ5 Cluster: Heat shock protein; n=1; Pseudomonas pu...    37   0.62 
UniRef50_Q5DEW6 Cluster: SJCHGC09345 protein; n=1; Schistosoma j...    37   0.62 
UniRef50_A2FPJ8 Cluster: Heat shock protein SSB-related protein;...    37   0.62 
UniRef50_Q30W77 Cluster: Ethanolamine utilization protein EutJ; ...    36   0.82 
UniRef50_Q7D073 Cluster: AGR_C_1814p; n=7; Alphaproteobacteria|R...    36   0.82 
UniRef50_A6FD17 Cluster: Putative heat shock protein 70 family p...    36   0.82 
UniRef50_A0YV37 Cluster: Heat shock protein 70; n=2; Oscillatori...    36   0.82 
UniRef50_A0LF41 Cluster: DnaK-related protein; n=1; Syntrophobac...    36   0.82 
UniRef50_A5AJL9 Cluster: Putative uncharacterized protein; n=1; ...    36   0.82 
UniRef50_Q4E175 Cluster: Heat shock protein 70 (HSP70), putative...    36   0.82 
UniRef50_Q9KEK9 Cluster: Cell-shape determining protein; n=19; B...    36   1.1  
UniRef50_Q98BE0 Cluster: DnaK-type molecular chaperone; DnaK; n=...    36   1.1  
UniRef50_Q62G55 Cluster: Chaperone protein, putative; n=30; Burk...    36   1.1  
UniRef50_Q2RVY4 Cluster: Ethanolamine utilization protein eutJ; ...    36   1.1  
UniRef50_Q8VQG1 Cluster: MreB5; n=5; Spiroplasma citri|Rep: MreB...    36   1.1  
UniRef50_A5TWE9 Cluster: Rod shape-determining protein; n=3; Fus...    36   1.1  
UniRef50_A7PMW8 Cluster: Chromosome chr14 scaffold_21, whole gen...    36   1.1  
UniRef50_Q7RZ77 Cluster: Putative uncharacterized protein NCU043...    36   1.1  
UniRef50_Q1DPZ3 Cluster: Putative uncharacterized protein; n=1; ...    36   1.1  
UniRef50_UPI00003836FB Cluster: COG0443: Molecular chaperone; n=...    36   1.4  
UniRef50_Q1D8M5 Cluster: Putative uncharacterized protein; n=1; ...    36   1.4  
UniRef50_Q15XT0 Cluster: Putative uncharacterized protein; n=1; ...    36   1.4  
UniRef50_A7DFU0 Cluster: Molecular chaperone, HSP70 class; n=2; ...    36   1.4  
UniRef50_A6R8X4 Cluster: Putative uncharacterized protein; n=1; ...    36   1.4  
UniRef50_A1CFP4 Cluster: Putative uncharacterized protein; n=2; ...    36   1.4  
UniRef50_Q09AQ1 Cluster: Molecular chaperone; n=2; Cystobacterin...    35   1.9  
UniRef50_Q01UV8 Cluster: Molecular chaperone; n=1; Solibacter us...    35   1.9  
UniRef50_A5VGL2 Cluster: Cell shape determining protein MreB/Mrl...    35   1.9  
UniRef50_A4FAH5 Cluster: Putative uncharacterized protein; n=1; ...    35   1.9  
UniRef50_A2FZ97 Cluster: Putative uncharacterized protein; n=1; ...    35   1.9  
UniRef50_A2E5D4 Cluster: DnaK protein; n=3; Trichomonas vaginali...    35   1.9  
UniRef50_A6SR43 Cluster: Putative uncharacterized protein; n=2; ...    35   1.9  
UniRef50_Q2W310 Cluster: Putative uncharacterized protein; n=1; ...    35   2.5  
UniRef50_A4Z1V1 Cluster: Putative chaperone protein; n=2; Bradyr...    35   2.5  
UniRef50_A0XXF0 Cluster: Predicted chaperone; n=3; Alteromonadal...    35   2.5  
UniRef50_Q1VL17 Cluster: Rod shape-determining protein MreB; n=1...    34   3.3  
UniRef50_Q1AVX6 Cluster: Cell division protein FtsA; n=1; Rubrob...    34   3.3  
UniRef50_A5ANY6 Cluster: Putative uncharacterized protein; n=1; ...    34   3.3  
UniRef50_A7APN5 Cluster: Putative uncharacterized protein; n=1; ...    34   3.3  
UniRef50_Q4SWT1 Cluster: Chromosome undetermined SCAF13528, whol...    34   4.4  
UniRef50_Q5LSW4 Cluster: Putative uncharacterized protein; n=1; ...    34   4.4  
UniRef50_A6G8C0 Cluster: Cell division protein FtsA; n=5; Proteo...    34   4.4  
UniRef50_A4AM62 Cluster: Putative uncharacterized protein; n=1; ...    34   4.4  
UniRef50_A0W7X9 Cluster: Actin-like ATPase involved in cell morp...    34   4.4  
UniRef50_A2FPH5 Cluster: Putative uncharacterized protein; n=1; ...    34   4.4  
UniRef50_Q5BFU3 Cluster: Putative uncharacterized protein; n=1; ...    34   4.4  
UniRef50_Q01465 Cluster: Rod shape-determining protein mreB; n=3...    34   4.4  
UniRef50_Q74F76 Cluster: Cell shape-determining protein MreB/Mrl...    33   5.8  
UniRef50_Q5FKX8 Cluster: Cell shape determining protein; n=8; La...    33   5.8  
UniRef50_Q2JG83 Cluster: WD-40 repeat protein; n=3; Frankia|Rep:...    33   5.8  
UniRef50_Q11XW1 Cluster: Putative uncharacterized protein; n=1; ...    33   5.8  
UniRef50_A7HER3 Cluster: DnaK-related protein; n=4; Cystobacteri...    33   5.8  
UniRef50_A6VV34 Cluster: Molecular chaperone; n=4; Gammaproteoba...    33   5.8  
UniRef50_A4SHJ1 Cluster: Molecular chaperone; n=2; Aeromonas|Rep...    33   5.8  
UniRef50_A1S759 Cluster: Putative uncharacterized protein; n=1; ...    33   5.8  
UniRef50_Q6ZLB3 Cluster: Putative uncharacterized protein OJ1014...    33   5.8  
UniRef50_P16466 Cluster: Hemolysin precursor; n=1; Proteus mirab...    33   5.8  
UniRef50_Q8E9K4 Cluster: Type I restriction-modification system,...    33   7.7  
UniRef50_Q5PI65 Cluster: Putative ethanolamine utilization prote...    33   7.7  
UniRef50_Q5P1N5 Cluster: Acetone carboxylase beta subunit; n=20;...    33   7.7  
UniRef50_Q1VQ86 Cluster: Putative uncharacterized protein; n=1; ...    33   7.7  
UniRef50_A7HAM6 Cluster: Molecular chaperone-like protein precur...    33   7.7  
UniRef50_A4M4H3 Cluster: Actin-like ATPase involved in cell morp...    33   7.7  
UniRef50_Q6CXE8 Cluster: Cation-transporting ATPase; n=4; Saccha...    33   7.7  
UniRef50_Q5KHM1 Cluster: Fungal Zn(2)-Cys(6) binuclear cluster d...    33   7.7  
UniRef50_P0A206 Cluster: Ethanolamine utilization protein eutJ; ...    33   7.7  

>UniRef50_Q2VA67 Cluster: Putative heat schock protein 70; n=1;
           Theileria sp. China|Rep: Putative heat schock protein 70
           - Theileria sp. China
          Length = 372

 Score =  163 bits (397), Expect = 3e-39
 Identities = 77/84 (91%), Positives = 81/84 (96%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDKK  GE+NVLIFDLGGGTF
Sbjct: 2   VPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKSGGEKNVLIFDLGGGTF 61

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVK+TAGDTH G
Sbjct: 62  DVSILTIEDGIFEVKATAGDTHLG 85


>UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=239;
           Eukaryota|Rep: Heat shock cognate 71 kDa protein - Homo
           sapiens (Human)
          Length = 646

 Score =  163 bits (396), Expect = 4e-39
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTIEDGIFEVKSTAGDTH G
Sbjct: 206 DVSILTIEDGIFEVKSTAGDTHLG 229



 Score =  151 bits (365), Expect = 2e-35
 Identities = 66/87 (75%), Positives = 78/87 (89%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVS
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 121 SMVLTKMKEIAEAYLGKTVTNAVVTVP 147



 Score =  128 bits (309), Expect = 1e-28
 Identities = 60/64 (93%), Positives = 61/64 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64


>UniRef50_Q9UQC1 Cluster: Heat shock protein 72; n=10; Fungi/Metazoa
           group|Rep: Heat shock protein 72 - Homo sapiens (Human)
          Length = 151

 Score =  161 bits (392), Expect = 1e-38
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 60  VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 119

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 120 DVSILTIDDGIFEVKATAGDTHLG 143



 Score =  104 bits (249), Expect = 3e-21
 Identities = 45/61 (73%), Positives = 53/61 (86%)
 Frame = +2

Query: 332 MKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITF 511
           MKHWPF+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG  V NAVIT 
Sbjct: 1   MKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITV 60

Query: 512 P 514
           P
Sbjct: 61  P 61


>UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931;
           root|Rep: Heat shock 70 kDa protein 1 - Homo sapiens
           (Human)
          Length = 641

 Score =  161 bits (392), Expect = 1e-38
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI+DGIFEVK+TAGDTH G
Sbjct: 206 DVSILTIDDGIFEVKATAGDTHLG 229



 Score =  145 bits (352), Expect = 9e-34
 Identities = 64/87 (73%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+S
Sbjct: 61  LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLG  V NAVIT P
Sbjct: 121 SMVLTKMKEIAEAYLGYPVTNAVITVP 147



 Score =  125 bits (302), Expect = 1e-27
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78); n=736;
           root|Rep: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78) - Homo
           sapiens (Human)
          Length = 654

 Score =  147 bits (355), Expect = 4e-34
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDK+  GE+N+L+FDLGGGTF
Sbjct: 172 VPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKR-EGEKNILVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV +T GDTH G
Sbjct: 231 DVSLLTIDNGVFEVVATNGDTHLG 254



 Score =  110 bits (264), Expect = 4e-23
 Identities = 55/87 (63%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-EDKTFFPEEVS 433
           NP NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V   G + KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLTKMKETAEAYLGK V +AV+T P
Sbjct: 147 AMVLTKMKETAEAYLGKKVTHAVVTVP 173



 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNP 88


>UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome
           shotgun sequence; n=3; Fungi/Metazoa group|Rep:
           Chromosome 3 SCAF9564, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 414

 Score =  144 bits (350), Expect = 2e-33
 Identities = 63/87 (72%), Positives = 77/87 (88%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NPNNT+FDAKRLIGRK +D TVQAD+K WPF+V+ DGGKPKI+V YKGE+K+F+PEE+S
Sbjct: 63  LNPNNTVFDAKRLIGRKLDDPTVQADVKLWPFKVIGDGGKPKIQVEYKGEEKSFYPEEIS 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVL KMKE AEAYLG+ V +AV+T P
Sbjct: 123 SMVLVKMKEIAEAYLGQKVSDAVVTVP 149



 Score =  119 bits (287), Expect = 7e-26
 Identities = 56/62 (90%), Positives = 58/62 (93%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A+  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 4   AEGLAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAL 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/30 (66%), Positives = 23/30 (76%)
 Frame = +1

Query: 481 QNCAECSYHVPAYFNDSQRQATKDAGTISG 570
           Q  ++    VPAYFNDSQRQATKDAG I+G
Sbjct: 139 QKVSDAVVTVPAYFNDSQRQATKDAGVIAG 168


>UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9;
           Trypanosomatidae|Rep: Heat shock cognate HSP70 protein -
           Trypanosoma brucei brucei
          Length = 676

 Score =  144 bits (348), Expect = 3e-33
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG-ERNVLIFDLGGGT 684
           VPAYFNDSQRQATKDAGTI+GL VLRIINEPTAAAIAYGLDK   G ERNVL+FD GGGT
Sbjct: 147 VPAYFNDSQRQATKDAGTIAGLEVLRIINEPTAAAIAYGLDKADEGKERNVLVFDFGGGT 206

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FDVSI+++  G+FEVK+T GDTH G
Sbjct: 207 FDVSIISVSGGVFEVKATNGDTHLG 231



 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 45/85 (52%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +2

Query: 263 NNTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVSSM 439
           N  IFDAKRLIGRKF D+ VQ+DMKHWPF+V   + G   ++V + GE     PE++S+ 
Sbjct: 64  NGVIFDAKRLIGRKFSDSVVQSDMKHWPFKVEEGEKGGAVMRVEHLGEGMLLQPEQISAR 123

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           VL  +K  AE+YLGK V  AV+T P
Sbjct: 124 VLAYLKSCAESYLGKQVAKAVVTVP 148



 Score = 93.1 bits (221), Expect = 7e-18
 Identities = 42/55 (76%), Positives = 49/55 (89%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           A+GIDLGTTYSCVGV+Q+ +VEIIANDQGNRTTPSYVAF + E L+GDAAK+  A
Sbjct: 6   AIGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFVNNEVLVGDAAKSHAA 60


>UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock
           cognate 71 kDa protein (Heat shock 70 kDa protein 8);
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           Heat shock cognate 71 kDa protein (Heat shock 70 kDa
           protein 8) - Canis familiaris
          Length = 393

 Score =  137 bits (332), Expect = 2e-31
 Identities = 67/72 (93%), Positives = 68/72 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 86  VPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF 145

Query: 688 DVSILTIEDGIF 723
           DVSIL IEDGIF
Sbjct: 146 DVSILIIEDGIF 157



 Score =  130 bits (314), Expect = 4e-29
 Identities = 58/87 (66%), Positives = 73/87 (83%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +N    +F+AK LIG +F+DA VQ+DMKHWPF VV+D G+PK++V YKG+ K+F+PEE+S
Sbjct: 1   MNSTIMVFNAKCLIGCRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGKTKSFYPEELS 60

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEAYLGKTV NAV+T P
Sbjct: 61  SMVLTKMKEIAEAYLGKTVTNAVVTVP 87


>UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 599

 Score =  137 bits (331), Expect = 3e-31
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQR+ATKDAG I+GLNV+RIINEPTAAA+AYGL K+     ERN+ IFDLGGG
Sbjct: 122 VPAYFNDSQRKATKDAGAIAGLNVMRIINEPTAAALAYGLQKRANCLEERNIFIFDLGGG 181

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTI++ +F VK+TAGDTH G
Sbjct: 182 TFDVSLLTIKNNVFVVKATAGDTHLG 207



 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 41/80 (51%), Positives = 58/80 (72%), Gaps = 1/80 (1%)
 Frame = +2

Query: 278 DAKRLIGRKFEDATVQADMKHWPFEVVSDGG-KPKIKVAYKGEDKTFFPEEVSSMVLTKM 454
           +AKRLIGRK+ D+ +Q D++ WPF+V++    KP+I V YKGE+K    EE+SSMVL KM
Sbjct: 44  NAKRLIGRKYSDSIIQNDIQLWPFKVLAGSDDKPEIIVKYKGEEKHLCAEEISSMVLKKM 103

Query: 455 KETAEAYLGKTVQNAVITFP 514
           +E AE +L   ++N V+T P
Sbjct: 104 REIAENFLESPIENVVVTVP 123


>UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|Rep:
           Chaperone protein DnaK - Roseiflexus sp. RS-1
          Length = 624

 Score =  134 bits (324), Expect = 2e-30
 Identities = 63/84 (75%), Positives = 72/84 (85%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GL VLRIINEPTAAA+AYGLDKK   +  +L+FDLGGGTF
Sbjct: 142 VPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKK--KDETILVFDLGGGTF 199

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L + DG+ EVK+T GDTH G
Sbjct: 200 DVSVLEVGDGVVEVKATNGDTHLG 223



 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 40/87 (45%), Positives = 57/87 (65%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP+NT +  KR IGR F++ TV+ +M   PF+VV  G +  ++V      K + P+E+S
Sbjct: 60  INPDNTFYSIKRFIGRNFDETTVEREMV--PFKVVK-GPRNDVRVFSPVTGKEYAPQEIS 116

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVL K+K  AEAYLG+ V  AVIT P
Sbjct: 117 AMVLQKLKTDAEAYLGEPVTKAVITVP 143



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 36/65 (55%), Positives = 42/65 (64%), Gaps = 2/65 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP-T 266
           VGIDLGTT S V V + G   +I N +GNRTTPS VAFT + ERL+G  AK Q    P  
Sbjct: 5   VGIDLGTTNSVVAVMEGGDPVVIPNAEGNRTTPSVVAFTKNGERLVGQTAKRQATINPDN 64

Query: 267 TQYSM 281
           T YS+
Sbjct: 65  TFYSI 69


>UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Rep:
           Heat shock protein 70 - Acidobacteria bacterium (strain
           Ellin345)
          Length = 634

 Score =  132 bits (318), Expect = 1e-29
 Identities = 61/84 (72%), Positives = 71/84 (84%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL VLR++NEPTAA++AYGLDKK  G   V ++DLGGGTF
Sbjct: 144 VPAYFNDAQRQATKDAGRIAGLEVLRLVNEPTAASLAYGLDKKRNG--TVAVYDLGGGTF 201

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL + DGIFEV ST GDTH G
Sbjct: 202 DISILKLHDGIFEVMSTNGDTHLG 225



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 32/85 (37%), Positives = 50/85 (58%)
 Frame = +2

Query: 260 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 439
           P   ++  KRL+GR  ED  +Q ++K +PF V  D    ++   + GE +T+ P E+S+ 
Sbjct: 64  PERAVYSIKRLMGRGIED--IQDELKLFPFRVADDLAAGEVIRIHLGE-RTYTPPEISAF 120

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +L ++K+ AE Y G  V  AVIT P
Sbjct: 121 ILRQLKKNAERYFGAPVTKAVITVP 145



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI-GDAAKNQV 251
           MA+   VGIDLGTT S V   +  +  +I  + G    PS VA     ++I G+AA+  +
Sbjct: 1   MAEERVVGIDLGTTNSLVAYMEGDRPVVIPGEDGANLVPSIVALDPAAQIIVGNAARKYL 60

Query: 252 A*TP 263
             TP
Sbjct: 61  IETP 64


>UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial
           precursor; n=291; root|Rep: Stress-70 protein,
           mitochondrial precursor - Homo sapiens (Human)
          Length = 679

 Score =  132 bits (318), Expect = 1e-29
 Identities = 62/84 (73%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK  + ++ + ++DLGGGTF
Sbjct: 193 VPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--SEDKVIAVYDLGGGTF 250

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+ G+FEVKST GDT  G
Sbjct: 251 DISILEIQKGVFEVKSTNGDTFLG 274



 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 41/87 (47%), Positives = 57/87 (65%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           NPNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 167

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMKETAE YLG T +NAVIT P
Sbjct: 168 AFVLMKMKETAENYLGHTAKNAVITVP 194



 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query: 42  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 218
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 219 RLIGDAAKNQVA*TPTTQY 275
           RL+G  AK Q    P   +
Sbjct: 99  RLVGMPAKRQAVTNPNNTF 117


>UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular
           organisms|Rep: Chaperone protein dnaK - Lactobacillus
           johnsonii
          Length = 624

 Score =  131 bits (316), Expect = 2e-29
 Identities = 62/84 (73%), Positives = 72/84 (85%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GLNV RIINEPTA+A+AYGLDK    E+ VL++DLGGGTF
Sbjct: 117 VPAYFNDAQRQATKDAGKIAGLNVQRIINEPTASALAYGLDKDENDEK-VLVYDLGGGTF 175

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL + DG+F+V ST GDTH G
Sbjct: 176 DVSILQLGDGVFQVLSTNGDTHLG 199



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/63 (49%), Positives = 40/63 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPTTQ 272
           +GIDLGTT S V V +  + +II N +GNRTTPS VAF + E  +G+ AK Q    P T 
Sbjct: 5   IGIDLGTTNSAVAVLEGKEPKIITNPEGNRTTPSVVAFKNGEIQVGEVAKRQAITNPNTI 64

Query: 273 YSM 281
            S+
Sbjct: 65  VSI 67



 Score = 40.3 bits (90), Expect = 0.050
 Identities = 17/37 (45%), Positives = 27/37 (72%)
 Frame = +2

Query: 404 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           DK + P+E+S+ +L  +K+ +E YLG+ V +AVIT P
Sbjct: 82  DKEYTPQEISAFILQYIKKFSEDYLGEKVTDAVITVP 118


>UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonospora
           locustae|Rep: Mitochondrial-type HSP70 - Antonospora
           locustae (Nosema locustae)
          Length = 622

 Score =  130 bits (314), Expect = 4e-29
 Identities = 61/84 (72%), Positives = 71/84 (84%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ++GL VLR+INEPTAAA+AYGL +   G   + +FDLGGGTF
Sbjct: 173 VPAYFNDSQRQATKDAGRLAGLKVLRVINEPTAAALAYGLGRTENG--TIAVFDLGGGTF 230

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I+DGIFEVKST G+TH G
Sbjct: 231 DISILEIKDGIFEVKSTNGNTHLG 254



 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 35/87 (40%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 433
           +P  T+F  KRLIGRKFED  +Q  ++  P++ VS   G   IKV+    D+ F P +++
Sbjct: 92  DPGATVFGTKRLIGRKFEDPEIQKYIQKLPYKTVSHVNGDAWIKVS----DRMFSPSQIA 147

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + +LT++K  AE +L   V  +VIT P
Sbjct: 148 AYILTELKRCAEDFLKSPVSKSVITVP 174



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = +3

Query: 72  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 212
           ++ K+  +GIDLGTT SCV V +    +II N  G RTTPS V F D
Sbjct: 34  EVEKSTIIGIDLGTTNSCVSVIKDRYPKIIRNRTGKRTTPSTVTFGD 80


>UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole genome
           shotgun sequence; n=3; core eudicotyledons|Rep:
           Chromosome chr18 scaffold_24, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 667

 Score =  130 bits (313), Expect = 5e-29
 Identities = 60/84 (71%), Positives = 70/84 (83%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG +KK      +L+FDLGGGTF
Sbjct: 175 VPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKK--NNETILVFDLGGGTF 232

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L + DG+FEV ST+GDTH G
Sbjct: 233 DVSVLEVGDGVFEVLSTSGDTHLG 256



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 29/70 (41%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +3

Query: 69  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKN 245
           + +     VGIDLGTT S V   + GK  I+ N +G RTTPS VA+T + + L+G  AK 
Sbjct: 53  FHVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKNGDMLVGQIAKR 112

Query: 246 QVA*TPTTQY 275
           Q    P   +
Sbjct: 113 QAVVNPENTF 122



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 28/87 (32%), Positives = 39/87 (44%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           VNP NT F  KR IGRK ++                  G+   +V+YK         E+S
Sbjct: 116 VNPENTFFSVKRFIGRKMDEV-----------------GEEAKQVSYK---------EIS 149

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL K+ + A  +L   V  AV+T P
Sbjct: 150 AQVLRKLADDASKFLNDKVTKAVVTVP 176


>UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular
           organisms|Rep: Chaperone protein dnaK1 - Synechocystis
           sp. (strain PCC 6803)
          Length = 692

 Score =  130 bits (313), Expect = 5e-29
 Identities = 61/84 (72%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF D+QRQATKDAGTI+GL VLRIINEPTAAA+AYGLDK+ T E  +L+FDLGGGTF
Sbjct: 140 VPAYFTDAQRQATKDAGTIAGLEVLRIINEPTAAALAYGLDKQET-EELILVFDLGGGTF 198

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L + +G+FEV ST+G+ H G
Sbjct: 199 DVSLLQLGNGVFEVLSTSGNNHLG 222



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 34/86 (39%), Positives = 54/86 (62%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N  NT++  KR IGR+++D TV+ +    P+  V  G    + V+ +G+  T  P+E+S+
Sbjct: 61  NAENTVYSIKRFIGRRWDD-TVE-ERSRVPYNCVK-GRDDTVSVSIRGQSYT--PQEISA 115

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           M+L K+K  +EA+LG+ V  AVIT P
Sbjct: 116 MILQKLKADSEAFLGEPVTQAVITVP 141



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 33/65 (50%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ-VA*TPT 266
           +GIDLGTT SC  V + GK  +I N +G RTTPS V FT  ++RL+G  AK Q V     
Sbjct: 5   IGIDLGTTNSCASVLEGGKPIVITNTEGGRTTPSIVGFTKGSQRLVGQLAKRQSVTNAEN 64

Query: 267 TQYSM 281
           T YS+
Sbjct: 65  TVYSI 69


>UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial
           precursor; n=18; Ascomycota|Rep: Heat shock protein
           SSQ1, mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 657

 Score =  129 bits (312), Expect = 6e-29
 Identities = 58/84 (69%), Positives = 72/84 (85%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ++GLNVLR+INEPTAAA+++G+D K      + ++DLGGGTF
Sbjct: 182 VPAYFNDSQRQATKDAGKLAGLNVLRVINEPTAAALSFGIDDK-RNNGLIAVYDLGGGTF 240

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL IEDG+FEV++T GDTH G
Sbjct: 241 DISILDIEDGVFEVRATNGDTHLG 264



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 33/87 (37%), Positives = 49/87 (56%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +N  NT F  KRLIGR F D  VQ DM   P+++V      +  ++         P +++
Sbjct: 98  INSENTFFATKRLIGRAFNDKEVQRDMAVMPYKIVKCESNGQAYLS-TSNGLIQSPSQIA 156

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           S++L  +K+T+E YLG+ V  AVIT P
Sbjct: 157 SILLKYLKQTSEEYLGEKVNLAVITVP 183



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 22/42 (52%), Positives = 25/42 (59%), Gaps = 4/42 (9%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGK----VEIIANDQGNRTTPSYVAF 206
           +GIDLGTT S V   +         II ND+G RTTPS VAF
Sbjct: 31  IGIDLGTTNSAVAYIRDSNDKKSATIIENDEGQRTTPSIVAF 72


>UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular
           organisms|Rep: Chaperone protein dnaK1 - Streptomyces
           avermitilis
          Length = 622

 Score =  129 bits (312), Expect = 6e-29
 Identities = 60/84 (71%), Positives = 72/84 (85%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDS+RQATK+AG I+GLNVLRI+NEPTAAA+AYGLDK    ++ +L+FDLGGGTF
Sbjct: 118 VPAYFNDSERQATKEAGEIAGLNVLRIVNEPTAAALAYGLDK---DDQTILVFDLGGGTF 174

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L I DG+ EVK+T GD H G
Sbjct: 175 DVSLLEIGDGVVEVKATNGDNHLG 198



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 1/56 (1%)
 Frame = +3

Query: 84  APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 248
           A AVGIDLGTT S V V + G+  +I N +G RTTPS VAF  + E L+G+ AK Q
Sbjct: 2   ARAVGIDLGTTNSVVSVLEGGEPTVITNAEGARTTPSVVAFAKNGEVLVGEVAKRQ 57



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = +2

Query: 401 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           + K F P+++S+ +L K+K  AEAYLG+ V +AVIT P
Sbjct: 82  DGKDFNPQQMSAFILQKLKRDAEAYLGEKVTDAVITVP 119


>UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2;
           Ostreococcus|Rep: Heat Shock Protein 70, cytosolic -
           Ostreococcus lucimarinus CCE9901
          Length = 711

 Score =  129 bits (311), Expect = 8e-29
 Identities = 63/90 (70%), Positives = 77/90 (85%), Gaps = 6/90 (6%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--GTGE--RN--VLIFD 669
           VPAYFND+QR+ TKDAG I+GL+VLRIINEPTAAA+AYGLD++    GE  +N  +L+FD
Sbjct: 310 VPAYFNDAQRRQTKDAGAIAGLDVLRIINEPTAAALAYGLDRREGENGEVIKNQCILVFD 369

Query: 670 LGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           LGGGTFDVS+L ++DG+FEV STAGDTH G
Sbjct: 370 LGGGTFDVSLLNLQDGVFEVLSTAGDTHLG 399



 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 41/88 (46%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEV 430
           +NP NT+F+ KR+IGR++ +   + ++   PF+V   +GGKP + V   GE K F PE++
Sbjct: 226 INPKNTLFNIKRIIGRQYSECAHELELM--PFDVKEGEGGKPIVSVDVNGEKKDFAPEQI 283

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           S+MVL KMK TAEA LG  +  AV+T P
Sbjct: 284 SAMVLQKMKATAEAQLGVPITKAVVTVP 311



 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 34/57 (59%), Positives = 46/57 (80%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCV V+++G+  ++ N +G+RTTPS+VAFT+  RL+GDAAK Q A  P
Sbjct: 172 IGIDLGTTYSCVSVWRNGEAHVLTNAEGDRTTPSWVAFTEQGRLVGDAAKRQAAINP 228


>UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular
           organisms|Rep: Chaperone protein dnaK - Brucella
           melitensis
          Length = 637

 Score =  128 bits (309), Expect = 1e-28
 Identities = 61/84 (72%), Positives = 71/84 (84%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL VLRIINEPTAAA+AYGLDK  +  + + ++DLGGGTF
Sbjct: 142 VPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDK--SEGKTIAVYDLGGGTF 199

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L I DG+FEVKST GDT  G
Sbjct: 200 DVSVLEIGDGVFEVKSTNGDTFLG 223



 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 40/87 (45%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           NP  T+F  KRLIGR+++D  V  D    P+++V  D G   ++V      K + P ++S
Sbjct: 61  NPEGTLFAVKRLIGRRYDDPMVTKDKDLVPYKIVKGDNGDAWVEV----HGKKYSPSQIS 116

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L KMKETAE+YLG+TV  AVIT P
Sbjct: 117 AMILQKMKETAESYLGETVTQAVITVP 143



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/61 (50%), Positives = 37/61 (60%), Gaps = 1/61 (1%)
 Frame = +3

Query: 84  APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVA*T 260
           A  +GID+GTT SCV V      ++I N +G RTTPS +AFTD  ERL G  AK Q    
Sbjct: 2   AKVIGIDMGTTNSCVAVMDGKNAKVIENAEGARTTPSIIAFTDGDERLAGQPAKRQAVTN 61

Query: 261 P 263
           P
Sbjct: 62  P 62


>UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellular
           organisms|Rep: Chaperone protein dnaK3 - Synechocystis
           sp. (strain PCC 6803)
          Length = 771

 Score =  128 bits (308), Expect = 2e-28
 Identities = 60/84 (71%), Positives = 72/84 (85%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQAT+DAG I+GL VLRIINEPTAA++AYGLD+     + +L+FDLGGGTF
Sbjct: 142 VPAYFNDSQRQATRDAGKIAGLEVLRIINEPTAASLAYGLDQGRI--QKILVFDLGGGTF 199

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L + DGIFEVK+T+GDT  G
Sbjct: 200 DVSVLEVGDGIFEVKATSGDTQLG 223



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 35/87 (40%), Positives = 50/87 (57%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT +  KR +GR++ D T ++  K   + +  D  +  IKV      K F PEE+S
Sbjct: 60  LNPQNTFYGVKRFMGRRYTDLTPES--KRVAYTIRRDD-RDNIKVRCPRLKKDFAPEEIS 116

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L K+ E A  YLG+ V  AVIT P
Sbjct: 117 AMILRKLAEEASRYLGEKVTGAVITVP 143



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TPTT 269
           VGIDLGTT S V V + GK  +IAN +G RTTPS V F  + E ++G   + Q    P  
Sbjct: 5   VGIDLGTTNSVVAVMEGGKPIVIANAEGMRTTPSVVGFNKEGELVVGQMGRRQAVLNPQN 64

Query: 270 QY 275
            +
Sbjct: 65  TF 66


>UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n=2;
           Trichomonas vaginalis|Rep: Heat shock cognate protein,
           putative - Trichomonas vaginalis G3
          Length = 622

 Score =  127 bits (307), Expect = 3e-28
 Identities = 55/84 (65%), Positives = 70/84 (83%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QR++T DAG I GL + RIINEPTAA++AYGLD+K     N+L++DLGGGTF
Sbjct: 158 VPAYFNDNQRKSTFDAGKIIGLKITRIINEPTAASLAYGLDRKNQDSVNILVYDLGGGTF 217

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+S+LT+ED  FEV +T+GDTH G
Sbjct: 218 DISLLTVEDSFFEVLATSGDTHLG 241



 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 36/85 (42%), Positives = 54/85 (63%)
 Frame = +2

Query: 260 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 439
           P NTI+  KRLIGR+F D  VQ ++ H  ++V+     P +++   G  + + PEE+SSM
Sbjct: 75  PKNTIYAIKRLIGRRFSDPEVQNEIPHLGYKVIDKNNHPYVEINNNGVIEHYSPEEISSM 134

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +L KMK  AE+YLG  +  +V+T P
Sbjct: 135 ILYKMKSVAESYLGYQINESVVTVP 159



 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 32/53 (60%), Positives = 42/53 (79%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           K P +GIDLGTT+SCVGVF +GKV+II N+ GNR TPS V   + ++++GDAA
Sbjct: 15  KHPIIGIDLGTTFSCVGVFMNGKVDIIPNEVGNRITPSVVYIGNGKKIVGDAA 67


>UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular
           organisms|Rep: Chaperone protein dnaK - Chlamydophila
           caviae
          Length = 664

 Score =  126 bits (304), Expect = 6e-28
 Identities = 59/84 (70%), Positives = 70/84 (83%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQR +TKDAG I+GL+V RII EPTAAA+AYG+DK   G++ + +FDLGGGTF
Sbjct: 145 VPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDK--AGDKKIAVFDLGGGTF 202

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I DG+FEV ST GDTH G
Sbjct: 203 DISILEIGDGVFEVLSTNGDTHLG 226



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 38/86 (44%), Positives = 52/86 (60%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP  T+   KR IGRK  +  V++++K  P++V S        V +  + K + PEE+ +
Sbjct: 66  NPEKTLASTKRFIGRKHSE--VESEIKTVPYKVASGSNGD---VVFLVDGKQYTPEEIGA 120

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            VL KMKETAEAYLG+ V  AVIT P
Sbjct: 121 QVLIKMKETAEAYLGEPVTEAVITVP 146



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 29/57 (50%), Positives = 37/57 (64%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +GIDLGTT SCV V + G+ ++I + +G RTTPS VAF   E L+G  AK Q    P
Sbjct: 11  IGIDLGTTNSCVSVMEGGQAKVITSSEGTRTTPSIVAFKGNETLVGIPAKRQAVTNP 67


>UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock
           protein 2; n=1; Pan troglodytes|Rep: PREDICTED: similar
           to heat shock protein 2 - Pan troglodytes
          Length = 640

 Score =  126 bits (303), Expect = 8e-28
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 258 TPT 266
            PT
Sbjct: 63  NPT 65



 Score =  118 bits (285), Expect = 1e-25
 Identities = 70/169 (41%), Positives = 84/169 (49%), Gaps = 2/169 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK K + +G  +        
Sbjct: 62  MNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKCKXSTRGRPRPSSQRRYP 121

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA--*TFSESSMNXXX 607
                + + + +   G             S T   +P + Q PS       S +S     
Sbjct: 122 PWSSRRXRRSRKPTWGARCTARSXRSRPISTTRSARPPRTQAPSRGSMCCASSTSPRRRP 181

Query: 608 XXXXXXXXXXXXENEMYLSLTSAAVPSTCPSLPSRMVSSR*NPPPATPT 754
                             SLT A   STCPS PSRM SSR +P PATPT
Sbjct: 182 SPTAWTRRAARAARRTCSSLTWAVALSTCPSXPSRMASSRXSPRPATPT 230


>UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock
           protein protein; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 502

 Score =  125 bits (302), Expect = 1e-27
 Identities = 57/86 (66%), Positives = 69/86 (80%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTIFDAKRLIGR+F D  V++ MKHWPF V++  GKP ++V + GE KT  PEEVSS
Sbjct: 33  NPKNTIFDAKRLIGRQFNDEVVRSGMKHWPFTVINTDGKPMLQVEHIGETKTLSPEEVSS 92

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVLTK+KETAEAYLG+ + +AVIT P
Sbjct: 93  MVLTKLKETAEAYLGEKITDAVITVP 118



 Score = 44.4 bits (100), Expect(2) = 7e-07
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = +1

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L IEDGIFEV +TAGD HFG
Sbjct: 142 DVSLLVIEDGIFEVLTTAGDAHFG 165



 Score = 31.9 bits (69), Expect(2) = 7e-07
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 3/33 (9%)
 Frame = +1

Query: 508 VPAYFNDSQRQATK-DAGTI--SGLNVLRIINE 597
           VP YFND+QRQATK D G +  S L+V  ++ E
Sbjct: 117 VPTYFNDAQRQATKEDQGEVRRSELDVSLLVIE 149


>UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella
           natans|Rep: Chaperone HSP70 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 610

 Score =  125 bits (302), Expect = 1e-27
 Identities = 61/86 (70%), Positives = 71/86 (82%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLD--KKGTGERNVLIFDLGGG 681
           VPAYFND QR ATKDAG ++ L V RI+NEPTAA IAYG+D  KK + ER+VLIFDLGGG
Sbjct: 128 VPAYFNDGQRIATKDAGALAELKVNRIVNEPTAACIAYGMDRTKKQSRERSVLIFDLGGG 187

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVSIL I+ G+FEVK+T G+TH G
Sbjct: 188 TFDVSILCIDGGVFEVKATHGNTHLG 213



 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 39/88 (44%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPK--IKVAYKGEDKTFFPEEV 430
           +P+  ++D+KR++G+K+ D T+Q DMK WPF+V+  G K    I V  KGE + F PE++
Sbjct: 43  HPSQVVYDSKRMLGKKYNDETIQDDMKTWPFKVL-QGPKESILISVQIKGETREFSPEQI 101

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SS+VL KM+E  E +  K + + VIT P
Sbjct: 102 SSIVLRKMREIGENFTLKPINDVVITVP 129



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 25/40 (62%), Positives = 32/40 (80%)
 Frame = +3

Query: 147 KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           KV+II+N+ GNRTT S VAFTD ++L+GDAAKNQ    P+
Sbjct: 6   KVQIISNEAGNRTTASVVAFTDDDKLVGDAAKNQAIFHPS 45


>UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 70;
           n=11; Entamoeba histolytica|Rep: Mitochondrial-type heat
           shock protein 70 - Entamoeba histolytica
          Length = 598

 Score =  124 bits (300), Expect = 2e-27
 Identities = 57/84 (67%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGTF 687
           PAYFND+QRQATKDAGT++GL V RIINEPTAAA+AYG+D +   E +N+ ++DLGGGTF
Sbjct: 145 PAYFNDAQRQATKDAGTLAGLKVKRIINEPTAAALAYGIDTRKENEGKNIAVYDLGGGTF 204

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL I  GIF+VK+T GDT  G
Sbjct: 205 DISILNINKGIFQVKATNGDTMLG 228



 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 34/67 (50%), Positives = 43/67 (64%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A++  +GIDLGTT SC+ VF      I+ N +G RTTPS V+FT T  L+G+AAK   A 
Sbjct: 7   ARSTCIGIDLGTTNSCMCVFDKTTPRILENAEGKRTTPSCVSFTPTGILVGEAAKRMEAL 66

Query: 258 TPTTQYS 278
            PTT  S
Sbjct: 67  HPTTTVS 73



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 32/87 (36%), Positives = 51/87 (58%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           ++P  T+   KR+IG ++++   Q      P+++V +G   +  +   G  KT+ P E+S
Sbjct: 66  LHPTTTVSGVKRMIGCQYKNVEQQRK----PYKIV-EGRNGEGWIYING--KTYSPSEIS 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           S +L K+K+ AEA LGK V  AVIT P
Sbjct: 119 SFILKKLKKDAEAKLGKRVDEAVITCP 145


>UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38;
           Bacteria|Rep: Chaperone protein dnaK - Ureaplasma parvum
           (Ureaplasma urealyticum biotype 1)
          Length = 603

 Score =  124 bits (298), Expect = 3e-27
 Identities = 58/84 (69%), Positives = 71/84 (84%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+D+QRQATK+AG I+GL+V RIINEPTAAA+AYG+DK    E+ +L+FDLGGGTF
Sbjct: 118 VPAYFDDAQRQATKNAGIIAGLSVERIINEPTAAALAYGIDKLDK-EQKILVFDLGGGTF 176

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L + DG FEV ST+GD H G
Sbjct: 177 DVSVLDMADGTFEVLSTSGDNHLG 200



 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 32/65 (49%), Positives = 41/65 (63%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAK   +GIDLGTT SCV V ++ K  ++ N +G RT PS V+F   E L+GDAAK +  
Sbjct: 1   MAKEIILGIDLGTTNSCVAVIENKKPIVLENPEGKRTVPSVVSFNGDEVLVGDAAKRKQI 60

Query: 255 *TPTT 269
             P T
Sbjct: 61  TNPNT 65



 Score = 39.9 bits (89), Expect = 0.067
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 365 GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           G K K+ V     +K + PEE+S+ +LT +KE AE  +G  V  AVIT P
Sbjct: 74  GTKEKVTVL----NKDYTPEEISAKILTYIKEYAEKKIGAKVNKAVITVP 119


>UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep:
           GLP_623_6850_8883 - Giardia lamblia ATCC 50803
          Length = 677

 Score =  123 bits (296), Expect = 6e-27
 Identities = 58/88 (65%), Positives = 76/88 (86%), Gaps = 4/88 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGE-RNVLIFDLG 675
           VPAYF+DSQR ATKDAG I+GL+V+RIINEPT+++IAYGLDKK    +G+ +N+L+FD G
Sbjct: 176 VPAYFSDSQRSATKDAGRIAGLDVVRIINEPTSSSIAYGLDKKTQETSGKAKNILVFDCG 235

Query: 676 GGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GGT DVSIL+++ G+FEV +TAG+TH G
Sbjct: 236 GGTHDVSILSVDSGVFEVLATAGNTHLG 263



 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 45/92 (48%), Positives = 64/92 (69%), Gaps = 5/92 (5%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-----EDKTFF 418
           ++P NTIFD KRLIGRKF+D  VQ DMK  P++V++  G+P ++++        ++K   
Sbjct: 86  ISPENTIFDVKRLIGRKFDDPEVQKDMKLLPYKVINKDGRPFVQLSGTNLPKELQNKIMS 145

Query: 419 PEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           PEE+S+MVLTKMK  AE YLG+ +  AV+T P
Sbjct: 146 PEEISAMVLTKMKTIAEDYLGEKITKAVVTVP 177



 Score = 79.4 bits (187), Expect = 9e-14
 Identities = 39/58 (67%), Positives = 45/58 (77%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCV V + G+VEII N+ G R TPSYVAFT D ERL+GDAAKN    +P
Sbjct: 31  IGIDLGTTYSCVAVSRAGQVEIIPNELGARVTPSYVAFTADGERLVGDAAKNYAPISP 88


>UniRef50_P02826 Cluster: Heat shock 70 kDa protein cognate 1; n=2;
           melanogaster subgroup|Rep: Heat shock 70 kDa protein
           cognate 1 - Drosophila simulans (Fruit fly)
          Length = 214

 Score =  122 bits (293), Expect = 1e-26
 Identities = 57/63 (90%), Positives = 59/63 (93%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  MNP 63



 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 33/44 (75%), Positives = 41/44 (93%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIK 385
           +NPNNTIFDAKRLIGR+F+DATVQ+DMKHWPFE  ++ GKP+I+
Sbjct: 61  MNPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEAFAENGKPRIR 104



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 23/27 (85%), Positives = 25/27 (92%)
 Frame = +1

Query: 679 GTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GTFDVS+LTIEDG FEVK+TAGDTH G
Sbjct: 105 GTFDVSVLTIEDG-FEVKATAGDTHLG 130


>UniRef50_UPI000058655A Cluster: PREDICTED: similar to heat shock
           protein protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 684

 Score =  121 bits (292), Expect = 2e-26
 Identities = 56/86 (65%), Positives = 66/86 (76%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTIFDAKRLIGR+F D  VQ+ MKHWPF V++  GKP ++V Y G   T  PEEVSS
Sbjct: 64  NPKNTIFDAKRLIGRQFNDEVVQSGMKHWPFTVINTDGKPMLQVEYIGVTGTLSPEEVSS 123

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVLTK+KETAEAY+G+ V + VIT P
Sbjct: 124 MVLTKLKETAEAYIGEKVTDTVITVP 149



 Score = 90.2 bits (214), Expect = 5e-17
 Identities = 42/61 (68%), Positives = 49/61 (80%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           K+P +GIDLGT+ SCVGVFQ+G VEII ND GNRTTPS VAFTD E LIG+ A NQ++  
Sbjct: 5   KSPVIGIDLGTSCSCVGVFQNGTVEIIPNDYGNRTTPSCVAFTDREILIGEEANNQMSKN 64

Query: 261 P 263
           P
Sbjct: 65  P 65



 Score = 37.1 bits (82), Expect = 0.47
 Identities = 15/19 (78%), Positives = 17/19 (89%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTI 564
           VP YFND+QRQATK+AG I
Sbjct: 148 VPTYFNDAQRQATKEAGVI 166


>UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 603

 Score =  120 bits (290), Expect = 3e-26
 Identities = 54/84 (64%), Positives = 72/84 (85%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQR++TK+AG I+G +V+RIINEPTAAAIAYG ++    + NVL+FDLGGGTF
Sbjct: 143 VPAYFNDSQRESTKNAGKIAGFDVMRIINEPTAAAIAYGFEQNIKEKSNVLVFDLGGGTF 202

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV++L+I++G ++V +T GDTH G
Sbjct: 203 DVTLLSIDNGEYKVIATDGDTHLG 226



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 36/89 (40%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query: 254 VNPNNTI-FDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEE 427
           +N   TI FD KRLIGRK+ D  +Q D+K+  + +  +G  +P I+V Y      F PE+
Sbjct: 56  INCTGTIVFDVKRLIGRKYNDPELQKDLKYITYSIKDNGKNEPIIEVPYMSVLSAFRPED 115

Query: 428 VSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           +S+M+L + KE A   +G+ V+ A+IT P
Sbjct: 116 ISAMLLRRFKEIASDAMGRDVKKAIITVP 144



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 2/53 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHG--KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 245
           +GIDLGTT+SC+ V++    +VEII N QG  TTPS VAFTD +RLIG+ A N
Sbjct: 5   IGIDLGTTFSCMAVWKESSKRVEIITNRQGKETTPSVVAFTDKQRLIGEEAIN 57


>UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter sp.
           BAL39|Rep: Heat shock protein 70 - Pedobacter sp. BAL39
          Length = 617

 Score =  120 bits (290), Expect = 3e-26
 Identities = 54/84 (64%), Positives = 70/84 (83%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQAT+DAG ++GL+VLRI+NEPTAA++AYG+      ++ + ++DLGGGTF
Sbjct: 157 VPAYFNDSQRQATRDAGKLAGLDVLRIVNEPTAASLAYGIGLDPNKQQTIAVYDLGGGTF 216

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL I++GIFEV ST G+T  G
Sbjct: 217 DVSILAIQNGIFEVLSTNGNTFLG 240



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 31/86 (36%), Positives = 48/86 (55%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           +P NTIF  KRL+GR ++D     D   + ++++ D     +K+  K  DK + P E+S+
Sbjct: 77  DPANTIFSVKRLLGRSYKDLAAHQDT--FSYKIIDDENDTLVKI--KAGDKFYTPIELSA 132

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            +L ++K  AE  L   V  AVIT P
Sbjct: 133 EILKELKGRAEHALKTPVNRAVITVP 158



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 2/52 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQG-NRTTPSYVAF-TDTERLIGDAAK 242
           VGIDLGTT S V      K+  + ND G     PS V F    + L+G+ AK
Sbjct: 20  VGIDLGTTNSLVAFINPDKLPQVINDTGKGLLVPSVVHFNAHGDTLVGNEAK 71


>UniRef50_A0DHP4 Cluster: Chromosome undetermined scaffold_50, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_50,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 598

 Score =  120 bits (290), Expect = 3e-26
 Identities = 57/84 (67%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFN++QRQATKDAG I+GLNV+RI+NEPTAAAIAYG  K+   E N++IFDLGGGT+
Sbjct: 165 VPAYFNNAQRQATKDAGAIAGLNVVRILNEPTAAAIAYGFSKRKLKE-NLVIFDLGGGTY 223

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSI++I+DG  +V +T+G T+FG
Sbjct: 224 DVSIVSIDDGDIQVIATSGITNFG 247



 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 47/89 (52%), Positives = 62/89 (69%), Gaps = 2/89 (2%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVA-YKG-EDKTFFPEE 427
           +NP+ T+++ KRL+GRKF D +VQ D K  P+E+V    KP+I V   KG   K F PEE
Sbjct: 78  INPSRTLYNIKRLMGRKFADPSVQNDRKFMPYEIVELDDKPQIMVQNIKGFSSKMFAPEE 137

Query: 428 VSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           +S+MVL KMKE +E YL + V+NAVIT P
Sbjct: 138 ISAMVLMKMKEISETYLKREVENAVITVP 166



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 36/66 (54%), Positives = 46/66 (69%), Gaps = 1/66 (1%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           P +GIDLGT  SCVG+F++G VEII N++G R TPS VAFTD   +IG  A NQ    P+
Sbjct: 22  PIIGIDLGTKNSCVGIFRNGNVEIIPNEEGKRKTPSVVAFTDKGLIIGKEANNQAIINPS 81

Query: 267 -TQYSM 281
            T Y++
Sbjct: 82  RTLYNI 87


>UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum
           ferrooxidans|Rep: HscA chaperone - Leptospirillum
           ferrooxidans
          Length = 588

 Score =  120 bits (289), Expect = 4e-26
 Identities = 57/94 (60%), Positives = 73/94 (77%), Gaps = 1/94 (1%)
 Frame = +1

Query: 481 QNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV- 657
           Q   +    VPAYFND+QRQATKDAG ++GLNVLRI+NEPT+AA+AYG    G G+  + 
Sbjct: 113 QTVTDAVITVPAYFNDAQRQATKDAGEMAGLNVLRILNEPTSAALAYGF---GAGKDGLY 169

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            ++DLGGGTFD S+L+I  G+FEVK+T+GDTH G
Sbjct: 170 AVYDLGGGTFDFSLLSIRRGVFEVKATSGDTHLG 203



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/81 (33%), Positives = 46/81 (56%)
 Frame = +2

Query: 272 IFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTK 451
           ++ AKRL+GR F D   +     +P E V   G P I   ++   +     ++ +M+L++
Sbjct: 47  VYSAKRLMGRSFSDVEQEIGQLAYPVENVD--GLPLIPDPFR--KRHLSAPQIGAMILSE 102

Query: 452 MKETAEAYLGKTVQNAVITFP 514
           +++ AE  LG+TV +AVIT P
Sbjct: 103 LRKRAEVALGQTVTDAVITVP 123


>UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular
           organisms|Rep: Chaperone protein dnaK - Bordetella
           bronchiseptica (Alcaligenes bronchisepticus)
          Length = 641

 Score =  120 bits (289), Expect = 4e-26
 Identities = 61/97 (62%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = +1

Query: 481 QNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL 660
           +   E    VPAYFNDSQRQATKDAG I+GL V RIINEPTAAA+A+GLDK   G+R ++
Sbjct: 133 EEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKTEKGDRKIV 192

Query: 661 IFDLGGGTFDVSILTIED----GIFEVKSTAGDTHFG 759
           ++DLGGGTFDVSI+ I D      FEV ST GDT  G
Sbjct: 193 VYDLGGGTFDVSIIEIADVDGEMQFEVLSTNGDTFLG 229



 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           NP NT++  KRLIGRKF++  VQ D+   P+ +V +D G   ++V      K   P +VS
Sbjct: 61  NPKNTLYAVKRLIGRKFDEKAVQKDIDLMPYSIVKADNGDAWVEV----RGKKLAPPQVS 116

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMK+TAE YLG+ V  AVIT P
Sbjct: 117 AEVLRKMKKTAEDYLGEEVTEAVITVP 143



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 34/65 (52%), Positives = 42/65 (64%), Gaps = 2/65 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*TP-T 266
           +GIDLGTT SCV V   G+V+II N +G RTTPS VA+ D  E L+G  AK Q    P  
Sbjct: 5   IGIDLGTTNSCVAVLDGGQVKIIENAEGARTTPSIVAYMDDGETLVGAPAKRQAVTNPKN 64

Query: 267 TQYSM 281
           T Y++
Sbjct: 65  TLYAV 69


>UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3;
           Planctomycetaceae|Rep: Chaperone protein dnaK -
           Rhodopirellula baltica
          Length = 645

 Score =  120 bits (288), Expect = 5e-26
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 8/92 (8%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL V RIINEPTAAA+AYGLDKK   + ++++FDLGGGTF
Sbjct: 143 VPAYFNDAQRQATKDAGQIAGLEVARIINEPTAAALAYGLDKK--KDESIIVFDLGGGTF 200

Query: 688 DVSILTIEDG--------IFEVKSTAGDTHFG 759
           DVS+L + D         +F+V ST+GDTH G
Sbjct: 201 DVSVLEVADSGDEEQESRVFQVVSTSGDTHLG 232



 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 35/86 (40%), Positives = 52/86 (60%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP  T++ AKR +GR+  +  VQ++ K  P+ +    G P   V  +  D  + P+E+S+
Sbjct: 64  NPKRTVYSAKRFMGRRHNE--VQSEEKMVPYGIT---GGPGDYVKIQVGDSEYTPQEISA 118

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            VL K+KE+AE+YLG  V  AVIT P
Sbjct: 119 KVLRKLKESAESYLGHKVNKAVITVP 144



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVA*TP-T 266
           +GIDLGTT S V + +  + ++I N +GNR TPS VAFTD  E ++G+ A+ Q    P  
Sbjct: 8   IGIDLGTTNSVVAIMEGSEPKVIPNPEGNRLTPSVVAFTDKQETIVGEPARRQAVTNPKR 67

Query: 267 TQYS 278
           T YS
Sbjct: 68  TVYS 71


>UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n=2;
           Cystobacterineae|Rep: Heat shock protein 70 family
           protein - Myxococcus xanthus (strain DK 1622)
          Length = 535

 Score =  116 bits (278), Expect = 8e-25
 Identities = 55/84 (65%), Positives = 68/84 (80%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+G+ VLRI+NEPTAAA+AYG  +     + V+++DLGGGTF
Sbjct: 144 VPAYFNDNQRQATKDAGRIAGMEVLRILNEPTAAALAYGFGR--DVNQRVVVYDLGGGTF 201

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL I   +FEV +TAGDT+ G
Sbjct: 202 DVSILEIGKDVFEVLATAGDTYLG 225



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 30/86 (34%), Positives = 50/86 (58%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP  T++ AKRLIGR +    V+      P+ +V +G    +++A    + ++   E+S+
Sbjct: 63  NPEQTVYSAKRLIGRYYFSDEVKKAQAVMPYRIV-EGDNNSVRIAMN--EHSYSLPEISA 119

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           +VL ++K  AE YLG+ V  AV+T P
Sbjct: 120 LVLKELKAVAETYLGQEVTKAVVTVP 145



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 2/70 (2%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQV 251
           MA   A+GIDLGT++SCV V Q G+  +I N+ G  T  S V+F  D   L+G+AAK  +
Sbjct: 1   MADDIAIGIDLGTSFSCVAVVQDGQPTVIPNEWGETTHASCVSFLEDGSVLVGNAAKKNI 60

Query: 252 A*TP-TTQYS 278
              P  T YS
Sbjct: 61  ITNPEQTVYS 70


>UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 593

 Score =  116 bits (278), Expect = 8e-25
 Identities = 56/84 (66%), Positives = 67/84 (79%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA FND QRQATKDA  I+GLNV RIINEPTAAA++YG+DKK     NVL++DLGGGT 
Sbjct: 139 VPATFNDKQRQATKDAALIAGLNVKRIINEPTAAALSYGIDKK-QETLNVLVYDLGGGTL 197

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L + +G F VK+TAG +H G
Sbjct: 198 DVSLLEVTEGKFTVKATAGISHLG 221



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 37/59 (62%), Positives = 44/59 (74%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           A+GIDLGTTYSCVGVF++ +VEII N+ G RTTPS VAF      IG+AA N+ A  PT
Sbjct: 4   AIGIDLGTTYSCVGVFRNQRVEIIPNELGKRTTPSCVAFNSFHTHIGEAAVNERAENPT 62



 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 39/88 (44%), Positives = 53/88 (60%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTIF  KR+IG+   D     D+  +PFE+        IKV++ G+ +   PE +S+
Sbjct: 60  NPTNTIFGIKRIIGKDSYD-----DVGKFPFEITKSKSGLVIKVSFNGKKRKLKPELISA 114

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFPRT 520
           M+L K+K  AE YLG  V+NAVIT P T
Sbjct: 115 MILRKLKTDAEIYLGADVKNAVITVPAT 142


>UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 946

 Score =  115 bits (277), Expect = 1e-24
 Identities = 55/85 (64%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG-LDKKGTGERNVLIFDLGGGT 684
           VPAYFNDSQR+ATK AG I+GLNVL IINEPTAAA+AYG  + K   ERN+L++DLGGGT
Sbjct: 144 VPAYFNDSQRKATKAAGEIAGLNVLGIINEPTAAALAYGQSNNKDCKERNLLVYDLGGGT 203

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FDVS++T    ++EV+++ GD+H G
Sbjct: 204 FDVSLVTHCKDVYEVRASDGDSHLG 228



 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 48/88 (54%), Positives = 62/88 (70%)
 Frame = +2

Query: 251 GVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEV 430
           G NP NT++  KRLIGR F+D  VQ D+ H+ F+VV+  GKP I+V YK E +T  PEE+
Sbjct: 58  GKNPENTVYGTKRLIGRDFDDPEVQHDITHFLFKVVNRNGKPFIQVQYKKEIRTLPPEEI 117

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           S+MVL  +K TAE YLG  V++ VIT P
Sbjct: 118 SAMVLESVKCTAEEYLGVKVEDVVITVP 145



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 35/59 (59%), Positives = 43/59 (72%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           P +GIDLGTT SCV VF + KVE+IAN  G+R TPS V+F D E +IG+ AKNQ+   P
Sbjct: 4   PVIGIDLGTTNSCVAVFNN-KVEVIANVLGSRITPSCVSFDDNETIIGEGAKNQLGKNP 61


>UniRef50_Q1CWT5 Cluster: DnaK family protein; n=2;
           Cystobacterineae|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 608

 Score =  114 bits (275), Expect = 2e-24
 Identities = 52/89 (58%), Positives = 71/89 (79%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 672
           +C   VPA F+D+QRQAT++A +I+GL+V+R++NEPTAAA+AYGL +   G  N L+FDL
Sbjct: 138 KCVITVPANFDDNQRQATREAASIAGLDVVRLVNEPTAAALAYGLSRGFEG--NALVFDL 195

Query: 673 GGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GGGTFDVSIL ++ G+FEV++T GD   G
Sbjct: 196 GGGTFDVSILEVKSGVFEVRATGGDPRLG 224



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 26/92 (28%), Positives = 48/92 (52%)
 Frame = +2

Query: 239 QEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFF 418
           Q  G  +P++ ++  KR +GR++    VQ      P+ +V+ G    ++V   G  +   
Sbjct: 56  QSLGEEHPDSVVWATKRFLGRRYTPELVQEAKALVPYPLVA-GPSGDVRVRLAG--RVMP 112

Query: 419 PEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
             +VS+M+L ++   A+A+ G+ V   VIT P
Sbjct: 113 VTQVSAMILGELALDAQAHFGRPVTKCVITVP 144



 Score = 39.9 bits (89), Expect = 0.067
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKN 245
           +GIDLGTT S V   + G+  +I    G R TPS +      ER++G AA++
Sbjct: 6   IGIDLGTTNSAVATVEDGRPRMIPPRAGGRLTPSTLGVNKAGERVVGVAAQS 57


>UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella
           natans|Rep: Chaperone DnaK - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 653

 Score =  112 bits (270), Expect = 8e-24
 Identities = 53/84 (63%), Positives = 65/84 (77%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+D+QR ATKDAG+I+GLNV RIINEPTAA++AYG DK  +    + +FD GGGTF
Sbjct: 204 VPAYFDDAQRNATKDAGSIAGLNVQRIINEPTAASLAYGFDK--SDNSIIFVFDAGGGTF 261

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L   DG+FEV  T GD+  G
Sbjct: 262 DVSLLEAGDGVFEVIQTGGDSSLG 285



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 27/87 (31%), Positives = 42/87 (48%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           VNP NT +  K LIGRK++          +P   + +G    IKV+    +  F+PE+ S
Sbjct: 122 VNPQNTYYSVKSLIGRKYQTTAPNLSSLAYP---IKEGPNGLIKVSCPQLNTDFYPEQPS 178

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL +++           + AVIT P
Sbjct: 179 AKVLEQLESNYHTAFDSKPELAVITVP 205



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 26/68 (38%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVA*TP-T 266
           VGIDLGTT S +     G+  I+ N  G R TPS +        ++GD AK Q    P  
Sbjct: 67  VGIDLGTTNSAIATMVAGQPSILPNSSGARLTPSVIGIDKQNNFVVGDIAKRQAVVNPQN 126

Query: 267 TQYSMPNV 290
           T YS+ ++
Sbjct: 127 TYYSVKSL 134


>UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:
           2-alkenal reductase - Anaeromyxobacter sp. Fw109-5
          Length = 623

 Score =  111 bits (267), Expect = 2e-23
 Identities = 51/84 (60%), Positives = 66/84 (78%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND QRQATKDAG I+GL VLRI+NEPTAAA+AYG  ++   +  V++FDLGGGTF
Sbjct: 146 VPAYFNDGQRQATKDAGRIAGLEVLRIVNEPTAAALAYGFGRQVRSK--VVVFDLGGGTF 203

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L +   +++V +  GDT+ G
Sbjct: 204 DVSVLDVGRSVYDVVAVGGDTYLG 227



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 34/86 (39%), Positives = 53/86 (61%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP  T+F AKRLIGR++  + V+   K  P+E+V+      ++V   G   +    E+S+
Sbjct: 64  NPEGTVFAAKRLIGRRWGSSEVEDARKALPYELVAGPEGNDVRVQLGGRAVSM--PELSA 121

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           +VL ++K  AEA+LGK V+ AV+T P
Sbjct: 122 LVLAELKADAEAFLGKPVRRAVVTVP 147



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/60 (45%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           P VGIDLGTT S V   Q G   +I    G   TPS VA   +  RL+G  AK Q    P
Sbjct: 6   PVVGIDLGTTNSVVATVQDGVPRVIPGRTGQPLTPSVVAVAKNGRRLVGALAKRQAITNP 65


>UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188;
           Bacteria|Rep: Chaperone protein hscA - Yersinia pestis
          Length = 650

 Score =  111 bits (266), Expect = 2e-23
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL-IFDLGGGT 684
           VPAYF+D+QRQ TKDA  ++GL+VLR++NEPTAAAIAYGLD   +G+  V+ ++DLGGGT
Sbjct: 190 VPAYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLD---SGQEGVIAVYDLGGGT 246

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FD+SIL +  G+FEV +T GD+  G
Sbjct: 247 FDISILRLSRGVFEVLATGGDSALG 271



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 27/87 (31%), Positives = 43/87 (49%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           ++P NTI   KR++GR   D   +     + F   S+ G P I+ A +G      P +VS
Sbjct: 110 LDPVNTISSVKRMMGRSLADIVQRYPNLPYQFH-ASENGLPMIQTA-RG---LVNPVQVS 164

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + +L  + + A+A L   +   VIT P
Sbjct: 165 AEILKTLAQRAQAALAGELDGVVITVP 191


>UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 509

 Score =  110 bits (265), Expect = 3e-23
 Identities = 53/84 (63%), Positives = 64/84 (76%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF D QRQA K+AG +  L V+RIINEPTAAA+AYG+ K+   E  VL++DLGGGTF
Sbjct: 148 VPAYFTDRQRQAVKEAGALVDLEVVRIINEPTAAALAYGIGKR--LEERVLVYDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSI+ I D +FEVK+T GD   G
Sbjct: 206 DVSIIEIRDRVFEVKATGGDIFLG 229



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 27/87 (31%), Positives = 50/87 (57%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT++  KRLIGR   D  V +  +   +++ + G    ++V   G  ++F  +++ 
Sbjct: 66  LNPRNTLYATKRLIGRAPRDEVVDSMQRSVQYQLHA-GANHDVEVDCHG--RSFSIQQIG 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           S +L K+++ A  +LG  V+ AV+T P
Sbjct: 123 SRILGKIRDVASDHLGFKVRRAVVTVP 149



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 27/60 (45%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGV-FQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 248
           +A  P +GIDLGTT SC  V +  G+V++I    G+ T PS  A  D    LIG  AK Q
Sbjct: 4   LAADPIIGIDLGTTNSCGAVAYGDGQVKLIPYKGGDYTIPSIFAIDDKGNELIGHEAKRQ 63


>UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29;
           Proteobacteria|Rep: Chaperone protein hscA - Salmonella
           typhimurium
          Length = 616

 Score =  110 bits (265), Expect = 3e-23
 Identities = 51/84 (60%), Positives = 66/84 (78%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+D+QRQ TKDA  ++GL+VLR++NEPTAAAIAYGLD    G   + ++DLGGGTF
Sbjct: 156 VPAYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSGKEGV--IAVYDLGGGTF 213

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL +  G+FEV +T GD+  G
Sbjct: 214 DISILRLSRGVFEVLATGGDSALG 237



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 20/55 (36%), Positives = 29/55 (52%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           A GIDLGTT S V   + G+ E + + +G    PS V +      +G AA++  A
Sbjct: 21  AAGIDLGTTNSLVATVRSGQAETLPDHEGRHLLPSVVHYQQQGHTVGYAARDNAA 75


>UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera
           aphidicola|Rep: Chaperone protein hscA - Buchnera
           aphidicola subsp. Acyrthosiphon pisum (Acyrthosiphon
           pisumsymbiotic bacterium)
          Length = 611

 Score =  110 bits (265), Expect = 3e-23
 Identities = 51/84 (60%), Positives = 67/84 (79%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND Q++ TK A  +SG+N++R++NEPTAAA+AYGL K   G   VL++DLGGGTF
Sbjct: 148 VPAYFNDFQKKETKKAAVLSGINLIRLLNEPTAAAVAYGLQKLKKG--IVLVYDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL +  GIFEV +T+GD++ G
Sbjct: 206 DVSILNLNKGIFEVLATSGDSNLG 229



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 21/71 (29%), Positives = 31/71 (43%)
 Frame = +3

Query: 66  KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 245
           K K  K   +GIDLGTTYS     +   V ++ + +     PS V +   +  +G  A  
Sbjct: 5   KKKHDKKLLLGIDLGTTYSLAATVREKSVILLLDKKKRYLLPSVVHYKKNKISVGWKALE 64

Query: 246 QVA*TPTTQYS 278
            +   PT   S
Sbjct: 65  NITEDPTNTIS 75



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 24/86 (27%), Positives = 40/86 (46%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           +P NTI   KRL+GR      V+      P+ +  D  +    + ++       P +VSS
Sbjct: 69  DPTNTISSVKRLLGRSIN--FVKKKFPILPYLIEKDIHEG---IFFRTNFGNITPIDVSS 123

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            +L K+K+ A     + +  +VIT P
Sbjct: 124 HILKKLKKRAVLLFNQEIDASVITVP 149


>UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas
           vaginalis|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 617

 Score =  110 bits (264), Expect = 4e-23
 Identities = 52/84 (61%), Positives = 68/84 (80%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFN+ QR+AT  AG I+GL V RII+EPTAAA+AYGL+K+   E+ V+++DLGGGTF
Sbjct: 154 VPAYFNEDQRKATITAGQIAGLKVDRIISEPTAAALAYGLNKE--DEKYVIVYDLGGGTF 211

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LT++   F+V +T GDTH G
Sbjct: 212 DVSLLTLDKDYFQVVATGGDTHLG 235



 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 42/89 (47%), Positives = 58/89 (65%)
 Frame = +2

Query: 248 GGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEE 427
           G ++P  T+F  KRLIGRKF D  VQ +M   PF +V    +P IK++ + ED    PEE
Sbjct: 67  GTISPETTVFAVKRLIGRKFSDPIVQQEMHRVPFTIVERDERPYIKISTEEEDTLISPEE 126

Query: 428 VSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           +S++VL K+K+ AE YL +T+  AVIT P
Sbjct: 127 ISALVLKKLKQQAELYLNETIHEAVITVP 155



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 26/59 (44%), Positives = 42/59 (71%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPTT 269
           +GIDLGTT+S VG++++G+VEII N+   + TPS V++ +  R++GD+A      +P T
Sbjct: 15  IGIDLGTTFSVVGIYKNGEVEIIPNEINKKITPSVVSYYNGSRVVGDSAVRLGTISPET 73


>UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27;
           Proteobacteria|Rep: Chaperone protein hscA homolog -
           Burkholderia mallei (Pseudomonas mallei)
          Length = 622

 Score =  110 bits (264), Expect = 4e-23
 Identities = 52/84 (61%), Positives = 65/84 (77%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+D+QRQATKDA  ++GLNVLR++NEPTAAAIAYGLD    G     ++DLGGGTF
Sbjct: 155 VPAYFDDAQRQATKDAARLAGLNVLRLLNEPTAAAIAYGLDNGAEG--LYAVYDLGGGTF 212

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL +  G+FEV +  GD+  G
Sbjct: 213 DLSILKLTKGVFEVLAAGGDSALG 236



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 30/92 (32%), Positives = 45/92 (48%)
 Frame = +2

Query: 239 QEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFF 418
           +E   ++P NTI   KR +GR   +    A+    P+E V   G  +I+      D    
Sbjct: 72  KEEAAIDPRNTIVSVKRFMGRGKAEVEGAANA---PYEFVDAPGMVQIRTV----DGVKS 124

Query: 419 PEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           P EVS+ +L  +++ AE  LG  +  AVIT P
Sbjct: 125 PVEVSAEILATLRQRAEDTLGDDLVGAVITVP 156



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 26/59 (44%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*TP 263
           AVGIDLGTT S V   ++   E + +D G    PS V + D   R IG AAK + A  P
Sbjct: 21  AVGIDLGTTNSLVAAVRNSIPEALPDDAGRVLLPSVVRYLDKGGRRIGHAAKEEAAIDP 79


>UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3;
           Psychrobacter|Rep: 2-alkenal reductase - Psychrobacter
           sp. PRwf-1
          Length = 650

 Score =  109 bits (261), Expect = 1e-22
 Identities = 52/90 (57%), Positives = 69/90 (76%), Gaps = 6/90 (6%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG------ERNVLIFD 669
           VPAYF+++QRQATKDA  ++GL VLR++NEPTAAA+AYGLD+          ER  LI+D
Sbjct: 164 VPAYFDEAQRQATKDAAQLAGLKVLRLLNEPTAAAVAYGLDRAAGSSDETQQERLFLIYD 223

Query: 670 LGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           LGGGTFDVS+L + +G+FEV +T G++  G
Sbjct: 224 LGGGTFDVSLLKMNEGVFEVLATGGNSALG 253



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           +P NTI  AKR +GR  +D        H P+++ S         ++        P EVS+
Sbjct: 84  DPVNTIISAKRFMGRSVKD----IKFSH-PYQLKSSETSADAMPSFLTGQGNVSPVEVSA 138

Query: 437 MVLTKMKETAEAYL-GKTVQNAVITFP 514
            +L  +K+ A+  L   ++Q AVIT P
Sbjct: 139 DILRTLKDRAQRALPDDSIQGAVITVP 165


>UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031574 - Anopheles gambiae
           str. PEST
          Length = 503

 Score =  109 bits (261), Expect = 1e-22
 Identities = 51/84 (60%), Positives = 67/84 (79%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F+D QRQA  DA TI+GL+VLR+INEPTAAAI+ G++KK  GE+ VL+   GGG  
Sbjct: 125 VPAQFSDGQRQAVLDAATIAGLSVLRLINEPTAAAISIGINKKLIGEQYVLVCSFGGGFL 184

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSI+TI +G+F+VK+++GDT  G
Sbjct: 185 DVSIVTIYNGVFQVKASSGDTRLG 208



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 29/53 (54%), Positives = 40/53 (75%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           A+GID GT++S VG++++GK EIIAN+ GN   PS VAFT+  RL+G+ A  Q
Sbjct: 5   AIGIDFGTSFSSVGIYRNGKFEIIANECGNHRIPSVVAFTEKGRLVGEEALAQ 57



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 7/92 (7%)
 Frame = +2

Query: 260 PNNTIFDAK-RLIGRKFEDATVQADMK--HWPFEVVSDGGKPK----IKVAYKGEDKTFF 418
           P+   F  K RL+G   E+A  QAD    +   EV    G+ K    ++V +KGE K + 
Sbjct: 38  PSVVAFTEKGRLVG---EEALAQADTDPANCVIEVKRILGRHKKEGGLQVQFKGETKCYQ 94

Query: 419 PEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           PEE+  ++L  ++  AE  LG+ V  AV+  P
Sbjct: 95  PEEICGIILAHLRSMAERQLGEPVTCAVVAVP 126


>UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodospira
           halophila SL1|Rep: Heat shock protein 70 -
           Halorhodospira halophila (strain DSM 244 / SL1)
           (Ectothiorhodospirahalophila (strain DSM 244 / SL1))
          Length = 577

 Score =  108 bits (260), Expect = 1e-22
 Identities = 49/84 (58%), Positives = 68/84 (80%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+D+QRQAT+DAGT++GL V+RIINEPTAAA+AY  D+     R++L++DLGGGTF
Sbjct: 118 VPAYFSDAQRQATRDAGTLAGLEVVRIINEPTAAALAYESDQ--AERRHILVYDLGGGTF 175

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS++ +E  + EV ++ G+ H G
Sbjct: 176 DVSVVRMEQDVVEVLASHGNNHLG 199



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 16/37 (43%), Positives = 29/37 (78%)
 Frame = +2

Query: 404 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           D+++ P+E+S+++L ++K+ AE  LG+ V+ AVIT P
Sbjct: 83  DRSYTPQEISAVILARLKQAAEVQLGEPVRKAVITVP 119



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*TP 263
           +GIDLGTT S V V ++G+V++I  +      PS V   +    L+G AA+NQ+A  P
Sbjct: 6   IGIDLGTTNSEVAVVRNGQVQLIEVEDA-YLMPSAVGLDEEGGLLVGYAARNQLALHP 62


>UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular
           organisms|Rep: Heat shock protein 70 - Rhodoferax
           ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118)
          Length = 633

 Score =  108 bits (259), Expect = 2e-22
 Identities = 49/84 (58%), Positives = 66/84 (78%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+D+QR ATKDA  I+GL V+R++NEPTAA++AYGLD+  + E  + + DLGGGT 
Sbjct: 121 VPAYFDDNQRSATKDACRIAGLEVIRLVNEPTAASLAYGLDRL-SEELRIAVIDLGGGTL 179

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+I+    G+FEVK+T+GDT  G
Sbjct: 180 DVTIMEFGKGVFEVKATSGDTQLG 203



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 5/62 (8%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQ----GNRTTPSYVAFT-DTERLIGDAAKNQVA* 257
           +GIDLGT+ S   V + G+  II + +    G +  PSYVA T D + L+G+ A+ Q   
Sbjct: 4   IGIDLGTSNSAAAVLRGGRPVIIPSAEGLSIGGKAFPSYVALTADGQMLVGEPARRQATA 63

Query: 258 TP 263
            P
Sbjct: 64  NP 65



 Score = 39.5 bits (88), Expect = 0.088
 Identities = 16/36 (44%), Positives = 26/36 (72%)
 Frame = +2

Query: 407 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           + + PE++S+ +L K+K  AEA+LG+ V  AV+T P
Sbjct: 87  RDYSPEQLSAFLLQKIKRDAEAFLGEPVHQAVVTVP 122


>UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26;
           Bacteria|Rep: Chaperone protein hscC - Bacillus
           anthracis
          Length = 566

 Score =  107 bits (258), Expect = 2e-22
 Identities = 53/84 (63%), Positives = 66/84 (78%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QR++TK A  I+GL V R+I+EPTAAAIAYGL ++   E   L+FDLGGGTF
Sbjct: 117 VPAYFNDTQRKSTKRAAEIAGLTVERLISEPTAAAIAYGLYQE-ESETKFLVFDLGGGTF 175

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL + +GI +VKS AGD + G
Sbjct: 176 DVSILELFEGIMDVKSIAGDNYLG 199



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQV 251
           +GIDLGTT S V  +      +I N  G   TPS V+  +T E L+G  AK ++
Sbjct: 4   IGIDLGTTNSLVATWSEDGATLIPNVLGEFLTPSVVSVDETGEILVGRIAKERL 57



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +2

Query: 410 TFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           TF  EE+SS V+  +K+ AEAYL + V  AVI+ P
Sbjct: 84  TFSSEELSSFVIKSLKQDAEAYLNEEVTGAVISVP 118


>UniRef50_A3CIL0 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 382

 Score =  107 bits (258), Expect = 2e-22
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 2/63 (3%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFN SQRQATKDA  I+GLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDLGGG
Sbjct: 180 VPAYFNYSQRQATKDARVIAGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDLGGG 239

Query: 682 TFD 690
           TFD
Sbjct: 240 TFD 242



 Score =  101 bits (241), Expect = 3e-20
 Identities = 48/80 (60%), Positives = 62/80 (77%), Gaps = 1/80 (1%)
 Frame = +2

Query: 278 DAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKM 454
           DAKRLIG++F DA+VQ+D+  WPF+V++  G K  I V YKGE+K F  EE+SSMVL KM
Sbjct: 102 DAKRLIGQRFTDASVQSDIMLWPFKVIAGPGDKSMIVVQYKGEEKQFAAEEISSMVLIKM 161

Query: 455 KETAEAYLGKTVQNAVITFP 514
           +E AEAYLG T++ AV+T P
Sbjct: 162 REIAEAYLGTTIKKAVVTVP 181



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 32/73 (43%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 442
           N   +AKRLIGR+F DA+VQ+D+K WPF+V++  G K  I V YKGE+K    E++    
Sbjct: 22  NMAENAKRLIGRRFTDASVQSDIKLWPFKVIAGPGDKSTIVVQYKGEEKQVAAEQIDDET 81

Query: 443 LTKMKETAEAYLG 481
           ++     A+ Y G
Sbjct: 82  ISPSVCYADPYDG 94


>UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus
           weihenstephanensis KBAB4|Rep: Heat shock protein Hsp70 -
           Bacillus weihenstephanensis KBAB4
          Length = 578

 Score =  107 bits (257), Expect = 3e-22
 Identities = 51/84 (60%), Positives = 67/84 (79%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+DSQR+AT+ AG I+GL V RIINEPTAAAIAYG +     + ++L++DLGGGTF
Sbjct: 117 VPAYFSDSQRKATQKAGEIAGLKVERIINEPTAAAIAYGFENLDQNQ-HILVYDLGGGTF 175

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSI+ I +G+ EVK++AG+   G
Sbjct: 176 DVSIIEIFEGVVEVKASAGNNKLG 199



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 29/58 (50%), Positives = 37/58 (63%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV-AFTDTERLIGDAAKNQVA*TP 263
           VGIDLGTT S +   ++GK EII N +GNRTTPS V      E +IG+ AK+ +   P
Sbjct: 4   VGIDLGTTNSAIAYLKNGKPEIIENKKGNRTTPSVVQKDLKGEIIIGEDAKSGIKSLP 61



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 17/32 (53%), Positives = 23/32 (71%)
 Frame = +2

Query: 419 PEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           PEEVS+++L  +KE+ E  LG+ V  AVIT P
Sbjct: 87  PEEVSALILKYLKESVEEKLGEAVTEAVITVP 118


>UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2;
           Gammaproteobacteria|Rep: Molecular chaperone HscA -
           Vesicomyosocius okutanii subsp. Calyptogena okutanii
           (strain HA)
          Length = 614

 Score =  107 bits (257), Expect = 3e-22
 Identities = 51/84 (60%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV-LIFDLGGGTF 687
           PAYFND+QRQATKDA T++GL  LR++NEPTAAA+AYGL+   +GE  V  I+DLGGGTF
Sbjct: 156 PAYFNDAQRQATKDAATLAGLKTLRLLNEPTAAAVAYGLE---SGEEGVHAIYDLGGGTF 212

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL    G+F+V +  GD   G
Sbjct: 213 DISILNFSKGVFKVLAIGGDATLG 236



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 26/86 (30%), Positives = 44/86 (51%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           +P NTI   KR +G  +E+ +     K+ P++++ DG      V +          E+S+
Sbjct: 78  DPTNTIISIKRFMGMSYEEVST---FKNCPYQLIKDGNN----VLFHTSMGNLSAVEISA 130

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            +L+ +K+ AE  LG  +  AVIT P
Sbjct: 131 SILSSLKQRAENSLGGVLSGAVITTP 156


>UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 607

 Score =  106 bits (255), Expect = 5e-22
 Identities = 49/84 (58%), Positives = 63/84 (75%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFN +QR+AT++A  I+GL VLRI+NEPTAAAIAY L  +    RN+LI+DLGGGTF
Sbjct: 143 VPAYFNATQRRATEEAAEIAGLKVLRILNEPTAAAIAYSLKGQRLSRRNILIYDLGGGTF 202

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+ + ++     VK+  GDTH G
Sbjct: 203 DVAAVNVDGPRITVKAKGGDTHLG 226



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 35/84 (41%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVSSMV 442
           N++FD KR+IGR+++D  +Q DM  WPF+V   D G P +++    +   F    VSS++
Sbjct: 61  NSLFDVKRIIGRRYDDVLLQRDMPLWPFKVEKDDNGIPYLEIHKNEKPLKFSAVTVSSLI 120

Query: 443 LTKMKETAEAYLGKTVQNAVITFP 514
           L  +K  AE  LG  V++AVIT P
Sbjct: 121 LRCLKYNAERKLGLEVKSAVITVP 144



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 28/55 (50%), Positives = 40/55 (72%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQV 251
           ++GIDLGTT+SCV  +Q+G+V I+ N+ G RTTPS +A   D + LIG  AK+ +
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKDVI 56


>UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13;
           Rickettsiales|Rep: Heat shock protein Hsp70 - Ehrlichia
           canis (strain Jake)
          Length = 618

 Score =  106 bits (254), Expect = 7e-22
 Identities = 46/84 (54%), Positives = 65/84 (77%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+++ R+ATKDA  ++ L VLR++NEPTAAA+AYG++K        +++DLGGGTF
Sbjct: 148 VPAYFDEAARKATKDAAHLANLEVLRLLNEPTAAALAYGIEKPEYENNIYMVYDLGGGTF 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL +  G+F+V +T GDT+ G
Sbjct: 208 DVSILKLHQGVFQVLATGGDTNLG 231



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 245
           A GIDLGTT S + +  + GK  I +++ G    PS V++ + +  +G    N
Sbjct: 17  AFGIDLGTTNSLISMIDNEGKTIIFSDENGRFLIPSTVSYINNQVEVGKNYSN 69


>UniRef50_A2Y3V8 Cluster: Putative uncharacterized protein; n=4;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 430

 Score =  105 bits (253), Expect = 9e-22
 Identities = 51/87 (58%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGED-KTFFPEEVS 433
           NP  T++DAKRLIG +F DA VQ DM+  PF VV  GGKP ++V  +G D +   PEEVS
Sbjct: 98  NPGRTVYDAKRLIGLRFADAEVQRDMRLLPFAVVDKGGKPHVRVEVRGGDVRLLSPEEVS 157

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVL +MKETAEAYLG+ V  AV+T P
Sbjct: 158 AMVLARMKETAEAYLGEEVTRAVVTVP 184



 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 44/58 (75%), Positives = 50/58 (86%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFT   ERLIG+AAKNQ A  P
Sbjct: 42  IGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTGGGERLIGEAAKNQAAANP 99



 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 32/39 (82%), Positives = 36/39 (92%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 624
           VPAYFND+QRQATKDA TI+GL V RI+NEPTAAA+AYG
Sbjct: 183 VPAYFNDAQRQATKDAATIAGLAVERILNEPTAAALAYG 221


>UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1;
           Acanthamoeba polyphaga mimivirus|Rep: Heat shock protein
           70 homolog - Mimivirus
          Length = 941

 Score =  105 bits (253), Expect = 9e-22
 Identities = 48/87 (55%), Positives = 66/87 (75%), Gaps = 3/87 (3%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLIFDLGG 678
           VPAYFND+QRQAT D+  I+GL+VL+IINEPTAAA+AYGL  +   ++   NV+++DLG 
Sbjct: 166 VPAYFNDAQRQATLDSAKIAGLDVLKIINEPTAAALAYGLGSEKWNKKTGGNVIVYDLGA 225

Query: 679 GTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GT DVS++ I +G+F   +  G+TH G
Sbjct: 226 GTLDVSLMNISNGVFRTLAVGGNTHLG 252



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 7/93 (7%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGK-PKIKVAYKGEDKT------F 415
           NP NTI+D KR+IGR+  D +++       +E+VSD  K   I V     D T      +
Sbjct: 75  NPKNTIYDIKRIIGRRMNDKSIEQTKNLISYELVSDESKHENILVQLDKSDYTLTHKYQY 134

Query: 416 FPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
            PEE+ + +L +++  A  YL K +  AVIT P
Sbjct: 135 KPEEICAQILIEIRRIASQYLQKPINKAVITVP 167



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/49 (46%), Positives = 35/49 (71%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           +GIDLGT +SCV ++++ + EII +  GNRT PS V+F  + +L+G  A
Sbjct: 20  IGIDLGTRFSCVSIWRNKRFEIIPDQFGNRTIPSVVSFYKSAKLVGHNA 68


>UniRef50_Q6F9S6 Cluster: Chaperone protein; n=2; Acinetobacter|Rep:
           Chaperone protein - Acinetobacter sp. (strain ADP1)
          Length = 566

 Score =  105 bits (252), Expect = 1e-21
 Identities = 51/84 (60%), Positives = 65/84 (77%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND QRQAT  A  ++GL V R+INEPTAAA+AYGL +  + +   LIFDLGGGTF
Sbjct: 120 VPAYFNDIQRQATISAAELAGLKVSRLINEPTAAALAYGLGQ--SDDSCFLIFDLGGGTF 177

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSI+ + DG+ EV+++AGD + G
Sbjct: 178 DVSIVELFDGVIEVRASAGDNYLG 201



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 27/52 (51%), Positives = 37/52 (71%), Gaps = 1/52 (1%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAA 239
           P +GIDLGT+ S VGVF++G+  +I N  GN+ TPS +A  + E+ LIG AA
Sbjct: 6   PLIGIDLGTSNSLVGVFENGQPRLIENAYGNKLTPSAIAMDEDEQILIGQAA 57


>UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas sp.
           MWYL1|Rep: 2-alkenal reductase - Marinomonas sp. MWYL1
          Length = 552

 Score =  105 bits (252), Expect = 1e-21
 Identities = 47/89 (52%), Positives = 69/89 (77%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 672
           E    VPAYFN+ QRQAT+ A +++GL+V R++NEPTAAA+AYGLD + + E+  L+ DL
Sbjct: 111 EAVISVPAYFNNKQRQATQQAASLAGLDVERLLNEPTAAALAYGLDNQDS-EQTYLVLDL 169

Query: 673 GGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GGGTFDVS++ + + IFE+ +++GD + G
Sbjct: 170 GGGTFDVSVIEVFNEIFEIHASSGDNYLG 198



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 26/58 (44%), Positives = 40/58 (68%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           +GIDLGTT+S VGV++ G V++I + +GN   PS V  + D   L+G AA++++A  P
Sbjct: 3   IGIDLGTTHSVVGVWKDGSVQLIPDMEGNILVPSAVGISEDNYILVGQAARDRLATNP 60



 Score = 33.1 bits (72), Expect = 7.7
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +2

Query: 404 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA 571
           D+ +   E+S+++L  +KE AE YL + V  AVI+ P      K +    Q  SLA
Sbjct: 81  DQEYNAIELSAILLKSLKEQAEQYLEEPVYEAVISVP-AYFNNKQRQATQQAASLA 135


>UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 592

 Score =  105 bits (251), Expect = 2e-21
 Identities = 51/87 (58%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 433
           NP NT+FDAKRLIGRKF D+ VQ DM  WPF+V+     KP I V  KG++K    EE+S
Sbjct: 67  NPENTVFDAKRLIGRKFGDSVVQNDMMLWPFKVICGVNDKPMISVKCKGQEKHLCAEEIS 126

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKM++TAE +L   V+NAV+T P
Sbjct: 127 SMVLTKMRKTAEEFLELPVKNAVVTVP 153



 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 43/60 (71%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           AVGIDLGTTYSCV V+  +H +VEII NDQGN+TTPS+VAFTD +RL+GDAAKNQ    P
Sbjct: 9   AVGIDLGTTYSCVAVWLDEHNRVEIIHNDQGNKTTPSFVAFTDDQRLVGDAAKNQAPTNP 68



 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 37/59 (62%), Positives = 47/59 (79%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 684
           VPAYFND+QR+AT DAG I+GLN++RIINEPTAAAIAYGLDK+   ++   +  + G T
Sbjct: 152 VPAYFNDAQRKATIDAGVIAGLNIMRIINEPTAAAIAYGLDKRTNCDKVFQVKAIAGNT 210


>UniRef50_Q73CC4 Cluster: Dnak protein, truncation; n=1; Bacillus
           cereus ATCC 10987|Rep: Dnak protein, truncation -
           Bacillus cereus (strain ATCC 10987)
          Length = 505

 Score =  104 bits (250), Expect = 2e-21
 Identities = 47/84 (55%), Positives = 68/84 (80%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+D+QR+AT+DAG I+GL+VL++INEPTAAA+AYGL  +   ++NV+++DLGGGTF
Sbjct: 117 VPAYFDDAQRKATQDAGRIAGLHVLKVINEPTAAALAYGLANR-EQKQNVMVYDLGGGTF 175

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+++ +      VK+T GD + G
Sbjct: 176 DVTLIQLNQDEVVVKATGGDRNLG 199



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           +GIDLGTT S V  +   G   I+ N +G R TPS + F D   +IG  AK+     PT
Sbjct: 3   IGIDLGTTNSAVAYIDDSGNPTILPNREGERVTPSVIFFEDGSPVIGSTAKSISVSDPT 61



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 29/88 (32%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIF-DAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEV 430
           V P+   F D   +IG   +  +V        F V    G    K    GE   F PE++
Sbjct: 34  VTPSVIFFEDGSPVIGSTAKSISVSDPTNTVQF-VKRQMGNASYKFPIGGE--VFTPEDL 90

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           S+++L ++KE AE  +G  V  AVIT P
Sbjct: 91  SALILKRLKEDAEEAIGAKVTKAVITVP 118


>UniRef50_A7HBX9 Cluster: 2-alkenal reductase precursor; n=7;
           Cystobacterineae|Rep: 2-alkenal reductase precursor -
           Anaeromyxobacter sp. Fw109-5
          Length = 542

 Score =  104 bits (249), Expect = 3e-21
 Identities = 46/89 (51%), Positives = 66/89 (74%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 672
           E    VPAY++D+QRQA ++AG ++G  V RI+NEPTAAA+AYG  +    ++ +L++DL
Sbjct: 142 EAVISVPAYYSDAQRQAVREAGKLAGFEVRRIVNEPTAAALAYGFGR--ALDQKILVYDL 199

Query: 673 GGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GGGTFDVS+L ++  +FEV +T GDT  G
Sbjct: 200 GGGTFDVSVLQLQGNVFEVLATGGDTFLG 228



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 34/86 (39%), Positives = 50/86 (58%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTI+ AKRLIGRK+    VQ    ++ +++V +G      V   GE +T    E+S+
Sbjct: 66  NPKNTIYGAKRLIGRKWSSRVVQELRNYYSYDIV-EGPNGDAAVMLGGEVRTL--PEISA 122

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           MVL  +++ A  +L K V  AVI+ P
Sbjct: 123 MVLAHVRKIAGQFLQKDVDEAVISVP 148



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*TP 263
           P +GIDLGTT +CV   +    +++  D+GN   P+ VA +D  + L+G+ AK+Q+   P
Sbjct: 8   PVLGIDLGTTNACVAHVRSRIPKVVPTDRGNLILPTVVALSDRGDLLVGNVAKDQLVTNP 67


>UniRef50_A4J964 Cluster: Heat shock protein 70; n=2;
           Clostridiales|Rep: Heat shock protein 70 -
           Desulfotomaculum reducens MI-1
          Length = 619

 Score =  104 bits (249), Expect = 3e-21
 Identities = 48/84 (57%), Positives = 66/84 (78%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF D QR+ATK AG ++G  V RIINEPTAAA+A+GL      +R++LI+DLGGGTF
Sbjct: 130 VPAYFTDEQRRATKQAGELAGFVVERIINEPTAAALAFGLAHM-EEDRHILIYDLGGGTF 188

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS++ +  G+ EVK+++G++H G
Sbjct: 189 DVSVVEMMSGVLEVKASSGNSHLG 212



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +3

Query: 45  TSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTER 221
           T+ K D   + +  P VGIDLGTT S V    + K EII + Q     PS V    + + 
Sbjct: 2   TNRKND-ATRQSFRPIVGIDLGTTNSAVAYIHNSKPEIIPSPQSKHIIPSVVLLDPEGKV 60

Query: 222 LIGDAAK 242
           ++G+ A+
Sbjct: 61  VVGEDAR 67


>UniRef50_A2WTX8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 359

 Score =  104 bits (249), Expect = 3e-21
 Identities = 50/99 (50%), Positives = 68/99 (68%), Gaps = 1/99 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 433
           NP NT+F  KRL+GR+F DA+VQ  +K WPF+VV   G KP +  +YKG+ K    EEV+
Sbjct: 117 NPTNTVFATKRLMGRRFSDASVQDGLKLWPFKVVPGRGDKPMVAASYKGKQKLLAAEEVA 176

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQK 550
           SM+L+KMK  AEAY+G  V+NAV+T P +   L+ +  K
Sbjct: 177 SMLLSKMKAEAEAYIGGPVKNAVVTVPASFDVLQRRATK 215



 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 37/60 (61%), Positives = 46/60 (76%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           P +GIDLGT  SCV V+Q+G+ EI+ N+ G R TPSY AFTD ERL+GDAAK+Q +  PT
Sbjct: 60  PVIGIDLGTACSCVAVWQNGRAEIVTNEHGGRATPSYAAFTDAERLVGDAAKSQASRNPT 119


>UniRef50_UPI0000D56BFD Cluster: PREDICTED: similar to CG8937-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8937-PA, isoform A - Tribolium castaneum
          Length = 767

 Score =  103 bits (247), Expect = 5e-21
 Identities = 48/93 (51%), Positives = 66/93 (70%)
 Frame = +1

Query: 481 QNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL 660
           Q  ++    VPAYFN++QR AT+DA  I+G  VL+++NEP+AAA+AY  + +    R +L
Sbjct: 137 QKVSKAVVTVPAYFNNNQRAATRDAARIAGFEVLKLVNEPSAAALAYVRENRIKNGRVIL 196

Query: 661 IFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           I+DLGGGTFDVSI+  E+G  +V S  GDTH G
Sbjct: 197 IYDLGGGTFDVSIVRTENGTIKVLSVDGDTHLG 229



 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 29/58 (50%), Positives = 40/58 (68%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           VGIDLGTT SC+ V ++GK+E+I N +GNRTT SYV + +   L+G  AK   +  P+
Sbjct: 6   VGIDLGTTNSCIAVERNGKIEVIPNREGNRTTLSYVYYGEDSILVGKTAKYMASANPS 63



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 33/87 (37%), Positives = 51/87 (58%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           NP+N I++ KRLIG   +D  ++++ K   +E+V    G+  I+V    E     PEEV 
Sbjct: 61  NPSNGIYEIKRLIGCLHDDPDIESERKSLNYELVRGTNGEILIQVEQNSEKFHTLPEEVC 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + +L ++K  AE YLG+ V  AV+T P
Sbjct: 121 ARILHRLKIDAEMYLGQKVSKAVVTVP 147


>UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1;
           Neorickettsia sennetsu str. Miyayama|Rep: Putative
           chaperone protein HscA - Neorickettsia sennetsu (strain
           Miyayama)
          Length = 593

 Score =  103 bits (247), Expect = 5e-21
 Identities = 48/84 (57%), Positives = 64/84 (76%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+++ R A KDA TI+GLNV+R+++EPTAAA+ YG+D+K   E   +++DLGGGTF
Sbjct: 132 VPAYFDNASRTAIKDAATIAGLNVVRLLSEPTAAALFYGIDEK-KEEGRYIVYDLGGGTF 190

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL    GIF+V  T GD + G
Sbjct: 191 DVSILEFHKGIFKVSCTDGDDYLG 214



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = +3

Query: 66  KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           + K+ +   +GID GTT S V +F   K  +I  + G+   PS +   D + +IG  AK
Sbjct: 10  RQKLDREVIIGIDFGTTNSLVCIFDGSKCVVIPQEGGDVLLPSVIGVKDKDIIIGKEAK 68


>UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 586

 Score =  103 bits (247), Expect = 5e-21
 Identities = 48/84 (57%), Positives = 65/84 (77%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+D QR AT+DAG ++GL+V+RIINEPT+AAIAY  D        +L++DLGGGTF
Sbjct: 117 VPAYFDDRQRNATRDAGLLAGLDVVRIINEPTSAAIAY--DAGHPENHKLLVYDLGGGTF 174

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS++ +E+G+ EV ++ GDT  G
Sbjct: 175 DVSLVVVENGVVEVLASHGDTKLG 198



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +2

Query: 404 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           +K F PEE+SS +L  +K+ AE YLG  ++ AVIT P
Sbjct: 82  EKEFRPEEISSFILLTLKKHAEKYLGSEIKKAVITVP 118



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI-GDAAKNQVA*TP-T 266
           VGIDLGTT S + + ++GK ++I  D  +   PS V    T +LI G  AKNQ   +P +
Sbjct: 5   VGIDLGTTNSEISILENGKPKVIPVDD-DLIMPSCVGIDITGKLIVGKTAKNQAVSSPES 63

Query: 267 TQYSMP-NVSSDVSSKM 314
           T +S+   +  DV  ++
Sbjct: 64  TIFSIKRKMGEDVKVRL 80


>UniRef50_A2Y4X8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 391

 Score =  103 bits (247), Expect = 5e-21
 Identities = 53/96 (55%), Positives = 68/96 (70%), Gaps = 3/96 (3%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 433
           NP  TI+DAKRLIGR+F DA VQ DMK  PF VV   GKP ++V  K G+ + F PEEVS
Sbjct: 103 NPERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVS 162

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP--RTSMTLK 535
           +MVLT+MKETAEAYLG+       T+   +T++T++
Sbjct: 163 AMVLTRMKETAEAYLGEKKTQVFTTYKDRQTTVTIQ 198



 Score = 92.7 bits (220), Expect = 9e-18
 Identities = 44/58 (75%), Positives = 51/58 (87%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPS+VAFTD  ERLIG+AAKNQ A  P
Sbjct: 47  IGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP 104


>UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=1;
           Yersinia mollaretii ATCC 43969|Rep: COG0443: Molecular
           chaperone - Yersinia mollaretii ATCC 43969
          Length = 571

 Score =  102 bits (245), Expect = 8e-21
 Identities = 47/84 (55%), Positives = 64/84 (76%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFN+ QRQA K AG I+GLNV+R++NEPTAA++AYGL      ++  L FDLGGGTF
Sbjct: 126 VPAYFNNVQRQAVKTAGRIAGLNVIRLLNEPTAASLAYGL--LNNTQQKYLTFDLGGGTF 183

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS++ + +G+ EV+++ GD   G
Sbjct: 184 DVSVIDMFEGVIEVRASCGDIFLG 207



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 2/58 (3%)
 Frame = +3

Query: 75  MAKAPA-VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAK 242
           +A+A A +GIDLGT+ S V ++Q G+  ++ N +G+  TPS V   D  + ++G AAK
Sbjct: 6   VAQANALIGIDLGTSNSAVSLWQDGQAILLPNAEGDHLTPSVVGVDDHGQFIVGQAAK 63



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 16/32 (50%), Positives = 24/32 (75%)
 Frame = +2

Query: 419 PEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           PEE+S+++L ++K  AE YLG  V +A+IT P
Sbjct: 96  PEELSALLLQQLKADAERYLGYGVSDAIITVP 127


>UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep:
           Heat shock protein 70 - Frankia sp. (strain CcI3)
          Length = 556

 Score =  102 bits (244), Expect = 1e-20
 Identities = 46/84 (54%), Positives = 60/84 (71%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF D +R+ATK AG ++GLNV+ IINEPTAAA AYG  + G  E  VL++DLGGGTF
Sbjct: 126 VPAYFGDEERKATKLAGELAGLNVVDIINEPTAAAFAYGFGQDGAEESTVLVYDLGGGTF 185

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D +++ + +G   V +T GD   G
Sbjct: 186 DTTVIRLSEGAITVVATDGDHELG 209



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 29/69 (42%), Positives = 37/69 (53%), Gaps = 6/69 (8%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFT-----DTERLIGDA 236
           MA     GIDLGTTYSC+  V ++G+ E+I N +   TTPS V F       T  ++G  
Sbjct: 1   MAGTKVFGIDLGTTYSCIAQVDEYGRPEVIRNIESQPTTPSVVLFDTGAEGPTSFVVGTQ 60

Query: 237 AKNQVA*TP 263
           AK Q    P
Sbjct: 61  AKRQARIRP 69


>UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 623

 Score =  102 bits (244), Expect = 1e-20
 Identities = 45/84 (53%), Positives = 62/84 (73%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VP YFND+QR+A  DAG I+GL+V+RI++EP AAA+AYGLD   +  + V++FDLGG   
Sbjct: 179 VPVYFNDAQRRAISDAGDIAGLDVMRIVSEPIAAAVAYGLDNVRSNGKRVVVFDLGGENL 238

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+ L  +DG F+V +T GD + G
Sbjct: 239 DVTALVADDGFFDVLATNGDGYLG 262



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 38/87 (43%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV-AYKGEDKTFFPEEVS 433
           +P   + D  RL+G+K  D  VQ +M   P+ VV   GKP + V A  G+ +   PEE++
Sbjct: 94  SPGRAVHDFMRLLGKKLGDDDVQREMTRLPYAVVDMEGKPHVLVEAADGDVRVLSPEEIA 153

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMK+TAEA+LG+TV +AV+  P
Sbjct: 154 AAVLAKMKKTAEAHLGRTVSSAVVAVP 180



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/59 (57%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD--TERLIGDAAKNQVA*TP 263
           +GID+G TYSCV V+  G+VEII NDQG+R TPS+VAFTD     ++G+AAK Q   +P
Sbjct: 37  LGIDIGATYSCVAVYCKGRVEIIPNDQGSRLTPSWVAFTDGGGRLVVGEAAKEQAVGSP 95


>UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4;
           Planctomycetaceae|Rep: Chaperone protein HscC -
           Rhodopirellula baltica
          Length = 587

 Score =  101 bits (241), Expect = 3e-20
 Identities = 45/84 (53%), Positives = 64/84 (76%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND QR AT+ AG ++GLNV R+INEPTAAA+ YG   +   E+N+ + DLGGGTF
Sbjct: 131 VPAYFNDHQRTATRLAGEMAGLNVRRMINEPTAAALVYGFHAR-EDEKNLCVIDLGGGTF 189

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+++ + +G  E+++TAG++  G
Sbjct: 190 DVTVMEVFEGTLEIRATAGESMLG 213



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
 Frame = +3

Query: 57  TD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV-AFTDTERLIGD 233
           +D  +   +   +GIDLGTT+S V VF+ GK E+I+N  G + TPS V    D + ++G 
Sbjct: 6   SDSSFPTEEPVCIGIDLGTTHSLVSVFRDGKPELISNAHGEKLTPSIVGVLQDGQIVVGS 65

Query: 234 AAK 242
           AA+
Sbjct: 66  AAR 68



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = +2

Query: 278 DAKRLIGRKFEDATVQADMK-HWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKM 454
           D + ++G    +  V A  +  W F+    G + K+K+     DK F P E+SS+VL  +
Sbjct: 58  DGQIVVGSAARELRVTAPERCAWVFKRYM-GQERKLKLG----DKEFTPHELSSLVLQSL 112

Query: 455 KETAEAYLGKTVQNAVITFP 514
           ++ A A L   + +AVIT P
Sbjct: 113 RDDAAAQLNTEITDAVITVP 132


>UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus
           metalliredigens QYMF|Rep: 2-alkenal reductase -
           Alkaliphilus metalliredigens QYMF
          Length = 569

 Score =  101 bits (241), Expect = 3e-20
 Identities = 45/84 (53%), Positives = 65/84 (77%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF D QR+AT +AG ++GL V RIINEPTAAA+AYG+D     + ++L++DLGGGT 
Sbjct: 118 VPAYFTDEQRRATVEAGGLAGLKVERIINEPTAAALAYGIDHMDENQ-HILVYDLGGGTL 176

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV++L + +G+ EVK+++G+   G
Sbjct: 177 DVTVLEMFEGVLEVKASSGNNQLG 200



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVA*TP 263
           +GIDLGT+ S VG+F+ GK  +I N    + TPS V   +  +L IG  AK+Q+   P
Sbjct: 5   IGIDLGTSTSEVGIFETGKPIVIGNHLNEKITPSVVGLGEEGQLIIGRDAKDQMLFKP 62



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 22/50 (44%), Positives = 31/50 (62%)
 Frame = +2

Query: 365 GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           G + K+K+      K + P+E+SS +L  +KE AEAYL + V  AVIT P
Sbjct: 74  GSREKVKMG----GKEYRPQEMSSFILKYLKECAEAYLEEEVLRAVITVP 119


>UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1;
           Methanospirillum hungatei JF-1|Rep: Heat shock protein
           70 - Methanospirillum hungatei (strain JF-1 / DSM 864)
          Length = 571

 Score =  101 bits (241), Expect = 3e-20
 Identities = 46/84 (54%), Positives = 64/84 (76%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA ++DSQRQA  DA  I+G+NV+R+INEPTAAA+AYG+  +   +R VL++D GGGTF
Sbjct: 119 VPANYSDSQRQAIMDAAEIAGINVVRLINEPTAAALAYGI--REDRDRKVLVYDFGGGTF 176

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL++  G F+V ++ G+   G
Sbjct: 177 DVSILSVSSGFFDVDASTGEHRLG 200



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 2/55 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK-NQV 251
           +GID GTT S +      +  +I NDQG++ TPS V F  + E  IG+ AK NQ+
Sbjct: 6   IGIDFGTTNSKMAYMLLDEPVVIENDQGSKITPSVVYFKNEKEFSIGEQAKHNQI 60


>UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma
           marginale str. St. Maries|Rep: Heat shock protein -
           Anaplasma marginale (strain St. Maries)
          Length = 602

 Score =   99 bits (238), Expect = 6e-20
 Identities = 44/98 (44%), Positives = 71/98 (72%)
 Frame = +1

Query: 466 RSLSWQNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG 645
           +S + Q+       VPAYF++  R+AT+DA  ++G+ VLR++NEPTA+A++Y +++ G  
Sbjct: 133 KSCTGQDVTHAVITVPAYFDEIARKATRDAARMAGIEVLRLLNEPTASALSYKVEQAGDA 192

Query: 646 ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           E  V ++D GGGTFDVS+L + +G+F+V +T GDT+ G
Sbjct: 193 EVCV-VYDFGGGTFDVSVLRLHNGVFQVLATGGDTNLG 229



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 3/94 (3%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           A GIDLGTT S + V  H G V++  +  G    PS V +T D    +G  A N +    
Sbjct: 17  AFGIDLGTTNSLIAVVGHDGGVKVFEDPAGRSLIPSIVEYTRDGVVKVGHDA-NPLRALR 75

Query: 264 TTQYSMPNVSSDV-SSKMLLCKPT*STGLSRLSV 362
           +T+  M  ++ DV  S+      T   G + LS+
Sbjct: 76  STKRLMGKLAKDVHHSQFCGATVTDKNGSAALSI 109


>UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter
           usitatus Ellin6076|Rep: Heat shock protein 70 -
           Solibacter usitatus (strain Ellin6076)
          Length = 619

 Score =   99 bits (238), Expect = 6e-20
 Identities = 48/85 (56%), Positives = 66/85 (77%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERN-VLIFDLGGGT 684
           VPAYF+D+QR AT++AG ++GL V+RI+NEPTAA++AYG      G R+ V+++DLGGGT
Sbjct: 118 VPAYFSDAQRNATREAGMLAGLEVVRILNEPTAASLAYGF---ADGSRHTVMVYDLGGGT 174

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FDVSI+TIE  + EV S+ G+   G
Sbjct: 175 FDVSIVTIEGEVTEVLSSHGNNRLG 199



 Score = 39.9 bits (89), Expect = 0.067
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 248
           VGIDLGTT S V  F +G+V ++     ++  PS V  + + E ++G+AA NQ
Sbjct: 6   VGIDLGTTNSEVAAFLNGRVRVL-GPNASKMLPSCVGISPSGELMVGEAALNQ 57



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +2

Query: 407 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           K F P E+S+++L ++   AE  LG+ V+ AVIT P
Sbjct: 84  KGFSPAEISALILKELAAWAERDLGRPVERAVITVP 119


>UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshimeri
           serovar 6b str. SLCC5334|Rep: Complete genome - Listeria
           welshimeri serovar 6b (strain ATCC 35897 / DSM 20650
           /SLCC5334)
          Length = 561

 Score =   99 bits (238), Expect = 6e-20
 Identities = 46/93 (49%), Positives = 67/93 (72%)
 Frame = +1

Query: 481 QNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL 660
           + C E    VPAYFN+SQR+AT DA  ++GL V R+I+EPTAAAIAYG+ ++   +  ++
Sbjct: 108 ETCTEAVISVPAYFNNSQRKATIDAAFLAGLKVERLISEPTAAAIAYGIHQQ--NDTTLM 165

Query: 661 IFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           + D+GGGTFDVSIL + DG+ +V +  G+ + G
Sbjct: 166 VIDIGGGTFDVSILEMFDGVMQVIAIGGNNYLG 198



 Score = 37.1 bits (82), Expect = 0.47
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*TP 263
           +GIDLGT+ S V  ++  K  +I N  G+  TPS V   +  E LIG  A+ ++   P
Sbjct: 4   LGIDLGTSNSLVAYWKEDKAVLIPNVFGDVLTPSVVGIDENDELLIGKIARERLTSHP 61



 Score = 36.3 bits (80), Expect = 0.82
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +2

Query: 383 KVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           K  Y GE K F   ++SS VL  +K  AE +LG+T   AVI+ P
Sbjct: 76  KCYYLGEQK-FSATDLSSFVLKSLKADAENFLGETCTEAVISVP 118


>UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2;
           Anaeromyxobacter dehalogenans 2CP-C|Rep: Conserved
           region 2266 - Anaeromyxobacter dehalogenans (strain
           2CP-C)
          Length = 782

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 45/84 (53%), Positives = 61/84 (72%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAY+N+ QR A + AG ++GL V RI+NEPTAAA+AY   +    ++ VL++DLGGGTF
Sbjct: 366 VPAYYNERQRAAVRHAGALAGLKVERILNEPTAAALAYAFGRH--LDQRVLVYDLGGGTF 423

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D S+L + D ++EV ST GDT  G
Sbjct: 424 DASVLELNDNVYEVVSTGGDTFLG 447



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 33/86 (38%), Positives = 51/86 (59%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP  T++ AKRL+GR F+   VQ     + +E+V+    P    A +   +T   E+VS+
Sbjct: 285 NPRATVWGAKRLVGRAFDSPVVQEIKGKFAYEIVAG---PDGLAAVRLGPETLTLEQVSA 341

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           +VL ++KE A+ +LG+ V  AVIT P
Sbjct: 342 LVLAEVKEVAQNHLGEEVNRAVITVP 367



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVA*TP 263
           +GIDLGT+ SC  V + G+  +I + +G  T PS VA     R+ +G  A+ Q+   P
Sbjct: 229 IGIDLGTSNSCAAVVRDGRPYVIPSREGYNTVPSIVALNARNRIVVGHLARAQLLTNP 286


>UniRef50_Q4P628 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 225

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 46/58 (79%), Positives = 52/58 (89%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           A+GIDLGTTYSCVG + + +VEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQ A  P
Sbjct: 18  AIGIDLGTTYSCVGWWVNERVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQAAMNP 75



 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 46/87 (52%), Positives = 56/87 (64%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP  T+FDAKRLIGR+++D                D G P I+V Y GE K F P+E+S
Sbjct: 73  MNPKQTVFDAKRLIGRRYDDP---------------DDGSPFIEVNYLGETKQFSPQEIS 117

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKE AEA +GK V+ AVIT P
Sbjct: 118 SMVLTKMKEIAEAKIGKEVKKAVITVP 144



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 24/44 (54%), Positives = 28/44 (63%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG 639
           VPAYFNDSQR ATKDAGT     +L I +   AA+ A G +  G
Sbjct: 143 VPAYFNDSQRLATKDAGTYC-FPLLNITSTCAAASAATGKNNGG 185


>UniRef50_Q64YI6 Cluster: Chaperone protein DnaK; n=2; Bacteroides
           fragilis|Rep: Chaperone protein DnaK - Bacteroides
           fragilis
          Length = 529

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 46/83 (55%), Positives = 60/83 (72%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFD 690
           PAYF   +R  TK AG I+GLNVL IINEPTAAAI+YG+  K   ++ VL++DLGGGTFD
Sbjct: 129 PAYFGTKERMQTKQAGEIAGLNVLSIINEPTAAAISYGV--KTDQKKTVLVYDLGGGTFD 186

Query: 691 VSILTIEDGIFEVKSTAGDTHFG 759
           V+++ +  G  +V +T GD H G
Sbjct: 187 VTLINVNGGAIKVIATGGDHHLG 209



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 2/59 (3%)
 Frame = +3

Query: 96  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVA*TPT 266
           GIDLGTTYSC+  V +  +  ++ N +G+ TTPS V F D +  ++G  AK  +A  PT
Sbjct: 9   GIDLGTTYSCIAQVDKFDQAIVLRNFEGDATTPSAVYFEDMDHVVVGKEAKGMLATEPT 67


>UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera
           aphidicola (Baizongia pistaciae)|Rep: Chaperone protein
           hscA - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 511

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 46/84 (54%), Positives = 63/84 (75%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA+FND QRQ  K +  ++ LN++R++NEPT+AAIAYGL       + V I+DLGGGTF
Sbjct: 156 VPAHFNDLQRQEIKKSAELANLNIIRLLNEPTSAAIAYGLHL--NKNKIVAIYDLGGGTF 213

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL +  GIFEV +T+G+T+ G
Sbjct: 214 DISILKLNQGIFEVLATSGNTNLG 237



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 1/59 (1%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRT-TPSYVAFTDTERLIGDAAKNQVA*TP 263
           ++GID GTTYS V       + II  DQ NR   PS + +T  + ++G  A+ Q    P
Sbjct: 21  SIGIDFGTTYSLVASALEDNIYIIL-DQNNRALLPSIINYTSKKPIVGWEAQKQAINDP 78


>UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: DnaK
           protein - Clostridium perfringens
          Length = 575

 Score = 98.3 bits (234), Expect = 2e-19
 Identities = 46/84 (54%), Positives = 63/84 (75%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA FND QR+ATK+AG I+G  V RIINEPTAAA+AYG+D       N++++D GGGTF
Sbjct: 119 VPANFNDIQRKATKNAGEIAGFKVERIINEPTAAAMAYGVDNLDK-NGNIIVYDFGGGTF 177

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+IL + +G+ +VK + G+ + G
Sbjct: 178 DVTILEMFNGVLDVKVSRGNNYLG 201



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/50 (42%), Positives = 33/50 (66%)
 Frame = +2

Query: 401 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQK 550
           + K + PEE+S+++L K+KE AE +LG+ V+ AVIT P     ++ K  K
Sbjct: 83  QGKEYRPEEISALILKKLKEVAEYFLGEEVEEAVITVPANFNDIQRKATK 132



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 2/59 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIAN-DQGN-RTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +GIDLGTT S +   + GK  II N ++G+    PS V+    E  +G  AKNQ+   P
Sbjct: 5   IGIDLGTTTSEIAYVKDGKPCIIRNIEEGDEHAIPSVVSIEGDEIKVGKKAKNQILLKP 63


>UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2;
           Pansporablastina|Rep: Mitochondrial-like Hsp70 -
           Trachipleistophora hominis
          Length = 543

 Score = 98.3 bits (234), Expect = 2e-19
 Identities = 47/84 (55%), Positives = 64/84 (76%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFN +QR+ TK AG ++GL VLR++NEPT+AA+ + +    TG  ++ ++DLGGGTF
Sbjct: 140 VPAYFNHTQREETKKAGELAGLKVLRVLNEPTSAALNHAI----TG--HIAVYDLGGGTF 193

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SIL   D IFEVK+TAGD+  G
Sbjct: 194 DISILEKSDNIFEVKATAGDSFLG 217



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 40/86 (46%), Positives = 58/86 (67%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           +P +TIF+ KRLIGRK+ D  V+   K  PF V+ D G+ KIKV    +DK + P ++SS
Sbjct: 62  DPEHTIFNVKRLIGRKYAD--VKEYTKRLPFSVIDDNGELKIKV----DDKRYEPAKLSS 115

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            VL+K++  AE++L + V+ AVIT P
Sbjct: 116 FVLSKLRSAAESFLSRPVKFAVITVP 141



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 38/118 (32%), Positives = 59/118 (50%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M+K   VGIDLGTT SC+ + Q     II N +G RTTPS +  +    ++G  A+ ++ 
Sbjct: 1   MSKPAIVGIDLGTTNSCISIMQDNVATIIENQEGQRTTPSVINISGENVIVGKPAQRKLL 60

Query: 255 *TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK 428
             P  ++++ NV   +  K    K    T     SV++ N   +  I+V  K + P K
Sbjct: 61  TDP--EHTIFNVKRLIGRKYADVKE--YTKRLPFSVIDDNGELK--IKVDDKRYEPAK 112


>UniRef50_Q1CY00 Cluster: DnaK family protein; n=2;
           Cystobacterineae|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 1146

 Score = 97.5 bits (232), Expect = 3e-19
 Identities = 44/84 (52%), Positives = 63/84 (75%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAY+++ QR+A + +G ++GL V RI+NEPT+AA+AYGL+++    + VL++DLGGGTF
Sbjct: 743 VPAYYSEPQREAVRKSGILAGLKVERILNEPTSAALAYGLNRE--LNKKVLVYDLGGGTF 800

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D +IL IE  +FEV  T GD   G
Sbjct: 801 DATILKIEKNVFEVLGTGGDVFLG 824



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 31/88 (35%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEV 430
           + P +TI+ AKRL+GR ++ A V    + + +++V D  G+  +++A    D     EEV
Sbjct: 661 LRPQHTIYGAKRLVGRPYDSAVVNQVRERFHYDIVPDSAGRAAVRLA----DTALSLEEV 716

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
            +++L + KE AEA+L + V+ AV+T P
Sbjct: 717 QALILRECKEMAEAHLNQKVERAVVTVP 744



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVA*TP 263
           P +GIDLGTT SCV +  +G+  ++ + +G  T PS ++     + L+   AKNQ+   P
Sbjct: 604 PVIGIDLGTTNSCVALLSNGRPLVLRSREGYNTIPSVISLNAQNKLLVSHRAKNQLVLRP 663


>UniRef50_A6C7U8 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Planctomyces maris DSM 8797|Rep: DnaK protein (Heat
           shock protein), C-terminal region has VWA type A domain
           - Planctomyces maris DSM 8797
          Length = 715

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 44/84 (52%), Positives = 62/84 (73%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           +PAYF D++R+AT +AG  +GLN+L++INEPTAAAIAYG+  +     NVL++DLGGGTF
Sbjct: 119 IPAYFYDAERKATIEAGRQAGLNILQLINEPTAAAIAYGVTAQPKSTSNVLVYDLGGGTF 178

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV++L I +    V ++ GD   G
Sbjct: 179 DVTLLRITEDETRVLTSEGDAELG 202



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/51 (45%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           +GIDLGTT S V  V    +VE++ N+ G   TPS V F +   ++GD AK
Sbjct: 5   IGIDLGTTNSVVATVGCSERVEVLPNEHGKSITPSVVLFENGSVVVGDEAK 55


>UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera
           aphidicola str. Cc (Cinara cedri)|Rep: Molecular
           chaperone - Buchnera aphidicola subsp. Cinara cedri
          Length = 499

 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 47/84 (55%), Positives = 59/84 (70%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           +PAYFN+ Q+   + A     L +LR++NEPTAAAIAYGL+KK  G   + ++DLGGGTF
Sbjct: 140 IPAYFNNIQKNIVRKAAETVNLKILRLLNEPTAAAIAYGLEKKKKG--IICVYDLGGGTF 197

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL I  GIFEV ST G+   G
Sbjct: 198 DVSILKISKGIFEVLSTNGNCKLG 221



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 18/52 (34%), Positives = 26/52 (50%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIG 230
           M K   +GID GTT S V      K++II N    +  PS +  ++ +  IG
Sbjct: 1   MKKKTIIGIDFGTTNSLVSTILEKKIKIINNFNKKKFFPSIIHISNKKISIG 52


>UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena CCY
           9414|Rep: DnaK protein - Nodularia spumigena CCY 9414
          Length = 578

 Score = 96.3 bits (229), Expect = 7e-19
 Identities = 44/84 (52%), Positives = 63/84 (75%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F D+ R+AT +AG I+GLNVLR++NEPTAAA+A+G+ K    E  +++FD GGGT 
Sbjct: 120 VPANFPDAARKATFNAGEIAGLNVLRLLNEPTAAALAFGI-KNIASEEQLVVFDFGGGTL 178

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+S+L + +G+ +VKS+ GD   G
Sbjct: 179 DISVLEMFEGVLDVKSSFGDPQLG 202



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 15/37 (40%), Positives = 27/37 (72%)
 Frame = +2

Query: 404 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           ++ + PEE+++++L K+KE AE  LG  +Q+ VI+ P
Sbjct: 85  EQDYRPEEIAALILRKLKENAEEALGHPIQDVVISVP 121


>UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 759

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 44/84 (52%), Positives = 59/84 (70%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAY+N+ QR A + A  ++GL V RI+NEPTAAA+AY   +     + VL++DLGGGTF
Sbjct: 331 VPAYYNERQRAAVRHAAALAGLQVERILNEPTAAALAYAYGRH--LNQRVLVYDLGGGTF 388

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D S+L + D ++EV ST GDT  G
Sbjct: 389 DASVLELSDNVYEVVSTGGDTFLG 412



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 42/130 (32%), Positives = 69/130 (53%), Gaps = 1/130 (0%)
 Frame = +2

Query: 128 WCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCRQEPGGVNPNNTIFDAKRLIGRKF 307
           + +P+REG  H   P     S++    RHR       +     NP  T+  AKRLIGR +
Sbjct: 214 YVIPSREG--HNTVP-----SIVALNARHRVVVGHLAKAQLLTNPKATVSGAKRLIGRAW 266

Query: 308 EDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGK 484
           +   VQ     +P+E+V  D G   +++   GE+ T   E++S++VL ++++ A+ +L +
Sbjct: 267 DTPVVQEIRAKFPYEIVPGDDGVAAVRL---GEE-TVTLEQISALVLREVRDVAQNHLRE 322

Query: 485 TVQNAVITFP 514
            V  AVIT P
Sbjct: 323 EVNRAVITVP 332



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVA*TPTT 269
           VGIDLGTT SC  V + G+  +I + +G+ T PS VA     R ++G  AK Q+   P  
Sbjct: 194 VGIDLGTTNSCAAVVKDGRPYVIPSREGHNTVPSIVALNARHRVVVGHLAKAQLLTNPKA 253

Query: 270 QYS 278
             S
Sbjct: 254 TVS 256


>UniRef50_UPI0000510557 Cluster: COG0443: Molecular chaperone; n=1;
           Brevibacterium linens BL2|Rep: COG0443: Molecular
           chaperone - Brevibacterium linens BL2
          Length = 340

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 48/85 (56%), Positives = 62/85 (72%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF + +R AT+DA  ++GL +LRIINEPTAAAIA+G    G+   NVL+FDLGGGTF
Sbjct: 124 VPAYFGELERSATRDAAEMAGLPLLRIINEPTAAAIAHGFG-GGSRSENVLVFDLGGGTF 182

Query: 688 DVSILTIE-DGIFEVKSTAGDTHFG 759
           DV+I+ +E DG   V +T G+   G
Sbjct: 183 DVTIMRVESDGEMTVLATGGNHKLG 207



 Score = 39.9 bits (89), Expect = 0.067
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = +2

Query: 389 AYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           A+  + K + PEE+SS+VL K+K+ AE  L + V  A++T P
Sbjct: 84  AFAVDGKVWRPEELSSLVLKKLKQIAEENLSEPVTGAIVTVP 125



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 24/59 (40%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQ-HGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVA*TP 263
           +GIDLGTT S V      G    IA   G+RT PS V F  ++ + IG  AK+     P
Sbjct: 4   IGIDLGTTNSAVAATDAMGITTTIAARDGSRTLPSAVYFEPSDEVSIGARAKSMAVMEP 62


>UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Clostridium acetobutylicum|Rep: DnaK protein (Heat shock
           protein), C-terminal region has VWA type A domain -
           Clostridium acetobutylicum
          Length = 698

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 47/85 (55%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 684
           VPAYFN+ QRQ+T +AG  +  NVL I+NEPTAAA+AYG+  K +GE +N+L++DLGGGT
Sbjct: 119 VPAYFNNIQRQSTINAGKRAEFNVLSILNEPTAAAMAYGM--KASGENKNILVYDLGGGT 176

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FDV+++ I + + +V ST GD   G
Sbjct: 177 FDVTLVHIGEELIKVLSTDGDHELG 201



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 1/56 (1%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVF-QHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           ++GIDLGTT+S V +  ++G  +++ N +GN  TPS + F+  E ++GD AK   A
Sbjct: 4   SLGIDLGTTFSVVSIIDENGAPKVLKNKEGNTLTPSVIYFSGEEIIVGDDAKEMQA 59



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 16/38 (42%), Positives = 27/38 (71%)
 Frame = +2

Query: 401 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           ++K +  E++S +VL K+K+ AE +L   V++AVIT P
Sbjct: 83  QNKYYNAEDLSVIVLKKLKKDAEDFLKAEVKDAVITVP 120


>UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           Molecular chaperone DnaK - Syntrophomonas wolfei subsp.
           wolfei (strain Goettingen)
          Length = 498

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 41/84 (48%), Positives = 63/84 (75%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQAT  AG ++GL +L+++NEPTAAA+AY  ++    + ++L+ D+GGGTF
Sbjct: 117 VPAYFNDNQRQATYMAGELAGLKILQLLNEPTAAALAYASEQ--AEKEHILVLDIGGGTF 174

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D++++  E G+  VK+T G +  G
Sbjct: 175 DITLMEYEKGLCRVKATGGSSSLG 198



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 28/54 (51%), Positives = 37/54 (68%), Gaps = 2/54 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQ 248
           VGIDLGTT S V  + + GK EII N++G R TPS + F  + E L+G+ A+NQ
Sbjct: 3   VGIDLGTTNSLVAFINREGKAEIIINERGGRLTPSVIYFKNEQEVLVGEVARNQ 56



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 14/36 (38%), Positives = 27/36 (75%)
 Frame = +2

Query: 407 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           +T+ P E+S+++L K+ + A+ YLG+ ++ AV+T P
Sbjct: 83  RTYSPVEISALILRKLSDYAKEYLGQEIEAAVVTVP 118


>UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to heat shock protein - Nasonia vitripennis
          Length = 523

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 49/84 (58%), Positives = 63/84 (75%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA FN  QR+ATK AG ++ LNV  II+EP AAA+AYGL+ K      VLIFDLGGGTF
Sbjct: 157 VPANFNTIQREATKFAGEMAVLNV-SIISEPIAAALAYGLNHKINYNDYVLIFDLGGGTF 215

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS++T+++ I  V++T+GD H G
Sbjct: 216 DVSVVTMQNDILIVEATSGDQHLG 239



 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 43/101 (42%), Positives = 66/101 (65%)
 Frame = +2

Query: 248 GGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEE 427
           G  N  NTI+ +KRLIGR+F D  V+A+ +HWPF VV   G+P  +V +K E K + P++
Sbjct: 71  GQRNSKNTIYSSKRLIGREF-DNEVKAESEHWPFAVVDKEGRPFYEVNHKSEIKYYSPQD 129

Query: 428 VSSMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQK 550
           ++SM+L  +K+ AE+YL K + + VIT P    T++ +  K
Sbjct: 130 IASMILEYVKQFAESYLTKKITDVVITVPANFNTIQREATK 170



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 12/70 (17%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVF------------QHGKVEIIANDQGNRTTPSYVAFTDTE 218
           M++ P++GIDLGTT + +  +              G V IIAN +G+RTTPS VAF + E
Sbjct: 1   MSEVPSIGIDLGTTNTVIAAWIPETNKDLNSTKSSGTVNIIANSKGHRTTPSCVAFNEKE 60

Query: 219 RLIGDAAKNQ 248
           RLIG +A +Q
Sbjct: 61  RLIGTSALSQ 70


>UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacifica
           SIR-1|Rep: Chaperone DnaK - Plesiocystis pacifica SIR-1
          Length = 539

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 45/84 (53%), Positives = 61/84 (72%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F DSQR AT+ A  ++GL+V+R+INEPTAAA+AYG  +    +R + ++D GGGTF
Sbjct: 144 VPANFTDSQRSATRIAARLAGLDVIRVINEPTAAALAYGYIE--DMDRRIAVYDFGGGTF 201

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+IL I   +FEV ST+G+   G
Sbjct: 202 DVTILQITRNVFEVLSTSGEMFLG 225



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 30/87 (34%), Positives = 47/87 (54%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           V+P   ++ AKRLIGR+F    VQ   +  P+ +V +G    + +   G   +    E+S
Sbjct: 62  VDPTQVVYSAKRLIGRRFSSPEVQRHRETVPYRIV-EGPNESVMIELGGRRLSIV--EIS 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           S +L  +K+ AE  LG+ V+ AVI  P
Sbjct: 119 SQILRYLKDMAEEALGQRVKKAVIAVP 145



 Score = 33.5 bits (73), Expect = 5.8
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV-AFTDTERLIGDAAKNQVA*TPT 266
           +GIDLGTT S   V + G+  ++     +R  PS V A ++ +  +G+ AK   +  PT
Sbjct: 8   LGIDLGTTNSACAVVRDGRASVVRRGD-DRIVPSVVAALSNGQFAVGNEAKQLRSVDPT 65


>UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14;
           Rickettsia|Rep: Chaperone protein hscA homolog -
           Rickettsia felis (Rickettsia azadi)
          Length = 637

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 49/92 (53%), Positives = 61/92 (66%)
 Frame = +1

Query: 484 NCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLI 663
           N  +    VPA+FND+ R     A  I+G  VLR+I EPTAAA AYGL+K   G    L+
Sbjct: 140 NITKAVITVPAHFNDAARGEVMLAAKIAGFEVLRLIAEPTAAAYAYGLNKNQKG--CYLV 197

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +DLGGGTFDVSIL I++GIF+V +T GD   G
Sbjct: 198 YDLGGGTFDVSILNIQEGIFQVIATNGDNMLG 229



 Score = 39.5 bits (88), Expect = 0.088
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +3

Query: 69  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD 233
           +K  +  AVGID GTT S + +  + KV++I +       P+ + FT+   +IG+
Sbjct: 14  FKQERQIAVGIDFGTTNSLIAIATNRKVKVIKSRDDKELIPTTIDFTNENFIIGN 68


>UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;
           Orientia tsutsugamushi Boryong|Rep: Heat shock chaperone
           protein hscA - Orientia tsutsugamushi (strain Boryong)
           (Rickettsia tsutsugamushi)
          Length = 616

 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 45/84 (53%), Positives = 61/84 (72%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA+F+D+ R + K A  I+ L+VLR+I+EPTAAA +YGLDK   G    L++D GGGTF
Sbjct: 153 VPAHFDDAARNSIKQAAKIADLDVLRLISEPTAAAYSYGLDKGSNGV--YLVYDFGGGTF 210

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L I++ IF+V +T GD   G
Sbjct: 211 DVSLLKIKNKIFQVIATGGDNQLG 234



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 21/52 (40%), Positives = 27/52 (51%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VGID GTT S V    + K  +IAN QG    PS V+F     +I   +K +
Sbjct: 21  VGIDFGTTNSLVAHSINSKAYVIANSQGLNKLPSIVSFNHEGNVISIGSKEK 72



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +2

Query: 272 IFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVSSMVLT 448
           I   KRL+G+  E+    + +     E+ V +     +K+A    DKT  P E+S+ ++ 
Sbjct: 77  ITSVKRLLGKSTEEILNSSAIGQEIKELLVKNTNITSLKIA----DKTISPIEISAKIIN 132

Query: 449 KMKETAEAYLGKTVQNAVITFP 514
           ++K  AE Y  + ++ AVI+ P
Sbjct: 133 QLKLQAEQYFNQKIKKAVISVP 154


>UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 545

 Score = 92.7 bits (220), Expect = 9e-18
 Identities = 46/83 (55%), Positives = 57/83 (68%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFD 690
           PAYF D +R ATK+AG I+G NVL +I+EP AAA++YGLDK    ++NV +FDLGGGTFD
Sbjct: 152 PAYFGDPERAATKEAGVIAGFNVLAVIDEPVAAALSYGLDKL-KQDQNVFVFDLGGGTFD 210

Query: 691 VSILTIEDGIFEVKSTAGDTHFG 759
           V IL I+ G        GD   G
Sbjct: 211 VVILEIKGGKIREVVVNGDHLLG 233



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 26/62 (41%), Positives = 35/62 (56%), Gaps = 4/62 (6%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQH--GKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAK-NQ 248
           K   VGIDLGTT+S +       GK EII + + +R TPS V      + ++G+ AK N 
Sbjct: 17  KTTVVGIDLGTTFSAIAHINEDTGKAEIIPSPEQDRITPSVVLIEKVNDIIVGEIAKQNA 76

Query: 249 VA 254
           VA
Sbjct: 77  VA 78



 Score = 37.1 bits (82), Expect = 0.47
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +2

Query: 389 AYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           +++ E K +  +E+S+ +L K+K  AE  LG  + +AVIT P
Sbjct: 111 SFEHEGKKYSAQEISAFILKKLKNDAEERLGTMITDAVITCP 152


>UniRef50_Q010Y3 Cluster: DNAK_GLOVI Chaperone protein dnaK; n=1;
           Ostreococcus tauri|Rep: DNAK_GLOVI Chaperone protein
           dnaK - Ostreococcus tauri
          Length = 412

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 41/84 (48%), Positives = 60/84 (71%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           +PAYF+D+Q++AT  AG ++GL  ++++ EP AAA+AYG+D +   +  V +FDLGGGTF
Sbjct: 187 IPAYFDDAQQEATIRAGQLAGLTTVKLLKEPVAAALAYGIDVE--EDETVFVFDLGGGTF 244

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L +  G  EV +T GD   G
Sbjct: 245 DVSVLEVGGGTVEVLATGGDPQLG 268



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 3/112 (2%)
 Frame = +2

Query: 188 SVLCCVHRHRASHRRCRQEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG 367
           SV+C       S  R  +     +  NT+  AKR IG+K++     A  K +P+ VV+  
Sbjct: 79  SVVCFASDGSFSVGREARRMQRTDARNTVHSAKRFIGKKYKKTKKIA--KDFPYRVVNHP 136

Query: 368 GKPKIKVAYKGED---KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
                 +A +GE+   +   PEEVS+ VL  + + AE  LG ++  AVIT P
Sbjct: 137 ETKYASIAIEGENGETRLVAPEEVSACVLRTLLDAAEKELGTSIDKAVITIP 188



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 2/57 (3%)
 Frame = +3

Query: 78  AKAPAV-GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK 242
           A+A  + GIDLGTT S V + + GK EI+A  QG+RT PS V F +D    +G  A+
Sbjct: 41  ARASGICGIDLGTTNSAVAIVRDGKAEIVA-CQGHRTIPSVVCFASDGSFSVGREAR 96


>UniRef50_A6EQS3 Cluster: Heat shock protein Hsp70; n=1;
           unidentified eubacterium SCB49|Rep: Heat shock protein
           Hsp70 - unidentified eubacterium SCB49
          Length = 730

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 44/85 (51%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 684
           VPAYF + Q+ AT+ A  ++GL V +++ EPTAAAIAYG+D    G+ + VLI+D GGGT
Sbjct: 145 VPAYFTEKQKNATRIAAQLAGLKVQKLLAEPTAAAIAYGVDNLKVGDAKTVLIYDFGGGT 204

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FD+SIL I DG +    T GD   G
Sbjct: 205 FDLSILNIVDGQYMEAGTGGDRWLG 229



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 33/88 (37%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQ--ADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEV 430
           +P NTI   KRL+G   +D  VQ   +  ++ F +    G     VA     K + PE++
Sbjct: 59  DPINTILSVKRLMGGAIKDKMVQDMIESSYYKFGIAPLKGGTDDAVAVILGGKQYTPEQL 118

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SS +L K+K+ AE  LG  V +AVIT P
Sbjct: 119 SSEILKKIKKDAEEKLGDEVTHAVITVP 146



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           A+GIDLGT+ S +  F+   V+II N +    T S +     E L+G  A
Sbjct: 4   AIGIDLGTSNSVI-AFKDTSVKIIRNKENEELTRSCIGLRKEEILVGRTA 52


>UniRef50_A6C7U7 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=1; Planctomyces maris DSM 8797|Rep:
           DnaK protein (Heat shock protein), HSP70/DnaK family -
           Planctomyces maris DSM 8797
          Length = 557

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 43/83 (51%), Positives = 59/83 (71%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFD 690
           PAYF   Q++ATK AG I+GLNV  +I EPTAAAIAYG +++   +  VL++DLGGGTFD
Sbjct: 123 PAYFGSRQKEATKKAGEIAGLNVRYVIPEPTAAAIAYGEEQE--NDDTVLVYDLGGGTFD 180

Query: 691 VSILTIEDGIFEVKSTAGDTHFG 759
           ++++ ++ G   V ST GD   G
Sbjct: 181 ITLVDVKKGALTVLSTDGDAELG 203



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 2/54 (3%)
 Frame = +3

Query: 96  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQV 251
           GIDLGTTYSC+  + +HG+  ++ N++G+ TTPS V F D E  ++G AAK+ +
Sbjct: 8   GIDLGTTYSCISYIDEHGQPVVVQNNEGDLTTPSVVFFEDMENVVVGKAAKDAI 61



 Score = 36.7 bits (81), Expect = 0.62
 Identities = 23/75 (30%), Positives = 39/75 (52%)
 Frame = +2

Query: 290 LIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAE 469
           ++G+  +DA ++ D      +V  + G    +    G  K + PEEVS+++L K+ + A 
Sbjct: 52  VVGKAAKDA-IRTDADRVVSKVKREMGNSDWRFDLDG--KEYRPEEVSALILKKIVDDAT 108

Query: 470 AYLGKTVQNAVITFP 514
              GKT+   VIT P
Sbjct: 109 LTTGKTISEVVITCP 123


>UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 527

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 48/92 (52%), Positives = 62/92 (67%), Gaps = 8/92 (8%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG--LDKKGT------GERNVLI 663
           VP YFND +R+AT+DAG I+GLNV+ IINEPTAA +AY    D+ G       G+R +L+
Sbjct: 124 VPYYFNDVRRKATQDAGRIAGLNVIDIINEPTAATLAYAWKRDELGNPDAMPDGDRTILV 183

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +DLGGGTFDV+I+      F V +T GD   G
Sbjct: 184 YDLGGGTFDVTIVRYSPTQFRVLATDGDVMLG 215


>UniRef50_P77319 Cluster: Chaperone protein hscC; n=19;
           Gammaproteobacteria|Rep: Chaperone protein hscC -
           Escherichia coli (strain K12)
          Length = 556

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 44/84 (52%), Positives = 59/84 (70%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+D QR+ T+ A  ++GLN +R+INEPTAAA+AYGL  +       L+FDLGGGTF
Sbjct: 121 VPAYFSDEQRKHTRLAAELAGLNAVRLINEPTAAAMAYGLHTQ--QNTRSLVFDLGGGTF 178

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV++L     + EV ++AGD   G
Sbjct: 179 DVTVLEYATPVIEVHASAGDNFLG 202



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 17/46 (36%), Positives = 28/46 (60%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI 227
           A+GIDLGTT S + V++ G  ++I N  G   TPS ++  +   ++
Sbjct: 7   AIGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISMDENNHIL 52


>UniRef50_A5MZQ7 Cluster: DnaK9; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK9 - Clostridium kluyveri DSM 555
          Length = 540

 Score = 90.6 bits (215), Expect = 4e-17
 Identities = 41/84 (48%), Positives = 62/84 (73%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF   QR+ATK A   +GLNVLR++ EPTAAA+ YG+D++   ++ ++++DLGGGTF
Sbjct: 116 VPAYFTSEQREATKRAAERAGLNVLRLMPEPTAAALDYGIDQQ--RDQIIMVYDLGGGTF 173

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+SI+ ++   FEV +  G++  G
Sbjct: 174 DISIMKVDKNEFEVLAVDGNSRLG 197



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/59 (40%), Positives = 34/59 (57%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPTT 269
           VGIDLGTT S V   + G+ E+I  D G    PS ++  D E ++G  AK ++  +P T
Sbjct: 5   VGIDLGTTNSVVSYLKRGRAEVIPID-GKNIFPSVLSIRDGEIIVGSQAKARMMLSPET 62


>UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=2; Bacteria|Rep: DnaK protein (Heat
           shock protein), HSP70/DnaK family - Clostridium
           acetobutylicum
          Length = 551

 Score = 90.2 bits (214), Expect = 5e-17
 Identities = 44/83 (53%), Positives = 61/83 (73%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFD 690
           PAYF  ++R+ATK AG I+GLNV  IINEPTAAA+AYG+D     ++ VL++DLGGGTFD
Sbjct: 120 PAYFGINEREATKLAGEIAGLNVKAIINEPTAAAVAYGVDY--DKDKVVLVYDLGGGTFD 177

Query: 691 VSILTIEDGIFEVKSTAGDTHFG 759
           V+++ ++    +V  T GD + G
Sbjct: 178 VTMIDVKKDSIKVICTGGDHNLG 200



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query: 96  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           GIDLGTTYSC+  V ++G+  ++ N +  R TPS V F     ++GD AK
Sbjct: 6   GIDLGTTYSCISYVDEYGRPVVVPNAENERITPSVVFFDGDNVIVGDVAK 55



 Score = 33.5 bits (73), Expect = 5.8
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +2

Query: 407 KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           K +  EE+SS +L K+   AE  LG+ + + VIT P
Sbjct: 85  KNYHAEEISSFILRKLISDAENNLGQKINDVVITCP 120


>UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 605

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 42/84 (50%), Positives = 54/84 (64%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F+  QR AT  A  I+G+ V+ ++NEPTAAAIAY   +        ++ D GGGTF
Sbjct: 150 VPANFSSEQRDATAAAAEIAGIEVIELVNEPTAAAIAYDKSQTLINGGKYIVIDFGGGTF 209

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSI+T+ D  F V +T GDTH G
Sbjct: 210 DVSIVTVSDKEFTVNATDGDTHLG 233



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 4/87 (4%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 445
           N I++AKR IGR+ +   ++ D K    ++  + G+   ++    + K   P EVSS +L
Sbjct: 66  NIIYEAKRFIGRRVKPNEIEND-KSLLNKISVEDGELFYEIEQDNQIKKVSPVEVSSQIL 124

Query: 446 TKMKETA-EAYLGKTVQN---AVITFP 514
             +K+ A  +   K++ +   AVIT P
Sbjct: 125 LYLKQQAINSINNKSLSDNFKAVITVP 151


>UniRef50_A2DR00 Cluster: DnaK protein; n=7; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 615

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 44/98 (44%), Positives = 66/98 (67%)
 Frame = +1

Query: 466 RSLSWQNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG 645
           +S + +   +C   VPA FND+QR ATK A  I+ LNV + ++EPTAAAIAY  + +   
Sbjct: 137 KSATGKEATDCVITVPANFNDAQRNATKTAARIANLNVRKFLSEPTAAAIAY-YNIEPKD 195

Query: 646 ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           + ++L+FD G GT DVSI+ I+  +F VK+ AG+++ G
Sbjct: 196 KIHLLVFDFGAGTLDVSIVYIDGQVFNVKAVAGNSNLG 233



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 433
           NP+  IF AKRLIG K+ D  VQ   ++  FE+  D    P I V    + K + PEE+S
Sbjct: 70  NPSRVIFGAKRLIGHKYHDRPVQELFENVGFEIQPDEDDNPLIVV----DGKKYMPEEIS 125

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           S +L  +KET ++  GK   + VIT P
Sbjct: 126 SFLLEHVKETYKSATGKEATDCVITVP 152


>UniRef50_Q20752 Cluster: Putative uncharacterized protein stc-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein stc-1 - Caenorhabditis elegans
          Length = 450

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 42/83 (50%), Positives = 57/83 (68%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFD 690
           PA FN+ QR  T  A  I+ + V R+I+EPTAAA+AYGL KK  G  NV++ DLGGGT D
Sbjct: 182 PAEFNEKQRNFTAKAAEIAEMEVRRVISEPTAAALAYGLHKK-QGVENVVVVDLGGGTLD 240

Query: 691 VSILTIEDGIFEVKSTAGDTHFG 759
           VS+L ++ G+F  ++ AG+   G
Sbjct: 241 VSVLWLQGGVFVTQAMAGNNRLG 263



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFE--DATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEE 427
           NP  TI+DAKR IGR FE  +    +D K +PF++  D  GK   ++      K  +PEE
Sbjct: 94  NPKRTIYDAKRFIGRNFEKNNKDFLSDQKRYPFKINLDSEGKAFFEIPLDSGTKNVYPEE 153

Query: 428 VSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           + S+++  +K  A  +LG T+   VI+ P
Sbjct: 154 IGSLIIGYLKSAAAKHLGVTLGQVVISCP 182



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = +3

Query: 66  KYKMAKAPA--VGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTER-LIG 230
           KY +   P    GIDLGTTYS +G++    G+  I+ +D G ++ PS VAF      LIG
Sbjct: 25  KYGLPPPPPKIAGIDLGTTYSSIGIYHAVTGETIILPDDLGKKSVPSVVAFLPNGTVLIG 84

Query: 231 DAAKNQ 248
             A  Q
Sbjct: 85  TRATEQ 90


>UniRef50_A4QNX8 Cluster: Zgc:162281 protein; n=6; Eumetazoa|Rep:
           Zgc:162281 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 438

 Score = 86.6 bits (205), Expect = 6e-16
 Identities = 44/84 (52%), Positives = 58/84 (69%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F++ QR  T  A  ++GL+VLR+INEPTAAA+AYGL K      NVL+ DLGGGT 
Sbjct: 174 VPAEFDERQRNYTIRAANLAGLDVLRVINEPTAAAMAYGLHKAEV--FNVLVVDLGGGTL 231

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L  + G+F  ++ AG+   G
Sbjct: 232 DVSLLNKQGGMFLTRAMAGNNQLG 255



 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 37/92 (40%), Positives = 54/92 (58%)
 Frame = +2

Query: 239 QEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFF 418
           QE   VNP NTI+DAKR IG+ F++ T++ +   +PF+V+ + G     V       T  
Sbjct: 85  QELSDVNPQNTIYDAKRFIGKIFDEETLEKESARYPFKVIFNNGSADFLV-NTNSTFTVT 143

Query: 419 PEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           PE + S +L KM++ AE  LG  V+ AVI+ P
Sbjct: 144 PEFIGSRLLLKMRKMAEKQLGVPVEKAVISVP 175



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDT 215
           K   +G+DLGTT+  VGVFQ   G++EII +D+G ++ PS V+FT T
Sbjct: 30  KPRVIGLDLGTTFCSVGVFQPGTGEIEIIEDDKGRKSIPSVVSFTLT 76


>UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG31366-PA - Tribolium castaneum
          Length = 614

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 42/84 (50%), Positives = 55/84 (65%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFN SQR+AT +A   +G  VL+++NEPTAAA  Y +D+    E   L++DLGGGTF
Sbjct: 146 VPAYFNVSQREATLEAAQKAGFTVLKLLNEPTAAAFCYYVDQNWGEESYSLVYDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+IL       ++    GDTH G
Sbjct: 206 DVAILKNCRQNIDIVGVDGDTHLG 229



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 33/81 (40%), Positives = 50/81 (61%)
 Frame = +2

Query: 272 IFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTK 451
           +F  KR IG++F+D  ++ D++H PF + S   KP + + +K       PEEVS++VL K
Sbjct: 67  VFGIKRFIGKQFDDPDLRNDLRHVPFTIESIENKPIVTINHKSGVCKKTPEEVSALVLQK 126

Query: 452 MKETAEAYLGKTVQNAVITFP 514
           +K   E+ LG+ V  AVIT P
Sbjct: 127 VKTDVESKLGERVNKAVITVP 147



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI 227
           +GIDLGTT S    +   KV ++ N +G+R TPS V F D   +I
Sbjct: 6   IGIDLGTTNSSAAYYFKEKVRVVENKEGDRITPSCVYFRDQNTVI 50


>UniRef50_O88687 Cluster: Heat shock protein 70; n=2;
           Euteleostomi|Rep: Heat shock protein 70 - Mus musculus
           (Mouse)
          Length = 43

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 39/43 (90%), Positives = 40/43 (93%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVA 203
           MAK  A+GIDLGTTYSCVGV QHGKVEIIANDQGNRTTPSYVA
Sbjct: 1   MAKNTAIGIDLGTTYSCVGVLQHGKVEIIANDQGNRTTPSYVA 43


>UniRef50_UPI0000499E28 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 480

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 41/84 (48%), Positives = 59/84 (70%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+DSQ+  TK A  ++G +++R++ EP+AAA AYGL+   T ++  L FDLGGGT 
Sbjct: 147 VPAYFDDSQKDRTKKAVLMAGFSLIRLLAEPSAAAYAYGLE--STKDQMYLAFDLGGGTL 204

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+IL  +   F+ ++T GD H G
Sbjct: 205 DVTILEKKGEEFKFRATGGDVHLG 228



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 4/73 (5%)
 Frame = +2

Query: 251 GVNPNNTIFDAKRLIGRKFEDATVQADM--KHWPFEVV-SDGGKPKIKVAYKG-EDKTFF 418
           G+     I + KR IG+KF+D  VQ D+   ++P+++V  D G   + V Y   E++   
Sbjct: 54  GIPKPTAICEVKRFIGKKFDDEQVQEDINKNYFPYQIVKGDDGYCLVVVDYPDKEEERVE 113

Query: 419 PEEVSSMVLTKMK 457
           PE VS++VL  +K
Sbjct: 114 PEVVSAIVLKAIK 126



 Score = 37.1 bits (82), Expect = 0.47
 Identities = 22/46 (47%), Positives = 24/46 (52%), Gaps = 2/46 (4%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAF 206
           M +   VGIDLGTT+ C   F  Q  K E I    GN T PS V F
Sbjct: 1   MQQETVVGIDLGTTFCCCHFFNTQTNKYECINYLNGNSTIPSTVDF 46


>UniRef50_A2EAK8 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 615

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 43/91 (47%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +1

Query: 496 CSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG---LDKKGTGERNVLIF 666
           C   VPA FN +QR+AT +A T +GLN LR++NEPTAAA  Y    L K  T ++ V++F
Sbjct: 157 CVITVPAKFNTNQRKATLNAATKAGLNCLRLVNEPTAAAFCYKVHCLGKDDTSKKTVIVF 216

Query: 667 DLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           D G GT DVSI+  +   F V  T G++  G
Sbjct: 217 DFGAGTLDVSIVEFDGNSFNVIHTEGNSQLG 247



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 31/95 (32%), Positives = 51/95 (53%), Gaps = 10/95 (10%)
 Frame = +2

Query: 260 PNNTIFDAKRLIGRKFEDATVQ--ADMKHWPFEVVSDGGKPKIKVAY-------KGEDKT 412
           P   ++ +KRLIG +F   TVQ   +M      ++   GKP  KV Y       K +++ 
Sbjct: 68  PRQLLYGSKRLIGHEFYSDTVQNFIEMNEDTLNILEVRGKPVYKVDYYDDQNNNKIKEEI 127

Query: 413 FFPEEVSSMVLTKMKET-AEAYLGKTVQNAVITFP 514
           F PE++S+ +L K+  T  +A  G+ +++ VIT P
Sbjct: 128 FTPEDISAEILKKVASTYKDASGGEQLKSCVITVP 162


>UniRef50_A3BBU4 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 340

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 39/58 (67%), Positives = 51/58 (87%)
 Frame = +1

Query: 562 ISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKS 735
           I+GL + RIINEPTA AIAY +DKKGT E++VLIFDLGG TFD+SI+ I++G+F+V+S
Sbjct: 99  IAGLTIDRIINEPTAGAIAYDIDKKGT-EKSVLIFDLGGNTFDISIIAIDNGVFKVRS 155



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 24/37 (64%), Positives = 30/37 (81%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTP 191
           +   +GI+LGTTYS VGV+++G VEIIANDQGN  TP
Sbjct: 40  RCTVIGINLGTTYSWVGVYRNGIVEIIANDQGNHITP 76


>UniRef50_A6UND5 Cluster: 2-alkenal reductase; n=1; Methanococcus
           vannielii SB|Rep: 2-alkenal reductase - Methanococcus
           vannielii SB
          Length = 573

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 39/84 (46%), Positives = 58/84 (69%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F +  R+AT + G ++GLNVL +INEPTAAA+A+G+    + E N+ +FD GGGT 
Sbjct: 114 VPANFAEPARKATYNIGKLAGLNVLGLINEPTAAALAFGIRNLSSNE-NIAVFDFGGGTL 172

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+S+L +  G  +VK ++G+   G
Sbjct: 173 DISVLEMMGGFLDVKISSGNPKLG 196



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGK-VEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           P +GIDLGT+ S + VF+ GK + I   +  +   PS +A  ++E ++G  AK
Sbjct: 4   PIIGIDLGTSTSEIFVFKDGKQMPINDPESDSSVVPSIIAMQNSEIIVGSQAK 56



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 15/38 (39%), Positives = 26/38 (68%)
 Frame = +2

Query: 401 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           E++ FF EE+ + +L K+ + AE YLG+ + + V+T P
Sbjct: 78  ENQEFFAEELEAHILKKLVKNAEDYLGEKISDVVVTVP 115


>UniRef50_A5N5I5 Cluster: DnaK1; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK1 - Clostridium kluyveri DSM 555
          Length = 521

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 39/83 (46%), Positives = 58/83 (69%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFD 690
           PAYF   QR+ATK+A   +G NVLR++ EP+AAA++YG+++    ++ ++++DLGGGTFD
Sbjct: 117 PAYFTSEQRKATKNAARKAGFNVLRLMAEPSAAAVSYGINQ--NKDQIIMVYDLGGGTFD 174

Query: 691 VSILTIEDGIFEVKSTAGDTHFG 759
           VSI+ I    FE  +  GD   G
Sbjct: 175 VSIMKIRGNKFEAIAIDGDFRLG 197



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 24/58 (41%), Positives = 34/58 (58%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           VGIDLGTT S +   + GKVE I  D G  T PS V+ ++ + + G  AK ++   P+
Sbjct: 5   VGIDLGTTNSVISCVKRGKVETILLD-GKNTFPSVVSISNGKIITGYPAKAKLIMDPS 61


>UniRef50_P48723 Cluster: Stress 70 protein chaperone
           microsome-associated 60 kDa protein precursor; n=19;
           Tetrapoda|Rep: Stress 70 protein chaperone
           microsome-associated 60 kDa protein precursor - Homo
           sapiens (Human)
          Length = 471

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 41/84 (48%), Positives = 58/84 (69%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DLGGGT 
Sbjct: 174 VPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDLGGGTL 231

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L  + G+F  ++ +G+   G
Sbjct: 232 DVSLLNKQGGMFLTRAMSGNNKLG 255



 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 44/105 (41%), Positives = 62/105 (59%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTI+DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  PE V S
Sbjct: 91  NPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSPEYVGS 149

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA 571
            +L K+KE AEAYLG  V NAVI+ P     LK +   ++  +LA
Sbjct: 150 RLLLKLKEMAEAYLGMPVANAVISVP-AEFDLKQRNSTIEAANLA 193



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 230
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>UniRef50_Q8YNT4 Cluster: DnaK-type molecular chaperone; n=2;
           Nostocaceae|Rep: DnaK-type molecular chaperone -
           Anabaena sp. (strain PCC 7120)
          Length = 712

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 38/84 (45%), Positives = 51/84 (60%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           +PAYFND QR AT+ A   +GL  L ++ EPTAAAI+YG        + +L++D GGGTF
Sbjct: 128 IPAYFNDQQRYATRTAALKAGLTPLELLPEPTAAAISYGFSPDSEDVKTILVYDFGGGTF 187

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D S++T     F  +  AGD   G
Sbjct: 188 DASLITAAGTSFIEQGKAGDLWLG 211



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 8/94 (8%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV--SDGGKPKIKVAYKGEDKTFFPEEV 430
           +P N I   KRLIGR F D  V+       +++   S G    I V   G++  + PE++
Sbjct: 38  DPENVIASIKRLIGRGFSDQAVKKQRLEVGYKITEPSYGTDNSIAVWLGGQE--YSPEDI 95

Query: 431 SSMVLTKMKETAEAY---LGK---TVQNAVITFP 514
           S+ +L K+   A+AY   +GK    +  AVIT P
Sbjct: 96  SAEILKKVVSNAQAYRQGIGKIDEVIDQAVITIP 129


>UniRef50_A7BR82 Cluster: Heat shock protein Hsp70; n=1; Beggiatoa
           sp. PS|Rep: Heat shock protein Hsp70 - Beggiatoa sp. PS
          Length = 516

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 42/68 (61%), Positives = 52/68 (76%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF++ +R+AT DA   +GL VLRIINEPTAAA+ Y   K G  +  VLI+DLGGGTF
Sbjct: 119 VPAYFDEYRRKATMDAAEKAGLKVLRIINEPTAAALTYA--KTGQCKGKVLIYDLGGGTF 176

Query: 688 DVSILTIE 711
           DVSI+ I+
Sbjct: 177 DVSIVDIQ 184



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 27/62 (43%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           K  A+GIDLGTTYS +      GK EI+ N  G R T S V F     L+G  A +  A 
Sbjct: 2   KRHAIGIDLGTTYSALATLNSSGKPEIVPNLDGERVTASAVYFQGGSILVGQLAADAAAG 61

Query: 258 TP 263
            P
Sbjct: 62  DP 63


>UniRef50_A2DWC1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 649

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNV--LRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGG 681
           VP  F+ +QR+ TK+A  ++G N+  L ++ EPTAAAI Y          ++LI+D GGG
Sbjct: 147 VPEGFSTNQRKTTKEAAELAGFNINKLALLAEPTAAAIKYAYSADPNQRHHILIYDFGGG 206

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFD+S+ TI++   EVKST GD+  G
Sbjct: 207 TFDISLATIDNKTVEVKSTGGDSRLG 232



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 33/100 (33%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEV 430
           + P    +D+KR+IG+ ++D  V      WPF V S     P+I VA  G++++  P +V
Sbjct: 63  IEPTAVAYDSKRMIGQSYDD--VMKQKFEWPFRVESSSENDPEIVVACNGKEESVSPVQV 120

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQK 550
           S+ +L  +K   E  +G  + +AVIT P    T + K  K
Sbjct: 121 SAEILKYIKSKVEVKVGHPIDSAVITVPEGFSTNQRKTTK 160



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           +GIDLGTT+S   ++       E+I  D G +  PS VAF  +  ++G+ AK Q+   PT
Sbjct: 8   LGIDLGTTFSSAAIYNPDTKTTEVIEID-GKKELPSMVAFNVSPHVVGEPAKGQLLIEPT 66


>UniRef50_UPI0000499681 Cluster: heat shock protein 70; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 527

 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 39/84 (46%), Positives = 59/84 (70%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF++SQ+  TK A  ++G +++R++ EP+AAA AYGL+   T ++  L+FDLGGGT 
Sbjct: 152 VPAYFDNSQKDRTKKAVLMAGFSLIRLLAEPSAAAYAYGLE--STKDQMYLVFDLGGGTL 209

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+IL  +   F+ ++  GD H G
Sbjct: 210 DVTILEKKGEEFKFRAIGGDVHLG 233



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 10/110 (9%)
 Frame = +2

Query: 251 GVNPNNTIFDAKRLIGRKFEDATVQADM--KHWPFEVV-SDGGKPKIKVAY---KGEDKT 412
           G+     I + KR IG+KF+D  VQ D+   ++P+++V  D G  +I V Y   + E++ 
Sbjct: 57  GIPKPTAICEVKRFIGKKFDDEQVQEDINKNYFPYQIVKGDDGYCQIVVDYPDKEEEEEQ 116

Query: 413 FFPEEVSSMVLTKMKETAEAYLG---KTVQNAVITFPR-TSMTLKDKPQK 550
             PE VS++VL  ++   +  L         AV+T P     + KD+ +K
Sbjct: 117 VEPEVVSAIVLKAIEIEIQRRLNIKDNISLRAVVTVPAYFDNSQKDRTKK 166



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 21/40 (52%), Positives = 22/40 (55%), Gaps = 2/40 (5%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAF 206
           VGIDLGTT+ C   F  Q  K E I    GN T PS V F
Sbjct: 10  VGIDLGTTFCCCHFFNTQTNKYECIYYLNGNSTIPSTVDF 49


>UniRef50_Q1VU26 Cluster: Heat shock protein Hsp70; n=2;
           Bacteroidetes|Rep: Heat shock protein Hsp70 -
           Psychroflexus torquis ATCC 700755
          Length = 838

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 37/84 (44%), Positives = 55/84 (65%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           +PA F  +Q  AT+ AG ++G   + ++ EP AA++AYGLD  G  +   L+FD GGGTF
Sbjct: 128 IPAAFKINQIDATRRAGKLAGFEHIEVLQEPVAASMAYGLDS-GKKDGFWLVFDFGGGTF 186

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D +++ +E+GI +V  T GD H G
Sbjct: 187 DSALIKVEEGIMKVADTEGDNHLG 210



 Score = 37.1 bits (82), Expect = 0.47
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +3

Query: 96  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           GIDLGTT S +   + GK  II  ++   T  S VA+     ++GD A
Sbjct: 9   GIDLGTTNSAISRIEKGKATIIQTNKRRDTMASCVAYNKKGVIVGDDA 56


>UniRef50_UPI000038E267 Cluster: hypothetical protein Faci_03001788;
           n=1; Ferroplasma acidarmanus fer1|Rep: hypothetical
           protein Faci_03001788 - Ferroplasma acidarmanus fer1
          Length = 565

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 37/84 (44%), Positives = 56/84 (66%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFN++QR AT++A  I+G+ V + ++EP A AI+Y         +N+L+FD+G GT 
Sbjct: 123 VPAYFNNNQRNATREAAAIAGIKVKQFVSEPAAVAISYWNRASKAEAKNILVFDMGSGTT 182

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSI+  +   F V +T+G+T  G
Sbjct: 183 DVSIVRAQGKDFRVIATSGNTGLG 206


>UniRef50_Q3W504 Cluster: Heat shock protein Hsp70; n=3;
           Actinomycetales|Rep: Heat shock protein Hsp70 - Frankia
           sp. EAN1pec
          Length = 586

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 44/96 (45%), Positives = 58/96 (60%), Gaps = 12/96 (12%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERN----------- 654
           VPAYF D +R+AT  AG  +GLNV+ +INEPTAAA++YG  +   G R            
Sbjct: 90  VPAYFGDEERRATVLAGEYAGLNVVDVINEPTAAALSYGFARFEVGSRRTLTGPGTIAEE 149

Query: 655 -VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
             L++DLGGGTFDV+I+ + D    V +T GD   G
Sbjct: 150 VALVYDLGGGTFDVTIVELADRRVSVVATDGDHQLG 185


>UniRef50_A6NYB9 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 437

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 42/90 (46%), Positives = 59/90 (65%)
 Frame = +1

Query: 475 SWQNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERN 654
           S +N       VPAYF+D+QRQAT  A  ++GL+V+ +INEPTAAAI     ++      
Sbjct: 80  SGENVERVVISVPAYFSDNQRQATIKAAQLAGLDVVGLINEPTAAAIYASKSRQALS--- 136

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVKSTAG 744
            L+FDLGGGTFDVS++    G ++V++T G
Sbjct: 137 -LVFDLGGGTFDVSVVDSRFGDYDVQATDG 165


>UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2;
           Actinomycetales|Rep: Heat shock protein HSP70 -
           Saccharopolyspora erythraea (strain NRRL 23338)
          Length = 555

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 39/84 (46%), Positives = 53/84 (63%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF   +R ATK+AG I+GL+V+ I+ EP AAA+ Y        +R +L++DLGGGTF
Sbjct: 123 VPAYFGMLERTATKNAGQIAGLDVIGIVPEPVAAALHYEATTDAE-DRTILVYDLGGGTF 181

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D + + +     EV  T GD H G
Sbjct: 182 DTTAIRVSSDEIEVLCTDGDDHLG 205



 Score = 40.7 bits (91), Expect = 0.038
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 96  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVA*TPTT 269
           GIDLGTTYS +  V + G+  +  N     TTPS V F  ++  ++G  AKN     P  
Sbjct: 10  GIDLGTTYSAIAYVDETGRPAVCRNTDSLETTPSVVFFENESNVVVGSVAKNSAITYPDQ 69

Query: 270 QYSM 281
             S+
Sbjct: 70  VVSL 73


>UniRef50_UPI00005A2730 Cluster: PREDICTED: similar to heat shock
           protein 8; n=2; Canis lupus familiaris|Rep: PREDICTED:
           similar to heat shock protein 8 - Canis familiaris
          Length = 476

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 38/49 (77%), Positives = 41/49 (83%)
 Frame = +1

Query: 613 IAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +A   DKK   ERNVLIFDLGGGTFDVS+ TIE+GIFEVKSTAGDTH G
Sbjct: 156 VANEADKKVGAERNVLIFDLGGGTFDVSVPTIENGIFEVKSTAGDTHLG 204



 Score = 33.1 bits (72), Expect = 7.7
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +2

Query: 275 FDAKRLIGRKFEDATVQADMKHWPFEVVSDGGK 373
           F  K LIG++F  A V+ DMKH PF V ++  K
Sbjct: 130 FLMKCLIGQRFNYAVVKFDMKHRPFLVANEADK 162


>UniRef50_Q3SD91 Cluster: Cytosol-type hsp70; n=1; Paramecium
           tetraurelia|Rep: Cytosol-type hsp70 - Paramecium
           tetraurelia
          Length = 604

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 42/85 (49%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVS 433
           NP NTI++  RL+GR+F D  VQ ++++  F+V SD   +PKI V  K E     PEEV 
Sbjct: 64  NPTNTIYNVMRLMGRRFSDKIVQEEIQNLLFKVESDEHDRPKIVVQQKQEQLRLHPEEVC 123

Query: 434 SMVLTKMKETAEAYLGKTVQNAVIT 508
           SM+L+KMK  AE +LG  V  AVIT
Sbjct: 124 SMILSKMKTAAEIHLGHKVNQAVIT 148



 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 37/79 (46%), Positives = 52/79 (65%)
 Frame = +1

Query: 523 NDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSIL 702
           N   ++A +DAG ISGL +LRII + TAA  AYG++ +    R +LIF+LGGG+  VS  
Sbjct: 154 NFCSKRAIEDAGLISGLRILRIIIDSTAAYFAYGMNLQNINLRTILIFNLGGGSITVSAG 213

Query: 703 TIEDGIFEVKSTAGDTHFG 759
            IE  I E+ ST+G+ + G
Sbjct: 214 DIEFSIIEITSTSGNRNLG 232



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 36/59 (61%), Positives = 43/59 (72%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           A+GIDLG  YS VGV  + + E+IAN+ GN+ TPSYVAF D E LIG+AA NQ A  PT
Sbjct: 8   AIGIDLGLKYSRVGVMINDQFELIANEFGNKFTPSYVAFVDNEILIGEAALNQQAKNPT 66


>UniRef50_Q9M7S4 Cluster: Heat shock protein 70; n=1; Triticum
           aestivum|Rep: Heat shock protein 70 - Triticum aestivum
           (Wheat)
          Length = 130

 Score = 79.8 bits (188), Expect = 7e-14
 Identities = 39/94 (41%), Positives = 57/94 (60%)
 Frame = +2

Query: 77  GKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCRQEPGGV 256
           G+    R+R  +H+L+R  + AR   DHRQRPGQ  H+++  +HR  ASHRRC +    +
Sbjct: 36  GRGAGHRHRPRHHLLVRRRVAARPRRDHRQRPGQPHHALVRRLHRLGASHRRCAKNQVAM 95

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV 358
           NP NT+FDA  L          Q+D+K WP++V+
Sbjct: 96  NPINTVFDANVLSAEGLL-MPCQSDIKMWPYKVI 128


>UniRef50_A2F432 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 629

 Score = 79.8 bits (188), Expect = 7e-14
 Identities = 41/91 (45%), Positives = 58/91 (63%), Gaps = 3/91 (3%)
 Frame = +1

Query: 496 CSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY--GLDKKGTGE-RNVLIF 666
           C   VPA FN +QR+AT++A   +GLN LR++NEPTAAA AY   LD+    E + +++F
Sbjct: 152 CVITVPANFNTNQRRATQNAAQKAGLNCLRLVNEPTAAAFAYKQSLDEVTLRENQTIIVF 211

Query: 667 DLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           D G GT DVS++   +  F VK   G++  G
Sbjct: 212 DFGAGTLDVSVVVFNNNDFVVKYIEGNSDLG 242



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 31/85 (36%), Positives = 49/85 (57%), Gaps = 4/85 (4%)
 Frame = +2

Query: 272 IFDAKRLIGRKFEDATVQADMK-HW-PFEVVSDGGKPKIKVAYKGEDKTFF--PEEVSSM 439
           +F AKRL+GR F+   VQ  +K H    ++V+   KP  K+ ++  +KT++  PE+VSS 
Sbjct: 73  LFGAKRLLGRNFDHEKVQEFIKIHKDKVDIVNQDNKPLYKITFEDYNKTYYKKPEDVSSD 132

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +L  ++ET     G  +   VIT P
Sbjct: 133 LLGFVRETFAKCHGSQIDACVITVP 157


>UniRef50_A7PZE7 Cluster: Chromosome chr15 scaffold_40, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr15 scaffold_40, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 92

 Score = 79.4 bits (187), Expect = 9e-14
 Identities = 36/53 (67%), Positives = 46/53 (86%)
 Frame = +1

Query: 601 TAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           ++AAIAYGLDKKG GE+N+L+F LGGG  DVS+LTI++G+FEV +T GDTH G
Sbjct: 3   SSAAIAYGLDKKG-GEKNILVFYLGGGICDVSVLTIDNGVFEVLATNGDTHLG 54


>UniRef50_Q1D211 Cluster: DnaK family protein; n=1; Myxococcus
           xanthus DK 1622|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 504

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 39/89 (43%), Positives = 55/89 (61%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 672
           EC   VPA+ +  QR A + A   +GL V  IINEPTAAA+ Y        E+ V++FDL
Sbjct: 140 ECVLTVPAHASSRQRAAVRHAAEQAGLQVRAIINEPTAAALYYA--NLRNPEQTVMVFDL 197

Query: 673 GGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GGGTFD ++L +++ + +V +T GD   G
Sbjct: 198 GGGTFDATLLAVQNKVVKVLATGGDAFLG 226



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           +P +T+F AKR +GR+F+   V      + F +V ++ G   + +  K    T    +V+
Sbjct: 64  DPRHTVFGAKRFLGRRFQSEYVTQHKDKYAFGLVEAEDGYTAVTMYGKQTSLT----DVA 119

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            +++ ++   A    G   +  V+T P
Sbjct: 120 HLIIKQIHTLANHAAGTPFRECVLTVP 146


>UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia
           intestinalis|Rep: GLP_54_20127_18205 - Giardia lamblia
           ATCC 50803
          Length = 640

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 38/87 (43%), Positives = 59/87 (67%), Gaps = 4/87 (4%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNV-LIFDLGGG 681
           PAYFN+ QR+AT+ AG ++ L+V+R+++EPTAAA+ Y  +       E  + ++ D GGG
Sbjct: 155 PAYFNNDQRRATELAGQLANLDVIRVLSEPTAAALLYNYNSSSNKIKENEIFVVIDAGGG 214

Query: 682 TFDVSILTIE-DGIFEVKSTAGDTHFG 759
           T+D+SI+    DG++ V +TAGD   G
Sbjct: 215 TYDISIMECSGDGVYSVIATAGDGFLG 241



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 31/89 (34%), Positives = 46/89 (51%), Gaps = 3/89 (3%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N  NTI  +KRLIGR+F DA V+   KH  +++V  G   +  +      K+  P EV S
Sbjct: 68  NVKNTINASKRLIGRRFTDAEVKRAAKHVSYDIV-QGPNGEAMINVPNLHKSVSPIEVGS 126

Query: 437 MVLTKMKETAEAYLGKTVQ---NAVITFP 514
            +L  +K   +   G  ++   +AVIT P
Sbjct: 127 EILKYIKSQVQQRSGLEIEDKPHAVITCP 155



 Score = 37.1 bits (82), Expect = 0.47
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 4/56 (7%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER----LIGDAAKNQ 248
           +G DLGTT SCV     G   ++    G+RT PS V +   E     L+G  A+ Q
Sbjct: 9   LGFDLGTTNSCVSTMVSGVPTVLPMLDGSRTVPSVVGYLPLEARDTPLVGAEAERQ 64


>UniRef50_UPI0000498B17 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 543

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 36/84 (42%), Positives = 58/84 (69%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F D +R+AT+ A  ++G+  +R++NEPTAAA+AY  +KK   +  + +FD GGGT 
Sbjct: 153 VPAAFGDEERKATEQAIKMAGIEPIRMVNEPTAAAMAY--EKK---DGVLYVFDFGGGTL 207

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D+S++   +G+ ++K+T GD   G
Sbjct: 208 DISVIKFVEGVMQIKTTIGDPFLG 231



 Score = 33.1 bits (72), Expect = 7.7
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 245
           VGIDLGTT+S      +G+  I  ++    +  S VAFT ++ L+G   K+
Sbjct: 10  VGIDLGTTFSSACEIINGRPFIYKSEFERDSIRSCVAFTGSQCLVGTNDKS 60


>UniRef50_A2G573 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 621

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 39/87 (44%), Positives = 58/87 (66%), Gaps = 3/87 (3%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG---LDKKGTGERNVLIFDLGG 678
           +PA F+ +QR+ TK A  ++GL+V++ I+EPTAAAIAY     D+  TG++ VLIFD G 
Sbjct: 143 IPALFSPNQRECTKTAAELAGLDVIQFISEPTAAAIAYKDTIKDQGVTGKQTVLIFDFGA 202

Query: 679 GTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GT DVSI+  E+    + +  G+ + G
Sbjct: 203 GTLDVSIVAFENDDCNIIAVEGNVNLG 229



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 30/86 (34%), Positives = 49/86 (56%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           +P    + +KRLIGRKF D  VQ  +K  P+E+++   +P    AY  E  T+ PE +S+
Sbjct: 63  HPERVAYGSKRLIGRKFNDPYVQNFIKTCPYEIINKNDRP----AYVIEGNTYDPETISA 118

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            +L ++K   +   G  +++ VIT P
Sbjct: 119 QILLEIKNQFKKTTGNEMKSVVITIP 144


>UniRef50_Q4SW20 Cluster: Chromosome undetermined SCAF13693, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF13693,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 857

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F++ QR  T  A  ++GL VLR+I+EPTAAA+AYG+ +      +VL+ DLGGGT 
Sbjct: 169 VPADFDERQRNYTVKAAQLAGLEVLRVISEPTAAAMAYGVHRAEV--LSVLVVDLGGGTL 226

Query: 688 DVSILTIEDGIFEVKSTAG 744
           DVS+L+ + G+F  ++ AG
Sbjct: 227 DVSLLSKQGGMFLTRAMAG 245



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 2/59 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +G+DLGTT+  VGVF    G+VE++A+ +G R+ PS V+FT    L+G  A  Q    P
Sbjct: 32  IGLDLGTTFCSVGVFYPGSGEVEVLADAEGRRSIPSCVSFTAAAVLVGHEAAEQADRNP 90



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 29/86 (33%), Positives = 42/86 (48%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTI+DAKR IG+ FE   ++ + +       S  G  +  V+         P  V S
Sbjct: 89  NPRNTIYDAKRFIGKLFEPGVLEREERALH---PSRNGSAEFLVS-TNRSFGVSPTFVGS 144

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            +L +M+  AE  LG  V  AV++ P
Sbjct: 145 RLLLRMRSMAERRLGAPVHKAVVSVP 170


>UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia
           burgdorferi group|Rep: Heat shock protein 70 - Borrelia
           burgdorferi (Lyme disease spirochete)
          Length = 491

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 38/84 (45%), Positives = 54/84 (64%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF++ QR+   +A   +GLN   I+NEPTAAAIAY  +++  G    LI+DLGGGTF
Sbjct: 118 VPAYFSEIQRRCVVEAANFAGLNCKAILNEPTAAAIAYAFERQIDG--IFLIYDLGGGTF 175

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+++  +   + V S  G +  G
Sbjct: 176 DVTLMEKQGDTYTVLSVKGQSRLG 199



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 30/72 (41%), Positives = 44/72 (61%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPTTQ 272
           +GIDLGTT +    F     +II N++G R TPS V+F+D + L+G AAKNQ+   P  Q
Sbjct: 7   IGIDLGTTNTVASYFDVSS-KIILNERGERITPSIVSFSDKDVLVGSAAKNQILVNP--Q 63

Query: 273 YSMPNVSSDVSS 308
            +  N  +++ S
Sbjct: 64  KTFYNFKTNIGS 75



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = +2

Query: 392 YKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           YK + + +  E +S+ +L  +K  AE +L + ++NAVIT P
Sbjct: 79  YKVDGEFYKAEYISAHLLASVKRNAEKFLDEEIENAVITVP 119


>UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila
           auraria|Rep: LAC ORF protein - Drosophila auraria (Fruit
           fly)
          Length = 613

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 37/61 (60%), Positives = 46/61 (75%), Gaps = 3/61 (4%)
 Frame = -2

Query: 254 RHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDS---YCGC 84
           RHLVLG ++D+TLGVCE ++   G VALVVGDDLHL +L D +A VRG Q+DS   +C C
Sbjct: 552 RHLVLGRVADQTLGVCECHVGGRGAVALVVGDDLHLSMLVDAHAGVRGAQVDSNGRHCVC 611

Query: 83  F 81
           F
Sbjct: 612 F 612



 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = -1

Query: 756 KVGVAGGGFHLED-TILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSE 580
           +V V+GGG  LE  +++DG+DG VEG AA+V+D++++    + V+ V        +DD E
Sbjct: 383 QVRVSGGGPDLEQGSLVDGQDGDVEGAAAQVEDEHVALPLEVLVQPVGQCRRRGLVDDPE 442

Query: 579 NVQARDGTCIFCGLSLRVIEVRGN 508
           +VQ  D   +  GL+LRV+EV G+
Sbjct: 443 HVQPGDAAGVLGGLALRVVEVGGH 466



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 30/84 (35%), Positives = 44/84 (52%)
 Frame = -3

Query: 505 DNCILHSFAKISFGSFLHFRKHHGTDFLGEKGFVFTLICYLDLRFASITDNLERPVLHVG 326
           D+ +    A+I      H  +HH  DFLG +     L  + DL  +++ D+LE PVLHV 
Sbjct: 468 DDRVRDRLAQIGLRRLPHLDQHHRADFLGGEALGLALELHADLGLSAVADHLEGPVLHVL 527

Query: 325 LHSSIFELTSDETFGIEYCVVGVH 254
               +  L SDE  G+++ V GVH
Sbjct: 528 RDLRVVVLASDEALGVKHRVPGVH 551


>UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 707

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 38/85 (44%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY-GLDKKGTGERNVLIFDLGGGT 684
           VPAYF+D Q+  TK A   +G     ++NEPTAAA+ Y    +K +    +L++D GGGT
Sbjct: 145 VPAYFDDRQKAETKLAAKFAGFGDFELMNEPTAAALCYMHTFQKFSDSSKILVYDFGGGT 204

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FDVS++ I    FEV    GD+H G
Sbjct: 205 FDVSLVGINGKNFEVIGYDGDSHLG 229



 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 32/85 (37%), Positives = 56/85 (65%)
 Frame = +2

Query: 260 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 439
           P NT++D+KR+IG+ + +   + D+++WPF+V   GG P I+   K + + + P E+SS 
Sbjct: 63  PQNTVYDSKRMIGKMYSELD-ENDIRNWPFKVNDYGGAPSIQAVLKRQIREYRPYEISSY 121

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +L+ +K+ +E  LG  ++ AVIT P
Sbjct: 122 ILSYLKKKSEDQLGVPIKKAVITVP 146



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEI-IANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           M + P VGIDLGTT+S V V++  +    +    G+   PS +AF D E + G  AK+ +
Sbjct: 1   MNEGPFVGIDLGTTFSTVAVYKPAQKSFDVLKIDGDTQVPSVIAFGD-ELVYGQRAKSLM 59

Query: 252 A*TP-TTQYSMPNVSSDVSSKM 314
           A  P  T Y    +   + S++
Sbjct: 60  ANIPQNTVYDSKRMIGKMYSEL 81


>UniRef50_A7PR73 Cluster: Chromosome chr14 scaffold_26, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr14 scaffold_26, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 166

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 33/46 (71%), Positives = 41/46 (89%)
 Frame = +1

Query: 622 GLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GLDKKG GE+N+L+FDLGGG FDVS+LTI++G+FEV +T GDTH G
Sbjct: 100 GLDKKG-GEKNILVFDLGGGIFDVSVLTIDNGVFEVLATNGDTHLG 144


>UniRef50_Q0VDF9 Cluster: Heat shock 70 kDa protein 14; n=25;
           Euteleostomi|Rep: Heat shock 70 kDa protein 14 - Homo
           sapiens (Human)
          Length = 509

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 35/85 (41%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-TGERNVLIFDLGGGT 684
           VP  F + Q+ A  +A   +G NVLR+I+EP+AA +AYG+ +   TG+ N+L+F LGG +
Sbjct: 143 VPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTS 202

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
             +S++ +  GI+ V ST  D + G
Sbjct: 203 LSLSVMEVNSGIYRVLSTNTDDNIG 227



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 28/86 (32%), Positives = 45/86 (52%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N +NT+   K+++GR   D   Q  +      V+   GK + ++    E K   PE+V+ 
Sbjct: 59  NISNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVAR 118

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           ++ +KMKETA + LG    + VIT P
Sbjct: 119 LIFSKMKETAHSVLGSDANDVVITVP 144


>UniRef50_A6EMR6 Cluster: Heat shock protein Hsp70; n=1;
           unidentified eubacterium SCB49|Rep: Heat shock protein
           Hsp70 - unidentified eubacterium SCB49
          Length = 847

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 38/84 (45%), Positives = 54/84 (64%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F ++Q  AT++AG  +G + + II EP AAA  YG++ +   +   L+FD GGGTF
Sbjct: 131 VPAAFKNNQIDATREAGREAGFDQVGIITEPEAAAWVYGMNSENK-DGFWLVFDFGGGTF 189

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D ++L I DGI +V  T GD + G
Sbjct: 190 DAALLKITDGIRQVIDTEGDNYLG 213



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = +3

Query: 96  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKN 245
           GIDLGTT S +   ++G  E I       T PS V     + + +GDAA N
Sbjct: 9   GIDLGTTNSAISKMENGNPESIRTQTLKDTMPSCVYINRKKAIQVGDAAYN 59


>UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: 70 kD heat
           shock protein - Saccharopolyspora erythraea (strain NRRL
           23338)
          Length = 538

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 38/85 (44%), Positives = 56/85 (65%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY-GLDKKGTGERNVLIFDLGGGT 684
           VPAYF  ++++AT+ AG I+GLNVL ++ EP AAA+ + GL+      R++L++DLGGGT
Sbjct: 123 VPAYFGVAEKEATRRAGEIAGLNVLDVLAEPVAAALHHQGLESTDRA-RHLLVYDLGGGT 181

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FD + + +E     V  T GD   G
Sbjct: 182 FDTTAIRVERDDIRVVCTDGDQALG 206



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/66 (45%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
 Frame = +3

Query: 75  MAKAPAV-GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKN 245
           MA  P   GIDLGTT+SCV  V + G+  I  N     TTPS V F    R L+G +AKN
Sbjct: 1   MAAPPTTFGIDLGTTHSCVAYVDESGRPVIARNAVSEDTTPSVVYFEGPGRVLVGSSAKN 60

Query: 246 QVA*TP 263
                P
Sbjct: 61  SALLAP 66



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 18/54 (33%), Positives = 33/54 (61%)
 Frame = +2

Query: 353 VVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           V  D G+  ++  Y G  + + PEE+S+++L ++  +AE   G+ V++ VIT P
Sbjct: 73  VKRDMGRQGVEFGYHG--RAYTPEEISALILRELARSAEESTGRQVRDVVITVP 124


>UniRef50_UPI0000498597 Cluster: chaperone protein dnaK; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: chaperone protein
           dnaK - Entamoeba histolytica HM-1:IMSS
          Length = 523

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 39/84 (46%), Positives = 49/84 (58%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F D Q+ AT  A  + GL+V++I+ EPTAAA AYG+D+      N   FD GGGT 
Sbjct: 142 VPATFTDQQKDATLCAAQLGGLDVIQILPEPTAAAYAYGVDQ---NNGNFFAFDFGGGTL 198

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D +IL       +V S  GD H G
Sbjct: 199 DTTILKKTGNSLKVISAGGDQHLG 222


>UniRef50_Q2QXK2 Cluster: DnaK protein, expressed; n=2; Oryza
           sativa|Rep: DnaK protein, expressed - Oryza sativa
           subsp. japonica (Rice)
          Length = 461

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 35/85 (41%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 684
           VP YF+D  R+A  +A  ++GL  +RII+EPTAAA+++GL      +  NVL+  +GGGT
Sbjct: 184 VPYYFSDGPREAAMNAARMAGLTTVRIIDEPTAAAVSHGLHHGRLRDGGNVLVLHVGGGT 243

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
              ++LT ++ +FE  ++  D H G
Sbjct: 244 SAATVLTYDNAVFEAVASRHDAHLG 268



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = +2

Query: 284 KRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV--AYKGEDKTFFPEEVSSMVLTKMK 457
           KRL+G +F    V+   +H P+++V       I+V     G  ++ +  +V+SMV+ ++K
Sbjct: 104 KRLLGTRFGSPEVRRAAEHLPYKIVDWCTMAHIEVNAGAGGAARSVYASDVASMVIAELK 163

Query: 458 ETAEAYL---GKTVQNAVITFP 514
             AEA L   GK V NAV+T P
Sbjct: 164 ARAEARLAGGGKKVHNAVVTVP 185



 Score = 33.1 bits (72), Expect = 7.7
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA 254
           + +DLG T SCV  +     E  A        P+ VAFT D + L+G+AAKN  A
Sbjct: 47  IAVDLGNTNSCVAGYGD---EADAPPLFRLCIPTSVAFTGDGDALVGEAAKNHPA 98


>UniRef50_A2G8T1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 591

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 40/88 (45%), Positives = 54/88 (61%)
 Frame = +1

Query: 496 CSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLG 675
           C   VPA F+ +QR+ T  A   SG+  L++INEPTAAA +Y   +  T  + +LIFD G
Sbjct: 151 CVVTVPAKFDSNQRRDTISAIEKSGIKCLKLINEPTAAAFSY-FSEHQTNNQKILIFDYG 209

Query: 676 GGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            GT DVSI+ I+   FEV  T G++  G
Sbjct: 210 AGTLDVSIVEIKGKEFEVLYTEGNSDLG 237


>UniRef50_UPI0000DC15CB Cluster: UPI0000DC15CB related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC15CB UniRef100 entry -
           Rattus norvegicus
          Length = 490

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 46/84 (54%), Positives = 53/84 (63%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           V AYF+D Q QATKD G    LNVLRII E T A IAY        E  +L FDL   TF
Sbjct: 97  VAAYFSDLQCQATKDRGATK-LNVLRIIKETTTATIAY--------EFVLLFFDLSRSTF 147

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           +V +LTI  G+ EVK+T+GDTH G
Sbjct: 148 NV-VLTILAGVIEVKATSGDTHLG 170



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/45 (55%), Positives = 33/45 (73%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV 388
           +N  + +FDAKRLI  KF +ATVQ + +H+ F VVSDGGK K +V
Sbjct: 47  LNALHAVFDAKRLISSKFTEATVQPEKEHF-FRVVSDGGKSKAQV 90


>UniRef50_A5MZQ6 Cluster: DnaK8; n=2; Clostridium kluyveri DSM
           555|Rep: DnaK8 - Clostridium kluyveri DSM 555
          Length = 530

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 35/68 (51%), Positives = 49/68 (72%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F D+ ++AT +A  I+GL VL ++ EP AAAI YG +   + ++N+L++DLGGGTF
Sbjct: 129 VPANFTDNAKRATMEAAEIAGLEVLYLLEEPVAAAIRYGFN--SSKDQNILVYDLGGGTF 186

Query: 688 DVSILTIE 711
           DV IL  E
Sbjct: 187 DVCILKAE 194



 Score = 40.7 bits (91), Expect = 0.038
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI-GDAAKNQ 248
           +GIDLGT+ S   V+  GK  II  D G    PS V+F D+E +I G  AK +
Sbjct: 12  LGIDLGTSTSIASVYTKGKSRIIKID-GKEYIPSVVSFLDSETIIVGSQAKGR 63


>UniRef50_Q9XZM1 Cluster: Heat shock protein HSP70-2; n=3; Entamoeba
           histolytica|Rep: Heat shock protein HSP70-2 - Entamoeba
           histolytica
          Length = 244

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 33/64 (51%), Positives = 46/64 (71%)
 Frame = +1

Query: 568 GLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGD 747
           GL V+ IINEPTAAAIAYG DKK    + +L+FD+GGGTFD++++ +     +V +T G+
Sbjct: 1   GLEVIGIINEPTAAAIAYGYDKKYCEGKTILVFDIGGGTFDITLIRMNKRNQQVIATEGE 60

Query: 748 THFG 759
            H G
Sbjct: 61  RHLG 64


>UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 636

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 36/84 (42%), Positives = 51/84 (60%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           +P  FND Q+QAT D   I+GL V+R+I+EP AA IAYG D   T + N+ +FD GGGT 
Sbjct: 164 IPIGFNDIQKQATIDIAEIAGLKVVRLISEPNAAVIAYGRDYV-TEKTNIFVFDFGGGTL 222

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D++   +    FE    + + + G
Sbjct: 223 DIAATIVTKQKFEEIDNSSEMNLG 246



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +2

Query: 239 QEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY--KGEDKT 412
           +E G +NP NT +D KRL GR + D  V    K  PF ++ +  K  IKV+      +K 
Sbjct: 72  KEQGIINPQNTFYDIKRLTGRTYLDPNVNRVKKGLPFTIMQENDKICIKVSQPRNKSNKI 131

Query: 413 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           F  + + + VLTK+K  A +YLG  V+NAVI+ P
Sbjct: 132 FNIDYIQAKVLTKLKNIASSYLGVPVKNAVISIP 165



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 31/54 (57%), Positives = 39/54 (72%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           P +GIDLGTTYS V +F+  KVEII N+ G ++TP+ VAF  T  LIG+ AK Q
Sbjct: 22  PIIGIDLGTTYSSVCIFRDDKVEIIPNEYGFKSTPTVVAFNGT-FLIGEEAKEQ 74


>UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: HEAT SHOCK RELATED 70kDa
           PROTEIN - Encephalitozoon cuniculi
          Length = 683

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 44/96 (45%), Positives = 59/96 (61%), Gaps = 12/96 (12%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGL--NVLRIINEPTAAAIAYG-----LDKKGTGERNVLIF 666
           VPAYF + Q+  TK A TI+G   N +R++ EPTAAA+AYG      +   + + +VL+F
Sbjct: 172 VPAYFEEPQKDVTKAAATIAGFDPNKVRLLAEPTAAAMAYGHIQTQKNANFSAKEDVLVF 231

Query: 667 DLGGGTFDVSILTIE-----DGIFEVKSTAGDTHFG 759
           DLGGGTFDVS+L  E       +  VK+  GDT  G
Sbjct: 232 DLGGGTFDVSLLDFEFNGAAGSLGIVKAIDGDTFLG 267



 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 42/106 (39%), Positives = 58/106 (54%), Gaps = 18/106 (16%)
 Frame = +2

Query: 251 GVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEV--------------VSDGGKP---- 376
           G +P + IFDAKR+IGR+F+D  +Q  +K WPF+V              VS+G       
Sbjct: 68  GSDPMSVIFDAKRMIGREFDDPKIQNAIKGWPFKVVRYNHREKREEPNKVSEGSNSYDNI 127

Query: 377 KIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
            IK+   G+   + P E+S  VL  +K  AEA LG TV +AV+T P
Sbjct: 128 AIKITRNGKTNYYAPVEISGKVLLYLKNAAEARLGGTVDSAVVTVP 173



 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +3

Query: 66  KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTE-RLIGDAAK 242
           K K   + A+GIDLGTT+SCV  +  GKVE+I N  G RTTPS V+F +    ++G AA+
Sbjct: 5   KAKSNTSRAIGIDLGTTFSCVAGYISGKVEVITNQDGERTTPSVVSFDENNCTVVGTAAR 64

Query: 243 NQVA*TP 263
           N V   P
Sbjct: 65  NMVGSDP 71


>UniRef50_A2ECV1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 650

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 35/86 (40%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGL--NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGG 681
           +P  F+D+QR+ATK+A  I+G   N +  + EPT+AAI +          ++LI+D GGG
Sbjct: 144 IPQAFSDAQRKATKNAAIIAGFDPNKIHFLPEPTSAAIKFAHKASADHRHHILIYDFGGG 203

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFD+S  TI +   ++ ST GD+  G
Sbjct: 204 TFDISRATINNRKIKINSTGGDSKLG 229



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 1/100 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           + P    +D+KR+IGR +++  V+A    WPF +  +   +  I +  KG+ +   P +V
Sbjct: 61  ITPTLVAYDSKRMIGRTYDE--VKAQNMTWPFRIEGTSDNEVDIILENKGKTQVVSPVQV 118

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQK 550
           S+ +L  +K  AE  +GK    AVIT P+     + K  K
Sbjct: 119 SAEILKYLKTHAEKIIGK-FDGAVITIPQAFSDAQRKATK 157



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEI-IANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           VGIDLGTT+  V V++    E  +   +G++T PS V +  T    G  AK+Q+  TPT
Sbjct: 7   VGIDLGTTFCSVAVYRPSTQETEVLEIEGSKTIPSQV-YYGTPTYFGQKAKDQLQITPT 64


>UniRef50_Q52V38 Cluster: Heat shock protein 70-like; n=4; Mint
           virus 1|Rep: Heat shock protein 70-like - Mint virus 1
          Length = 604

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 36/91 (39%), Positives = 54/91 (59%)
 Frame = +1

Query: 487 CAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIF 666
           C+     VPA F  +QR    +  ++SG +   IINEP+AAA +    K    ER V+++
Sbjct: 146 CSGVVCSVPAAFTSTQRNFIMECVSLSGFHCSHIINEPSAAAFS-AFRKLSPSERFVMVY 204

Query: 667 DLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           D GGGTFDVS +++ +  F VK++ GD + G
Sbjct: 205 DFGGGTFDVSAVSVRNSTFVVKASGGDMNLG 235


>UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n=2;
            Eukaryota|Rep: NAD-specific glutamate dehydrogenase -
            Achlya klebsiana
          Length = 1063

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 32/80 (40%), Positives = 55/80 (68%)
 Frame = -1

Query: 756  KVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSEN 577
            +VG+       EDT  +G+  H+EGT  +++++ I+F+ TL VKTV N  +SRF++D+++
Sbjct: 814  QVGITSSSLDFEDTFFNGQKRHIEGTTTKIENENIAFT-TLLVKTVGNGGTSRFVNDTKD 872

Query: 576  VQARDGTCIFCGLSLRVIEV 517
            V+  +GT I   L+LRV+E+
Sbjct: 873  VKTSNGTSILGSLTLRVVEI 892



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 1/91 (1%)
 Frame = -3

Query: 505  DNCILHSFAKISFGSFLHFRKHHGTDFLGEKGFVFTLICYLDLRFASIT-DNLERPVLHV 329
            ++ +++S     F +FLH  ++H  +F   +   FTL    DL   + T  NLE PVL++
Sbjct: 897  NDSVVNSSTNEGFSNFLHLDQNHRGNFFRLESLSFTLEFDGDLWLVTSTRGNLEWPVLNI 956

Query: 328  GLHSSIFELTSDETFGIEYCVVGVHATWFLA 236
            GL S + E T+D+T  IE+ V  VH    L+
Sbjct: 957  GLSSWVVEFTTDQTLSIEHSVGRVHGNLVLS 987



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 23/52 (44%), Positives = 36/52 (69%)
 Frame = -2

Query: 251  HLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDS 96
            +LVL GI+++T  V E N+R  G V L+VG++ +  VL DT+ R+  T+ID+
Sbjct: 983  NLVLSGITNKTFAVSESNVRWGGTVTLIVGNNFNTIVLPDTDTRISRTEIDT 1034


>UniRef50_UPI0000498BE2 Cluster: chaperone protein dnaK; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: chaperone protein
           dnaK - Entamoeba histolytica HM-1:IMSS
          Length = 697

 Score = 72.9 bits (171), Expect = 8e-12
 Identities = 37/92 (40%), Positives = 51/92 (55%)
 Frame = +1

Query: 484 NCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLI 663
           N  +C   VPA FND QR  TK A   + L V+ I+NEPTAAA      +       +LI
Sbjct: 134 NNIKCILTVPAQFNDEQRNQTKKAALSANLEVIDILNEPTAAAYYCSKTQNYNDGDKILI 193

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           FD G GT DVS++ +++G   V  + G+ + G
Sbjct: 194 FDFGAGTLDVSLVEMKNGNLRVIGSEGNNYLG 225



 Score = 36.7 bits (81), Expect = 0.62
 Identities = 19/67 (28%), Positives = 37/67 (55%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N    I + KRLIG  F+ + VQ + +   +E+V D      ++ Y  ++ T  P EV+S
Sbjct: 59  NETQKISNTKRLIGCSFKPSLVQQEKRMINYEIVKDPENRLCRIKY-DKEHTISPTEVAS 117

Query: 437 MVLTKMK 457
           ++ ++++
Sbjct: 118 ILYSRVR 124


>UniRef50_Q3WFH0 Cluster: Heat shock protein Hsp70; n=1; Frankia sp.
           EAN1pec|Rep: Heat shock protein Hsp70 - Frankia sp.
           EAN1pec
          Length = 832

 Score = 72.9 bits (171), Expect = 8e-12
 Identities = 38/86 (44%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV--LIFDLGGG 681
           VPA F  +Q  AT+ A   +GL +  ++ EPTAAA+AY   +    E N+  L+FDLGGG
Sbjct: 124 VPAAFELNQTDATRRAAEAAGLGLSPLLQEPTAAALAYSFQRD---EDNIYRLVFDLGGG 180

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFD S++ I DG F++ +  GD   G
Sbjct: 181 TFDASVVHIRDGEFDIVNHRGDNFLG 206



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = +3

Query: 96  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVA*TP 263
           GIDLGTT S + V    +  I+ N   + TTPS V      R+ +G+ A+ +V   P
Sbjct: 9   GIDLGTTNSAIAVLDGTEARIVKNAFQHDTTPSAVYADRNGRIHVGERARERVESDP 65


>UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 708

 Score = 72.9 bits (171), Expect = 8e-12
 Identities = 37/93 (39%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +1

Query: 484 NCAECSYHVPAYFNDSQRQATKDAGT-ISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL 660
           NC +    +PA FN+ QR+ T  A   I+G   + +++EP++AA+ Y        +  VL
Sbjct: 138 NCTDVVITIPAAFNERQREKTIFAAQEIAGFRSVILLDEPSSAALEYAQGLPSNADELVL 197

Query: 661 IFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           IFD GGGT D+SI+ I +   +V +T GD HFG
Sbjct: 198 IFDFGGGTLDISIVEIFNNQCKVIATNGDPHFG 230



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 433
           NP NTI+D+KR+IGR F++   Q D K+W F       G   I      +  T  PEE+S
Sbjct: 62  NPTNTIYDSKRMIGRNFDNQIFQEDRKNWMFTTTRGMEGSININATINNQTITLLPEEIS 121

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
             +L  +K+TAE  +G    + VIT P
Sbjct: 122 GYILKHLKDTAELVIGNCT-DVVITIP 147



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGK-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           P +GIDLGTTY C+  F   K ++    D  +   PS+V+F + ER++G  A  Q+   P
Sbjct: 4   PHLGIDLGTTYCCIFAFDEKKNIKFSIRDGDSEQIPSFVSFANEERIVGRKAMAQMITNP 63

Query: 264 T 266
           T
Sbjct: 64  T 64


>UniRef50_A2ECF5 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 730

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 35/87 (40%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVS 433
           NP NT++D+KR+IG+KF +   Q D ++WPF    +D    +I V+ +G+     PEEVS
Sbjct: 62  NPENTVYDSKRMIGKKFSNPDFQIDRQNWPFNTSQADDDSIRINVSARGKKLNLRPEEVS 121

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
             +L  +K TAE  +G+   + VIT P
Sbjct: 122 GNILRYLKATAEKVIGE-CSDVVITIP 147



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 36/92 (39%), Positives = 54/92 (58%), Gaps = 1/92 (1%)
 Frame = +1

Query: 487 CAECSYHVPAYFNDSQRQATKDAGT-ISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLI 663
           C++    +PA F++ QR+ T  A   I+G   + +++EP+AAA+ Y  +     E  VLI
Sbjct: 139 CSDVVITIPASFDEIQREKTIFAAKEIAGFKNVALLDEPSAAALEYAQNLPPNSEEKVLI 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           FD GGGT D+SI+ I     +V  T G+ HFG
Sbjct: 199 FDFGGGTLDISIVEISRNKCKVLKTKGNPHFG 230



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGK-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +GIDLGTTY C+  +   K V     DQ +    SYV++   + + G  A+NQV   P
Sbjct: 6   LGIDLGTTYCCIYYYDEKKHVAEAIKDQDSSQIASYVSYNKDDVVYGSVAQNQVMNNP 63


>UniRef50_UPI00015B551B Cluster: PREDICTED: similar to
           ENSANGP00000015293; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000015293 - Nasonia
           vitripennis
          Length = 822

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GTGERNV 657
           +C   VP+YF  ++RQA  DA  I+GLNVLR+ NE TA A+ YG+ K+         RNV
Sbjct: 142 DCVISVPSYFTQAERQALLDAARIAGLNVLRLFNETTATALTYGIYKQDLPPPDAAPRNV 201

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D G  +  VSI     G  ++ ++A D+  G
Sbjct: 202 VFVDCGYASLQVSICAFHKGKLKMLASAADSQVG 235



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 34/88 (38%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEV--VSDGGKPKIKVAYKGEDKTFFPEEV 430
           N  NTI+  KRL+GRK+ D   Q +++  P+    ++DGG   I V Y  ED  F PE++
Sbjct: 62  NMKNTIYGFKRLLGRKYNDPFAQKELQSLPYRTSQLADGGIG-IHVQYLNEDHVFTPEQI 120

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           ++M+ TK+K+T+   L   V + VI+ P
Sbjct: 121 TAMLFTKLKDTSVTALQTAVNDCVISVP 148



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 27/59 (45%), Positives = 35/59 (59%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           MA    +GID G     + V + G +E IAND   R TPS VAF+   R++G AAKNQ+
Sbjct: 1   MAAMSVIGIDFGNDNCYIAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQL 59


>UniRef50_Q7M080 Cluster: DnaK-type molecular chaperone; n=1;
           Cricetulus griseus|Rep: DnaK-type molecular chaperone -
           Cricetulus griseus (Chinese hamster)
          Length = 137

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/43 (81%), Positives = 39/43 (90%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 636
           VPAYFND+QR    DAGTI+GLNV+RIINEPTAAAIAYGLDK+
Sbjct: 44  VPAYFNDAQR----DAGTIAGLNVMRIINEPTAAAIAYGLDKR 82



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/33 (60%), Positives = 25/33 (75%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEV 355
           NP NT+FDAK LIGR + D +VQ D+K  PF+V
Sbjct: 6   NPENTVFDAK-LIGRTWNDPSVQQDIKFLPFKV 37


>UniRef50_Q54GD7 Cluster: Heat shock protein Hsp70 family protein;
           n=2; Dictyostelium discoideum|Rep: Heat shock protein
           Hsp70 family protein - Dictyostelium discoideum AX4
          Length = 772

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 36/86 (41%), Positives = 55/86 (63%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--GTGERNVLIFDLGGG 681
           VP ++ND QR+A  +AG+I+GLN++R+INE TA A++YG+ K+   T   NVL  D+G  
Sbjct: 145 VPVFWNDYQRRAILNAGSIAGLNIIRLINETTATALSYGIYKEWSETDPTNVLFVDVGDS 204

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
              VS +  + G  +V  TA + + G
Sbjct: 205 ATSVSAVQYKKGQLKVLGTASNPNIG 230



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 33/87 (37%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NTI + KR IG++F+  TVQ ++KH  F+    D G     V Y GE  +F  E + 
Sbjct: 60  NIRNTITNIKRFIGQEFKTDTVQEELKHEMFQSYEMDNGFVGYNVTYAGEQCSFSSEAIL 119

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            M+  K+K+T EA++   V++ VI+ P
Sbjct: 120 GMLFGKLKKTTEAFVNNPVRDVVISVP 146



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           VG D GT    + V Q G V++IAN+  NR TPS V+F + ER +G++A
Sbjct: 5   VGFDFGTKNCTIAVAQKGGVDVIANEVSNRLTPSMVSFGEKERYLGESA 53


>UniRef50_Q06068 Cluster: 97 kDa heat shock protein; n=3;
           Strongylocentrotus|Rep: 97 kDa heat shock protein -
           Strongylocentrotus purpuratus (Purple sea urchin)
          Length = 889

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 36/88 (40%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KR I R+F D +VQ D K  P+++     G   ++V Y GE +TF PE++ 
Sbjct: 59  NYKNTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIY 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFPR 517
           +M+LTK+K TAE  L + V + VI+ P+
Sbjct: 119 AMILTKLKSTAEINLCRKVVDCVISVPQ 146



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG--TGE---RNV 657
           +C   VP Y+ D +R+    A  I+GLN LR+I++ TA A+AYG+ K+   T E   RNV
Sbjct: 139 DCVISVPQYYTDLERRGVIHAAEIAGLNCLRVISDTTAVALAYGIYKQDLPTPEEKPRNV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D G  +  VS+     G  +V + A D + G
Sbjct: 199 VFVDCGHSSLQVSVCAFNKGKLKVLANASDKNLG 232



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG D+G   S + V + G +E +AN+  +R TPS V+F +  R  G AA++Q
Sbjct: 4   VGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQ 55


>UniRef50_Q66239 Cluster: 65-kDa protein; n=19; Citrus tristeza
           virus|Rep: 65-kDa protein - Citrus tristeza virus
          Length = 594

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 36/92 (39%), Positives = 59/92 (64%)
 Frame = +1

Query: 484 NCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLI 663
           +C      VPA +N  QR  T+ + ++SG + + IINEP+AAA +  L K  + ++ + +
Sbjct: 143 SCTGVICSVPAGYNTLQRAFTQQSISMSGYSCVYIINEPSAAAYST-LPKLNSADKYLAV 201

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +D GGGTFDVSI+++    F V+S++GD + G
Sbjct: 202 YDFGGGTFDVSIVSVRLPTFAVRSSSGDMNLG 233


>UniRef50_A6CBP2 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 671

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 6/90 (6%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG------TGERNVLIFD 669
           VPA F+D QRQ T  AG  +GL  + +INEP AAA+ Y L  +G        E+ +L++D
Sbjct: 120 VPAQFSDLQRQETIAAGKQAGLKQVDLINEPVAAALCYVLGAEGMWFAELAEEQRILVYD 179

Query: 670 LGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           LGGGTFD+S++  +     V ++ GD   G
Sbjct: 180 LGGGTFDLSLVKYQKDEVNVLASGGDLKLG 209



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           M K  AVGIDLGTTYSC+  + +HG+   I N +G  +TPS   F   E ++G  A
Sbjct: 1   MQKIQAVGIDLGTTYSCIAHLNEHGEPVTIPNQEGELSTPSVAMFDGAEVIVGTEA 56


>UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein;
           n=1; Dictyostelium discoideum AX4|Rep: Heat shock
           protein Hsp70 family protein - Dictyostelium discoideum
           AX4
          Length = 517

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MA    +GID GT ++CVG+F++ ++EI  N QGNRTTPS V+F   ++L+GD AK Q+ 
Sbjct: 1   MANNNIMGIDFGTHFACVGIFKNERIEICPNQQGNRTTPSVVSFVGDDKLVGDEAKAQMD 60

Query: 255 *TP 263
             P
Sbjct: 61  RNP 63



 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 36/99 (36%), Positives = 59/99 (59%), Gaps = 4/99 (4%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS---DGGKPKIKVAYKGEDKTFFPEE 427
           NP NTI+D KRL+GRK  D     ++K   F+V +   +  K + +V YK    T  P E
Sbjct: 62  NPLNTIYDVKRLLGRKTTDELFDHEVKKLSFKVTTYEDNNEKIEFQVNYKSNVVTLTPIE 121

Query: 428 VSSMVLTKMKETAEAYL-GKTVQNAVITFPRTSMTLKDK 541
           +++ +L ++K TAE ++ G++++ AVI+ P T  T K +
Sbjct: 122 IATSILEQIKHTAETFIGGESIKKAVISVP-TDFTEKQR 159



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 31/88 (35%), Positives = 49/88 (55%), Gaps = 8/88 (9%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK--------KGTGERNVLI 663
           VP  F + QR   K+A T +G+ V+R+I+E +A A+AYG D+          + E NV++
Sbjct: 150 VPTDFTEKQRNDLKEAATAAGITVVRMIHEHSAVALAYGYDQVKECSETTNESKESNVMV 209

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGD 747
           FDLGG     S++ +   +FE+     D
Sbjct: 210 FDLGGSGVSASMIRVRSKLFEMIGNVSD 237


>UniRef50_O14992 Cluster: HS24/P52; n=8; Eutheria|Rep: HS24/P52 -
           Homo sapiens (Human)
          Length = 474

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNV 657
           +C   VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV
Sbjct: 139 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   + VS+     G  +V +TA DT  G
Sbjct: 199 VFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLG 232



 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 34/87 (39%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V+
Sbjct: 59  NAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L+K+KETAE+ L K V + V++ P
Sbjct: 119 AMLLSKLKETAESVLKKPVVDCVVSVP 145



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56


>UniRef50_O59838 Cluster: Heat shock protein homolog pss1; n=21;
           Fungi|Rep: Heat shock protein homolog pss1 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 720

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 37/88 (42%), Positives = 51/88 (57%), Gaps = 4/88 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE----RNVLIFDLG 675
           +PA+F D QR+A  +A  I+GLN LR++N+  AAA+ YG+ K    E    R V I D G
Sbjct: 148 IPAWFTDIQRRALLEAANIAGLNPLRLMNDNAAAALTYGITKTDLPEPESPRRVAIVDFG 207

Query: 676 GGTFDVSILTIEDGIFEVKSTAGDTHFG 759
              + VSI+    G F +KST  D + G
Sbjct: 208 HSNYSVSIVEFSRGQFHIKSTVCDRNLG 235



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/59 (33%), Positives = 38/59 (64%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           ++   VGID G + + + V ++  +++I N+  NR+TPS V++ +  R +G+AAK+  A
Sbjct: 3   SRTNVVGIDFGNSKTVIAVARNRAIDVIVNEVSNRSTPSLVSYGERSRFLGEAAKSAEA 61



 Score = 39.9 bits (89), Expect = 0.067
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQ-ADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KRL GR ++D  ++  +      ++    G    KV Y  E+  F   ++ 
Sbjct: 63  NFRNTVGSLKRLAGRTYDDPEIKDIESNFISAKLTEVDGFVGAKVQYLNEETAFSNIQLI 122

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +   TK+K  AEA L  +V + VI+ P
Sbjct: 123 AAYFTKIKAIAEAELIGSVSDVVISIP 149


>UniRef50_Q7ZUM5 Cluster: Heat shock protein 4; n=20;
           Euteleostomi|Rep: Heat shock protein 4 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 840

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 35/95 (36%), Positives = 55/95 (57%), Gaps = 5/95 (5%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERN 654
           A+C   VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RN
Sbjct: 138 ADCVISVPCFYTDAERRSVIDAAQIAGLNCLRLMNETTAVALAYGIYKQDLPAPEEKPRN 197

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           V+  D+G   + VS+     G  ++ +TA D   G
Sbjct: 198 VVFVDIGHSGYQVSVCAFNKGKLKILATAFDPEMG 232



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 44/129 (34%), Positives = 62/129 (48%), Gaps = 4/129 (3%)
 Frame = +2

Query: 140 AREGGDHRQRPGQQDHSVLCCVH---RHRASHRRCRQEPGGVNPNNTIFDAKRLIGRKFE 310
           AR GG         D     CV    R+R+     + +    N  NT+   KR  GR F 
Sbjct: 18  ARAGGIETVANEYSDRCTPACVSFGPRNRSIGAAAKSQMV-TNCKNTVHGFKRFHGRAFS 76

Query: 311 DATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 487
           D  VQ       +++     G   +KV Y  E+K F  E+V++M+LTK+KETAE+ L K 
Sbjct: 77  DPFVQNLKPSLVYDLAQMPSGTTGLKVMYMEEEKVFSIEQVTAMLLTKLKETAESALKKP 136

Query: 488 VQNAVITFP 514
           V + VI+ P
Sbjct: 137 VADCVISVP 145



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/53 (41%), Positives = 32/53 (60%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VG D+G     V V + G +E +AN+  +R TP+ V+F    R IG AAK+Q+
Sbjct: 4   VGFDVGFLNCYVAVARAGGIETVANEYSDRCTPACVSFGPRNRSIGAAAKSQM 56


>UniRef50_Q9VUC1 Cluster: CG6603-PA, isoform A; n=7;
           Endopterygota|Rep: CG6603-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 804

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 38/87 (43%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE+++
Sbjct: 59  NMKNTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+ TK+KET+ A +   V + VI  P
Sbjct: 119 AMLFTKLKETSAAAMQTQVNDCVIACP 145



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 3/88 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE---RNVLI 663
           +C    P +F +++R+A  DA  I+GLNVLR++NE TA A+AYG  K    E   RNV+ 
Sbjct: 139 DCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGFYKNDLFEDKPRNVIF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGD 747
            D G  +   S      G  ++ ++  D
Sbjct: 199 VDFGHSSLQASACAFTKGKLKMLASTWD 226



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           +GID G     V   + G +E +AND   R TPS+VAF   +R+IG AAKNQ
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQ 55


>UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM
           555|Rep: DnaK7 - Clostridium kluyveri DSM 555
          Length = 496

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 41/91 (45%), Positives = 53/91 (58%), Gaps = 7/91 (7%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGERNVLIFDLGG 678
           VP YF   Q Q T +A   +GL +L II EP AAA+AYG    +K    E  +LIFDLGG
Sbjct: 128 VPYYFKAHQFQNTSEAAKEAGLKLLGIIQEPIAAALAYGFHHSNKHLNREEKLLIFDLGG 187

Query: 679 GTFDVSILTI----EDGIFEVKSTAGDTHFG 759
           GTFD++I+ +    E+  F+V    GD   G
Sbjct: 188 GTFDLTIIKVKEDDENLSFDVLGIGGDDRLG 218


>UniRef50_Q7YUE0 Cluster: Hsp70 protein; n=1; Milnesium
           tardigradum|Rep: Hsp70 protein - Milnesium tardigradum
          Length = 203

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 31/47 (65%), Positives = 39/47 (82%)
 Frame = +1

Query: 619 YGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           + LDK  T E+ +L++DLGGGTFDVSILT+EDGIFEVK+  GD+H G
Sbjct: 19  FDLDKTDT-EKTILVYDLGGGTFDVSILTMEDGIFEVKAVNGDSHLG 64


>UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK6 - Clostridium kluyveri DSM 555
          Length = 490

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 6/90 (6%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG--LDKKGTGERNVLIFDLGGG 681
           VP +F  ++   T  A  ++GLN++ II EP AAA+AYG  L      + N+L+FDLGGG
Sbjct: 126 VPYHFRANEISNTIKAAKMAGLNLIGIIQEPIAAALAYGLHLSSDALKDENILVFDLGGG 185

Query: 682 TFDVSILTIEDG----IFEVKSTAGDTHFG 759
           TFD+++  + +      F V +T+GD   G
Sbjct: 186 TFDLTLFNLNNSSNRISFNVLATSGDDRLG 215



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +3

Query: 69  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           Y    +P VGIDLGTT+S +  +   K E+ +  +G    PS V    ++ +IG  A
Sbjct: 3   YDSVHSPVVGIDLGTTFSSIARWTGTKAEVYSL-KGEYNIPSVVYNDGSQFVIGKIA 58


>UniRef50_A2EPF1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 657

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 40/92 (43%), Positives = 52/92 (56%), Gaps = 1/92 (1%)
 Frame = +2

Query: 242 EPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGK-PKIKVAYKGEDKTFF 418
           E   + PN  I+D+KRLIG K++D  VQ   K  PFE+  +    P+I V YKG  K   
Sbjct: 60  ERAKIEPNLVIYDSKRLIGCKYQD--VQEICKTMPFEIQPNADDDPEIIVNYKGNQKVLK 117

Query: 419 PEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           P EVSS +L  +K  AE  L   ++ AVIT P
Sbjct: 118 PVEVSSQILAYLKSQAERRLRTKIKRAVITVP 149



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 33/84 (39%), Positives = 50/84 (59%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VP  F   Q Q TKDA   +GL  + +++EP ++ + Y        ++NV+I+D GGGTF
Sbjct: 148 VPHAFKKIQTQFTKDAAEAAGLESV-LLSEPESSVLYYKTKIDTDAKQNVIIYDFGGGTF 206

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D S+ TIE    ++++T GD H G
Sbjct: 207 DASLATIEGSEIKIRNTEGDPHLG 230



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           +GIDLGTT+S +  +   +  V +I  D GN++ PS V + D  +L+G+ A
Sbjct: 10  LGIDLGTTFSSIAYYDKNRQMVHLIEID-GNKSIPSVVYYGD-PKLVGNQA 58


>UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena
           thermophila SB210|Rep: dnaK protein - Tetrahymena
           thermophila SB210
          Length = 1213

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 32/84 (38%), Positives = 56/84 (66%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           +PAY + SQ+Q+  +A +I+GL V  ++N+  AA  +Y L+ +   ++N L+F LGG T 
Sbjct: 165 IPAYLSYSQKQSIVNAASIAGLEVQFVLNDYKAAIHSYDLEDQN--DKNALVFHLGGATM 222

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           +VSIL I++G+ +  ++  D +FG
Sbjct: 223 EVSILNIDEGVIDNIASCSDINFG 246



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 32/83 (38%), Positives = 52/83 (62%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFD 690
           P Y +D+Q+Q   +A +I+GL V R  N+  AA  +Y L+ +   ++N L+F LGG T +
Sbjct: 745 PTYLSDAQKQTMVNAASIAGLEVKRFFNDYKAAIHSYDLEDQN--DKNALVFHLGGATME 802

Query: 691 VSILTIEDGIFEVKSTAGDTHFG 759
           VSIL I+ G+ +  ++  D +FG
Sbjct: 803 VSILNIDYGVIDNIASCSDINFG 825



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 24/58 (41%), Positives = 36/58 (62%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           +GID G TYS V + Q G++ II N+ GN  TPS V+F + +  +G+ A +Q    P+
Sbjct: 28  IGIDFGNTYSSVAIVQEGQLIIIPNEYGNTETPSVVSFAEDKIFVGEQAIHQYQNNPS 85



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 28/105 (26%), Positives = 55/105 (52%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP+ ++   K+LI +  +D  +Q         +  +     I +  +G +     EEV++
Sbjct: 662 NPSRSVQKIKKLIAQDQKDIVLQNSQDFLSQNITKNNRIYDI-IDIEGSE-VHKTEEVTA 719

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA 571
           M+L+KMK+ AE +LG  ++ A+++FP T ++   K   +   S+A
Sbjct: 720 MILSKMKQIAENFLGNEIKYAILSFP-TYLSDAQKQTMVNAASIA 763



 Score = 39.5 bits (88), Expect = 0.088
 Identities = 23/86 (26%), Positives = 44/86 (51%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP+ ++   K+LI +  +D  +Q         +  +    +I      E  T   EEV++
Sbjct: 83  NPSRSVQKIKKLIAQDQKDIVLQNSQDFLSQNITKNNTISEIIDKEGSEAHT--TEEVTA 140

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            +L+KMK+ AE +LG  ++ A+++ P
Sbjct: 141 KILSKMKQIAENFLGTEIKYAILSIP 166


>UniRef50_Q9SAB1 Cluster: F25C20.19 protein; n=3; core
           eudicotyledons|Rep: F25C20.19 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 763

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 35/88 (39%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEV 430
           ++P +TI   KRLIGRKF +  VQ D++ +PFE   D  G  +I++ Y GE ++F P ++
Sbjct: 58  MHPKSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEIQSFSPVQI 117

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
             M+L+ +K+ AE  L   V + VI  P
Sbjct: 118 LGMLLSHLKQIAEKSLKTPVSDCVIGIP 145



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 4/94 (4%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK----KGTGERNV 657
           ++C   +P+YF +SQR A  DA  I+GL  LR++++ TA A+ YG+ K      +    +
Sbjct: 138 SDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATALGYGIYKTDLVANSSPTYI 197

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G     V + + E G   V+S A D + G
Sbjct: 198 VFIDIGHCDTQVCVASFESGSMRVRSHAFDRNLG 231



 Score = 40.3 bits (90), Expect = 0.050
 Identities = 16/49 (32%), Positives = 29/49 (59%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           VG D+G     + V +   ++++ ND+ NR  P+ V+F + +R +G AA
Sbjct: 4   VGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAA 52


>UniRef50_Q96269 Cluster: Heat-shock protein; n=14;
           Magnoliophyta|Rep: Heat-shock protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 831

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 36/88 (40%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP N+I   KRLIGR+F D  +Q D+K +PF V     G P I   Y GE + F P +V
Sbjct: 58  MNPKNSISQIKRLIGRQFSDPELQRDIKSFPFSVTEGPDGYPLIHANYLGEKRAFTPTQV 117

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
             M+L+ +K  AE  L   V +  I  P
Sbjct: 118 MGMMLSNLKGIAEKNLNTAVVDCCIGIP 145



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 36/92 (39%), Positives = 52/92 (56%), Gaps = 3/92 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGERNVLI 663
           +C   +P YF D QR+A  DA TI+GL+ LR+I+E TA A+AYG+   D   + + NV  
Sbjct: 139 DCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALAYGIYKTDLPESDQLNVAF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            D+G  +  V I   + G  ++ S A D   G
Sbjct: 199 IDIGHASMQVCIAGFKKGQLKILSHAFDRSLG 230



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/62 (33%), Positives = 29/62 (46%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPTTQ 272
           +G D G     V V +   ++++ ND+ NR TP+ V F D ER IG A        P   
Sbjct: 4   IGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDNERFIGTAGAASTMMNPKNS 63

Query: 273 YS 278
            S
Sbjct: 64  IS 65


>UniRef50_A2R006 Cluster: Contig An12c0210, complete genome; n=1;
           Aspergillus niger|Rep: Contig An12c0210, complete genome
           - Aspergillus niger
          Length = 513

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 34/84 (40%), Positives = 51/84 (60%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VP+  +D++R  T+DAG   GL V R++N PTAAAIA   D   +    +L+ D+G    
Sbjct: 95  VPSSCHDAERAETRDAGHQVGLKVHRLLNTPTAAAIAQWTDSPTSDAHLMLVLDIGARRA 154

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           + ++L   +G+FEVKS+ GD   G
Sbjct: 155 EATVLDAWNGLFEVKSSHGDCRLG 178



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTP-SYVAFTDTERLIGDAAKNQV 251
           A+GIDLG +Y  + V Q GKV +I + QG +  P SY+  T     +G A +++V
Sbjct: 4   AIGIDLGISYVSIAVAQDGKVHVIPDTQGRQRIPSSYLLRTSVAPSVGPAIRDRV 58


>UniRef50_A2E407 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 693

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 37/99 (37%), Positives = 55/99 (55%), Gaps = 1/99 (1%)
 Frame = +1

Query: 466 RSLSWQNCAECSYHVPAYFNDSQRQAT-KDAGTISGLNVLRIINEPTAAAIAYGLDKKGT 642
           ++L+   C++    VPA F+  QR+ T   A  I+G   + +++EP+AAA+ Y       
Sbjct: 134 KTLTSGECSDVVVTVPAAFDSIQREKTILAAKEIAGFKHVALLDEPSAAALEYAQGLPKH 193

Query: 643 GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            +  VLIFD GGGT D+SI+ I      V  T G+ HFG
Sbjct: 194 TQEKVLIFDFGGGTLDISIVDINQTECRVVKTKGNPHFG 232



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKP-KIKVAYKGEDKTFFPEEVS 433
           N   T++D+KR+IG+KF++   Q D K+W FE V        I + YKG+     PEE+S
Sbjct: 62  NTKYTVYDSKRMIGKKFDNKDFQIDRKNWMFETVRGANNSININIEYKGKIIPLAPEEIS 121

Query: 434 SMVLTKMKETAEAYL-GKTVQNAVITFP 514
             +L  +K   E  L      + V+T P
Sbjct: 122 GHILRYLKNITEKTLTSGECSDVVVTVP 149



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGIDLGTTY CV ++   K  I++   D      PSYV++     L G  A NQ+
Sbjct: 6   VGIDLGTTYCCVHIYDE-KRHIVSPILDGSTSQIPSYVSYCGDNILYGAVAMNQI 59


>UniRef50_Q3UYY6 Cluster: 13 days embryo forelimb cDNA, RIKEN
           full-length enriched library, clone:5930424B19
           product:hypothetical protein, full insert sequence; n=3;
           Murinae|Rep: 13 days embryo forelimb cDNA, RIKEN
           full-length enriched library, clone:5930424B19
           product:hypothetical protein, full insert sequence - Mus
           musculus (Mouse)
          Length = 101

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 31/39 (79%), Positives = 35/39 (89%)
 Frame = -2

Query: 758 PKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRSP 642
           P+ VSPAV FTSK+PSS+VRMDTS VPPPRSK+ST RSP
Sbjct: 63  PRCVSPAVAFTSKMPSSIVRMDTSNVPPPRSKMSTCRSP 101


>UniRef50_Q92598 Cluster: Heat shock protein 105 kDa; n=92;
           Eumetazoa|Rep: Heat shock protein 105 kDa - Homo sapiens
           (Human)
          Length = 858

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query: 263 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 439
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
           +LTK+KETAE  L K V + VI+ P
Sbjct: 121 LLTKLKETAENSLKKPVTDCVISVP 145



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNV 657
           +C   VP++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+         R V
Sbjct: 139 DCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIV 198

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G   F VS      G  +V  TA D   G
Sbjct: 199 VFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLG 232



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55


>UniRef50_UPI0000499AA8 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 757

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 32/87 (36%), Positives = 52/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+ D KRLIGR+++   VQ ++K  P++ V  + G   +KV  +GE K F PE++ 
Sbjct: 60  NVKNTVVDVKRLIGRQYDCPDVQTELKELPYQTVKLEDGMIGMKVMMRGEQKVFRPEQII 119

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+L ++K+  E Y      + VI+ P
Sbjct: 120 AMLLIQIKQFTEEYTKDIFTDCVISVP 146



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGERNVLI 663
           +C   VP YF ++QR A  DA  I+G++ LR++NE TA A+AYG+   D   T  R V+I
Sbjct: 140 DCVISVPGYFTENQRIAMLDAAKIAGISCLRLMNEHTATALAYGIYKTDLSETEPRPVVI 199

Query: 664 FDLGGGTFDVSILTI 708
            D+G      S++++
Sbjct: 200 LDVGHCNTTCSVISL 214



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 22/49 (44%), Positives = 32/49 (65%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDA 236
           AVGID+G     V V +   ++I+ N+  NR TP++V+F D ER IG+A
Sbjct: 4   AVGIDIGNRNITVAVVRKKGIDIVVNEVSNRQTPTFVSFNDKERAIGEA 52


>UniRef50_A2VD43 Cluster: Heat shock protein 14; n=3;
           Clupeocephala|Rep: Heat shock protein 14 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 504

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-TGERNVLIFDLGGGT 684
           VP  F++ Q+ A + A   +G NVLR+I+EP+AA +AY + +    G+ +VL++ LGG +
Sbjct: 143 VPFEFDEMQKNALRQAAESAGFNVLRLIHEPSAALLAYDIGQDSPLGKSHVLVYKLGGTS 202

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
             V++L +  G++ V +T  D   G
Sbjct: 203 LSVTVLEVNSGVYRVLATQTDHQTG 227



 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 31/86 (36%), Positives = 51/86 (59%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N  NT+   K+++GR+++D   QA  +     VV+  G P+ ++      K   PE+V+ 
Sbjct: 59  NAANTVVKVKQILGRRYDDPDAQAHKEESKCIVVNKSGLPRYEIDTGATTKYVSPEDVAK 118

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           ++  KMKETA++ LG  V++AVIT P
Sbjct: 119 LIFHKMKETAQSALGSDVKDAVITVP 144



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 25/51 (49%), Positives = 39/51 (76%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           A+G+  G T +CV VF+ G+ +++AND G+R TP+ VA+ DTE+++G AAK
Sbjct: 3   AIGVHFGYTCACVAVFKDGRADVVANDAGDRVTPAVVAYRDTEQIVGIAAK 53


>UniRef50_Q2H062 Cluster: Putative uncharacterized protein; n=2;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Chaetomium globosum (Soil fungus)
          Length = 763

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 38/89 (42%), Positives = 50/89 (56%), Gaps = 5/89 (5%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG---LDKKGTGE--RNVLIFDL 672
           VP +F D+QR+A  DA  I+GL +LR+IN+ TAAA+ YG   LD     E  R V   D+
Sbjct: 143 VPTWFTDAQRRAIIDAAEIAGLRLLRLINDTTAAALGYGITKLDLPAADEKPRRVAFVDV 202

Query: 673 GGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           G   +  SI+  + G   VK  A D H G
Sbjct: 203 GYSDYSCSIVEFKKGELAVKGNAYDRHLG 231



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 27/86 (31%), Positives = 48/86 (55%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N  NT+   KRLIGR  +D  VQ + K+   ++V   G+   +V Y G+ + F   ++++
Sbjct: 59  NLKNTVGSLKRLIGRSLKDPDVQIEQKYVSAQLVEINGQVGAEVQYLGQKEQFTATQLAA 118

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           M  +K+++T  A +   VQ  V++ P
Sbjct: 119 MFFSKIRQTTAAEIKLPVQELVMSVP 144



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG+D G+  + V V ++  V++I N+  NR TPS V F    R +G++AK Q
Sbjct: 4   VGVDFGSLNTVVAVARNRGVDVITNEVSNRATPSLVGFGPKSRYLGESAKTQ 55


>UniRef50_Q05036 Cluster: Uncharacterized protein C30C11.4; n=2;
           Caenorhabditis|Rep: Uncharacterized protein C30C11.4 -
           Caenorhabditis elegans
          Length = 776

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 5/95 (5%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RN 654
           ++C   VP+YF D QR+A   A   +GLN LRI+NE TA A+AYG+ K+   E     RN
Sbjct: 140 SDCVLAVPSYFTDVQRRAVLSAIQYAGLNSLRIVNETTAIALAYGIYKQDLPEEDAKSRN 199

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           V+  D+G  +   S++    G  ++ +T+ D   G
Sbjct: 200 VVFLDIGHSSTQASLVAFNRGKLQMVNTSYDLESG 234



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 43/131 (32%), Positives = 62/131 (47%), Gaps = 6/131 (4%)
 Frame = +2

Query: 140 AREGGDHRQRPGQQDHSVLCCVH---RHRASHRRCRQEPGGVNPNNTIFDAKRLIGRKFE 310
           AR+GG          H+   CV    + R+     RQ     N  NT+ + K LIGRKF 
Sbjct: 18  ARQGGIEVITNDYSLHATPACVSFGPKDRSMGVAARQAVT-TNIKNTVINFKHLIGRKFS 76

Query: 311 DATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG-- 481
           D   Q  +   P +VV        ++V+Y GE  TF PE+V + +LTK++   E+ L   
Sbjct: 77  DPVAQRFIPFIPCKVVKLPNDDIGVQVSYLGEPHTFTPEQVLAALLTKLRTIVESQLSDV 136

Query: 482 KTVQNAVITFP 514
           K V + V+  P
Sbjct: 137 KKVSDCVLAVP 147



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           +G D+G     +GV + G +E+I ND     TP+ V+F   +R +G AA+  V
Sbjct: 4   LGFDIGNLNCYIGVARQGGIEVITNDYSLHATPACVSFGPKDRSMGVAARQAV 56


>UniRef50_P32590 Cluster: Heat shock protein homolog SSE2; n=20;
           Saccharomycetales|Rep: Heat shock protein homolog SSE2 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 693

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 36/89 (40%), Positives = 53/89 (59%), Gaps = 5/89 (5%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGE--RNVLIFDL 672
           VP ++++ QR    DA  I+GLN +RI+N+ TAAA++YG+   D  G  E  R + + D+
Sbjct: 145 VPVWYSEEQRYNIADAARIAGLNPVRIVNDVTAAAVSYGVFKNDLPGPEEKPRIIGLVDI 204

Query: 673 GGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           G  T+  SI+    G  +V  TA D HFG
Sbjct: 205 GHSTYTCSIMAFRKGEMKVLGTAYDKHFG 233



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/87 (25%), Positives = 45/87 (51%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+ + KR+IG KF+D     + K +  ++V    GK  ++V + G+   F   +++
Sbjct: 60  NVKNTVENLKRIIGLKFKDPEFDIENKFFTSKLVQLKNGKVGVEVEFGGKTHVFSATQLT 119

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M + K+K T +     ++ +  +  P
Sbjct: 120 AMFIDKVKHTVQEETKSSITDVCLAVP 146



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 17/51 (33%), Positives = 31/51 (60%)
 Frame = +3

Query: 96  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           G+DLG   S + V ++  ++++ N+  NR+TPS V F    R +G++ K +
Sbjct: 6   GLDLGNNNSVLAVARNRGIDVVVNEVSNRSTPSLVGFGPRNRYLGESGKTK 56


>UniRef50_UPI0000F1F58C Cluster: PREDICTED: similar to Heat shock
           protein 4, partial; n=1; Danio rerio|Rep: PREDICTED:
           similar to Heat shock protein 4, partial - Danio rerio
          Length = 298

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 5/89 (5%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG-----TGERNVLIFDL 672
           VP ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+         RNV+  D+
Sbjct: 1   VPCFYTDAERRSVIDAAQIAGLNCLRLMNETTAVALAYGIYKQDLPAPEEKPRNVVFVDI 60

Query: 673 GGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           G   + VS+     G  ++ +TA D   G
Sbjct: 61  GHSGYQVSVCAFNKGKLKILATAFDPEMG 89


>UniRef50_A5AUN6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 153

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 31/38 (81%), Positives = 33/38 (86%)
 Frame = +3

Query: 150 VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           V+ IANDQGNRT PSYV FT+TERLIGDAAKNQVA  P
Sbjct: 5   VDFIANDQGNRTMPSYVDFTNTERLIGDAAKNQVAMNP 42



 Score = 40.7 bits (91), Expect = 0.038
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +1

Query: 535 RQATKDAGTISGLNVLRIINEPTAA 609
           RQATKDA  I+GL+V+RIINEP AA
Sbjct: 90  RQATKDARAIAGLDVVRIINEPIAA 114


>UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_226_13599_12049 - Giardia lamblia
           ATCC 50803
          Length = 516

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 31/62 (50%), Positives = 44/62 (70%), Gaps = 1/62 (1%)
 Frame = -2

Query: 248 LVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDSYCGCFCH-F 72
           LVLGG++DETL + E ++   G  AL++GDDLH  VL + NA V G+++D+Y  C CH F
Sbjct: 452 LVLGGVADETLCIREGDVGGRGVRALLIGDDLHFFVLINANAGVSGSEVDAYSRCSCHDF 511

Query: 71  VF 66
           +F
Sbjct: 512 IF 513



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 1/81 (1%)
 Frame = -3

Query: 514 RERDNCILHSFAKISFGSFLHFRKHHGTDFLGEKGFVFTLICYLDL-RFASITDNLERPV 338
           R+ D+ +    A++  G  LH  + HG D LG +    TL+  LDL       D+LER V
Sbjct: 362 RDGDDGLGDLVAEVVAGDILHLGEDHGGDLLGSERLRLTLVDNLDLGLLVGAADDLEREV 421

Query: 337 LHVGLHSSIFELTSDETFGIE 275
           L V LH  + E  +D+  G+E
Sbjct: 422 LEVCLHFRVVEPATDQALGVE 442



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 3/84 (3%)
 Frame = -1

Query: 756 KVGVAGGGFHLEDTI--LDGKDGHVEGTAAEVKDKYISFS-STLFVKTVSNRSSSRFIDD 586
           +V VA  G  L+D    +D ++G +E    EVKD+ ++       V+ + + S S  +DD
Sbjct: 278 QVSVASRGLDLKDAGAGVDSQEGDIERPTTEVKDEDVALLLGRRLVEPIGDGSGSGLVDD 337

Query: 585 SENVQARDGTCIFCGLSLRVIEVR 514
           +E+V+  +   +   L+LR+ EVR
Sbjct: 338 AEDVKPSNRAGVLRSLALRIREVR 361


>UniRef50_A0MBW7 Cluster: HSP 70h; n=6; Closterovirus|Rep: HSP 70h -
           Raspberry mottle virus
          Length = 599

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 33/91 (36%), Positives = 53/91 (58%)
 Frame = +1

Query: 487 CAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIF 666
           C+     VPA +N  QR  T+ + +  G   + ++NEP+AAA++  L +    +  +L++
Sbjct: 143 CSGVICSVPAGYNSIQRAFTEQSVSRGGYPCVYMLNEPSAAALS-SLPRLKPEDHRLLVY 201

Query: 667 DLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           D GGGTFDVS +T+    F VK + GD + G
Sbjct: 202 DFGGGTFDVSAVTVNGTTFVVKGSGGDMNLG 232


>UniRef50_P37092 Cluster: Heat shock protein 70 homolog; n=5;
           Closterovirus|Rep: Heat shock protein 70 homolog - Beet
           yellows virus (BYV) (Sugar beet yellows virus)
          Length = 598

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 34/91 (37%), Positives = 53/91 (58%)
 Frame = +1

Query: 487 CAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIF 666
           C      VPA +N  QR  T+    +SG   + ++NEP+AAA++     KG     VL++
Sbjct: 145 CTGVICSVPANYNCLQRSFTESCVNLSGYPCVYMVNEPSAAALSACSRIKGATSP-VLVY 203

Query: 667 DLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           D GGGTFDVS+++  +  F V+++ GD + G
Sbjct: 204 DFGGGTFDVSVISALNNTFVVRASGGDMNLG 234


>UniRef50_Q9QCV8 Cluster: Heat shock 70 protein; n=2; Plum bark
           necrosis and stem pitting-associated virus|Rep: Heat
           shock 70 protein - Plum bark necrosis and stem
           pitting-associated virus
          Length = 223

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 35/90 (38%), Positives = 47/90 (52%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 669
           A CS  VPA +   +R     A    G+ V  +INEPTAA     L+K G      L++D
Sbjct: 132 ASCS--VPADYYSFKRSFVYTACNALGIGVRAVINEPTAAGFCSLLEKTGGATSYTLVYD 189

Query: 670 LGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            GGGTFDVS+L + + +  V  + GD   G
Sbjct: 190 FGGGTFDVSLLAVSNNVIVVVDSRGDNLLG 219


>UniRef50_A2FKE2 Cluster: DnaK protein; n=3; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 573

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 38/86 (44%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VP  F+  Q++  + A   +G+ V+  + E +AAAIAYGL      E+ +LIFD GGGT 
Sbjct: 132 VPTSFSRIQKEKIQIAAKAAGIQVVSFLPESSAAAIAYGL--LNNTEQKLLIFDFGGGTL 189

Query: 688 DVSILTIEDGIFEVK--STAGDTHFG 759
           DVS++ I     EVK  +TAGD+H G
Sbjct: 190 DVSVIEINKN-NEVKELATAGDSHLG 214



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 32/104 (30%), Positives = 57/104 (54%), Gaps = 1/104 (0%)
 Frame = +2

Query: 263 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSM 439
           N  I+D KR +G+ + D  +Q D K WPF++ +D  G  +  ++  G+     PE ++++
Sbjct: 49  NQVIYDTKRALGKMYNDPVIQDDKKSWPFQISADENGYVQYDISDDGKTIHKTPESIAAL 108

Query: 440 VLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA 571
           +L  +         + VQ+AVIT P TS +   K +K+Q+ + A
Sbjct: 109 LLKFLMGKLNMTQTQKVQHAVITVP-TSFSRIQK-EKIQIAAKA 150


>UniRef50_A7QL81 Cluster: Chromosome chr3 scaffold_117, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr3 scaffold_117, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 103

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/36 (80%), Positives = 32/36 (88%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 615
           VPAYFNDSQRQATKDAG I+GLN++ IINEPT A I
Sbjct: 19  VPAYFNDSQRQATKDAGVITGLNLMHIINEPTTAEI 54


>UniRef50_Q1D082 Cluster: DnaK family protein; n=2;
            Cystobacterineae|Rep: DnaK family protein - Myxococcus
            xanthus (strain DK 1622)
          Length = 1293

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 32/83 (38%), Positives = 47/83 (56%)
 Frame = +1

Query: 511  PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFD 690
            P +F D Q  A ++A T++GL+  RI+  P AAA+AY    +G   + VL+ DLGGG   
Sbjct: 914  PTHFTDRQCAALREAATLAGLDAQRILIAPAAAALAYA-HGRGLARKRVLVVDLGGGGLQ 972

Query: 691  VSILTIEDGIFEVKSTAGDTHFG 759
            V ++ +     EV +T GD   G
Sbjct: 973  VCVVQVTGDDLEVITTGGDATLG 995


>UniRef50_A4ZIR9 Cluster: Heat shock protein 70; n=12;
           Closterovirus|Rep: Heat shock protein 70 - Grapevine
           leafroll-associated virus 2
          Length = 599

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = +1

Query: 487 CAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG--LDKKGTGERNVL 660
           C      VPA ++  QR  T    T+SG   + ++NEP+AAA++    ++KK     ++ 
Sbjct: 145 CTGVVCSVPANYDSVQRNFTDQCVTLSGYRCVYMVNEPSAAALSTCNMINKKSA---SLA 201

Query: 661 IFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           ++D GGGTFDVSI++  +  F V+++ GD + G
Sbjct: 202 VYDFGGGTFDVSIISYRNNTFVVRASGGDLNLG 234


>UniRef50_A5B0E9 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 318

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEP-TAAAIAYGL 627
           VPAYFND+QRQATKD G ISGL+V RIINEP TAAA  +GL
Sbjct: 95  VPAYFNDAQRQATKDVGRISGLDVQRIINEPTTAAARGHGL 135


>UniRef50_UPI0000E474BD Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 488

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 31/86 (36%), Positives = 46/86 (53%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+   K ++GRKFED  +Q   +  PF+VV   G    ++    +       EV+ 
Sbjct: 56  NPVNTVMQVKHIVGRKFEDQVIQDLKRQSPFKVVESKGLAGFEIEANNKKNIVSSLEVAG 115

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           +V  K+KE AE   GK ++N V+T P
Sbjct: 116 LVFRKLKEIAEHQGGKDMKNTVLTCP 141



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLD-KKGTGERNVLIFDLGGGTF 687
           P  F+D QR A + A   +G  +LR+I++P+AA +AY +   K     NVL++ LGG + 
Sbjct: 141 PVDFSDGQRAAVRKAAEAAGFKILRLISDPSAAVLAYEIGVTKPHDPCNVLVYRLGGSSV 200

Query: 688 DVSILTIEDGI 720
            VS++ + +G+
Sbjct: 201 SVSVINVTNGL 211



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 21/36 (58%), Positives = 29/36 (80%)
 Frame = +3

Query: 135 FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           F  GK E++AND G+RTTP+ VAFTD E+++G +AK
Sbjct: 15  FSDGKTEVVANDAGDRTTPTAVAFTDNEKIVGLSAK 50


>UniRef50_A5N5I8 Cluster: DnaK4; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK4 - Clostridium kluyveri DSM 555
          Length = 604

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 33/97 (34%), Positives = 52/97 (53%), Gaps = 6/97 (6%)
 Frame = +1

Query: 487 CAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG--LDKKGTGERNVL 660
           C      +P YF D Q    K+   ++G+ ++  I EP AAA+AYG  L      E N+L
Sbjct: 119 CEGAVIALPCYFQDEQCNIIKEGAKLAGIELIGTIQEPVAAALAYGMYLPLNKKREENIL 178

Query: 661 IFDLGGGTFDVSILTI---EDGI-FEVKSTAGDTHFG 759
           +FD GGG+ D+++L +   +D I F + ++ G    G
Sbjct: 179 VFDFGGGSLDITVLKVLEKKDEIQFNILASEGSESLG 215



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           P +GID GTTYS V  +   K EI     G    PS V F   +  +G+ A
Sbjct: 9   PVIGIDFGTTYSSVSKWDGKKAEIYGK-MGEYAIPSVVYFKQGKFDVGNGA 58


>UniRef50_Q4RM18 Cluster: Chromosome 10 SCAF15019, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10
           SCAF15019, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 892

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 34/87 (39%), Positives = 51/87 (58%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NT+   K+  GR F+D  VQA+    P+ +     G   IKV Y  ++K F  E+++
Sbjct: 59  NFKNTVHGFKKFHGRTFDDPFVQAEKPKLPYSLHKMANGSTGIKVRYLDDNKMFTVEQIT 118

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            M+L+K+KET+EA L K V + VI+ P
Sbjct: 119 GMLLSKLKETSEAALKKPVVDCVISVP 145



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 22/53 (41%), Positives = 34/53 (64%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGID+G     + V + G +E IAN+  +R TP+ V+     R+IG+AAK+Q+
Sbjct: 4   VGIDVGFQSCYIAVARSGGIETIANEYSDRCTPACVSLATKNRIIGNAAKSQI 56



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 31/45 (68%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 627
           +C   VP++F D++R++  DA  I+GLN LR+IN+ TA    +G+
Sbjct: 139 DCVISVPSFFTDAERRSVFDATQIAGLNCLRLINDTTAGECLFGV 183



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 5/59 (8%)
 Frame = +1

Query: 598 PTAAAIAYGLDKKGT-----GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           PT A +AYG+ K+       G RNV+  D+G  +F VSI     G  +V + A D + G
Sbjct: 223 PTVA-LAYGIYKQDLPAPEEGPRNVVFVDMGHSSFQVSITAFNKGKLKVLAAAFDPYLG 280


>UniRef50_A7RF55 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 391

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 34/96 (35%), Positives = 56/96 (58%), Gaps = 4/96 (4%)
 Frame = +1

Query: 484 NCAECSYHV----PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER 651
           +C   S HV    P  F + +    ++A   +G ++LRIINEP AAA+AYG+        
Sbjct: 134 HCGSSSNHVVLTVPVNFQEKEVSLLREAAEEAGFHILRIINEPVAAALAYGM-----YNT 188

Query: 652 NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            VL++ LGG + DV++L++ +G+++V +T  D   G
Sbjct: 189 TVLVYRLGGASHDVTLLSVINGMYKVLATEYDGALG 224



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           MA   A+G+ LG T SCV V   G   IIAND G+R TP+ VAF+DTE+ +G  AK
Sbjct: 1   MADYLAIGVHLGATTSCVAVSADGNTTIIANDAGDRVTPAMVAFSDTEKNVGLPAK 56



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 27/86 (31%), Positives = 47/86 (54%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           N  NTI  AKR++G+ + D+ VQ +      +++   G P  +V     +    P+EV +
Sbjct: 62  NARNTILRAKRVLGKSYSDSVVQEEAAALQCKLIDKDGLPYYEVESNERNIQVSPKEVIN 121

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           M+  KM ETA+++ G +  + V+T P
Sbjct: 122 MIYKKMLETAQSHCGSSSNHVVLTVP 147


>UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG07033;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG07033 - Caenorhabditis
           briggsae
          Length = 547

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 28/68 (41%), Positives = 46/68 (67%), Gaps = 1/68 (1%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TPT 266
           ++GIDLGTT+SCV  +Q+G+V ++ N+ G RTTPS +A T D + LIG  AK+ +    +
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNVLENENGCRTTPSVLAMTEDGDCLIGQHAKDVITKATS 61

Query: 267 TQYSMPNV 290
           + + +  +
Sbjct: 62  SLFDVKRI 69



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 1/65 (1%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMV 442
           +++FD KR+IGR+F+D  +Q DM  WPF V  D  G P +++    +   F    VSS++
Sbjct: 61  SSLFDVKRIIGRRFDDVLLQRDMPLWPFRVEKDTDGTPYLQIQNDAKKVKFSAVTVSSLI 120

Query: 443 LTKMK 457
           L  +K
Sbjct: 121 LKCLK 125



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 21/37 (56%), Positives = 28/37 (75%)
 Frame = +1

Query: 649 RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           RN+LI+DLGGGTFDV+++ +E     VK+  GDTH G
Sbjct: 151 RNILIYDLGGGTFDVAVVNVEGPRITVKAKGGDTHLG 187


>UniRef50_A2EVQ1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 1135

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 6/99 (6%)
 Frame = +1

Query: 481 QNC-AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV 657
           +NC A+    +P  FN  Q +  K A   + +++L  I EPTAAAIA  +   G  ++ +
Sbjct: 139 ENCKAKVVLTIPVAFNAEQCERIKSAAKAAKIDILSTIYEPTAAAIASNVMSSGKNQK-L 197

Query: 658 LIFDLGGGTFDVSILTI---EDGIFEVKSTA--GDTHFG 759
           +IFD GGGT DV+I+ +    +G+F+ K+ A  GD   G
Sbjct: 198 MIFDFGGGTLDVTIMEMSKDSEGVFKFKTIAITGDPDLG 236



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGK-PKIKVAYKGEDKTFFPEEV 430
           + P N + + KR+IG+   D  +Q    +W F++V    K    +V  K       PE+ 
Sbjct: 61  IEPGNCLHNIKRIIGKDLLDEDIQNRKSNWDFKLVEGNNKMAAFQVKTKDGRCIVSPEQA 120

Query: 431 SSMVLTKMKETAEA 472
           ++ V  K+   A++
Sbjct: 121 AAHVYKKLINAAKS 134


>UniRef50_A6GJQ9 Cluster: Heat shock protein Hsp70; n=1;
           Plesiocystis pacifica SIR-1|Rep: Heat shock protein
           Hsp70 - Plesiocystis pacifica SIR-1
          Length = 826

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 34/85 (40%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV-LIFDLGGGT 684
           VPA F   Q  AT DA  ++G   + ++ EP A+A+A G     T +    L++DLGGGT
Sbjct: 122 VPALFELPQSSATSDAARMAGFESVELLQEPIASALAAGWS--ATEDPGAWLVYDLGGGT 179

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FD S+L   DG   V    GD   G
Sbjct: 180 FDASLLETADGFLRVVGHDGDNFLG 204



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAK 242
           M KA  VG DLGTT S   VF   +  ++ N QG+  TPS V     ER+ +G  A+
Sbjct: 1   MEKALYVGFDLGTTNSAAAVFDGEQTRVVRNSQGSTLTPSVVRIDGRERVTVGAKAR 57


>UniRef50_Q4XZF4 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 128

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
 Frame = +3

Query: 69  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKN 245
           +  A    +GIDLGTT SCV + +  + ++I N +G RTTPS VAFT D +RL+G  AK 
Sbjct: 36  HNRASGDIIGIDLGTTNSCVAIMEGKQGKVIENAEGFRTTPSVVAFTNDNQRLVGIVAKR 95

Query: 246 QVA*TP 263
           Q    P
Sbjct: 96  QAITNP 101



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKH 340
           NP NT++  KR IGRKF++   + + K+
Sbjct: 100 NPENTVYATKRFIGRKFDEDATKKEQKN 127


>UniRef50_A2DHP3 Cluster: Heat shock protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Heat shock protein,
           putative - Trichomonas vaginalis G3
          Length = 266

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 35/89 (39%), Positives = 47/89 (52%), Gaps = 1/89 (1%)
 Frame = +1

Query: 496 CSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLG 675
           C   VPA    SQR A K    ISG NVL++I EP AA + Y L +       +L+   G
Sbjct: 143 CVITVPAKSTSSQRAAMKRVAEISGFNVLKVITEPVAATV-YALHQVPFQNGKILVCYFG 201

Query: 676 GGTFDVSILTIED-GIFEVKSTAGDTHFG 759
             T D+ ++ +E+   F VKS AGD+  G
Sbjct: 202 ASTLDICVIEVENKKSFTVKSIAGDSSLG 230



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 6/64 (9%)
 Frame = +3

Query: 90  AVGIDLGTT-----YSCVGVFQHGKVEIIANDQ-GNRTTPSYVAFTDTERLIGDAAKNQV 251
           A+GIDLGT      Y+  G  +    E++ NDQ G  TTP+ V+FTD   LIG+ A+   
Sbjct: 3   AIGIDLGTNNSRIAYNTSGPNEIPSFELLLNDQTGKSTTPTLVSFTDDSILIGEEARKVY 62

Query: 252 A*TP 263
           A  P
Sbjct: 63  ADKP 66



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/89 (25%), Positives = 48/89 (53%), Gaps = 1/89 (1%)
 Frame = +2

Query: 260 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSS 436
           P N I+  K ++GR++ +  ++   ++ PF++  D  G P +++   G+ + + PEE+ S
Sbjct: 66  PENAIYGIKPMLGRRYYE--IEKLFRNCPFKISYDSDGWPIVEITQNGKVEMYSPEEMMS 123

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFPRTS 523
            +  ++     +  GK  ++ VIT P  S
Sbjct: 124 FIFGELNNMVTSRAGKE-KSCVITVPAKS 151


>UniRef50_A0CZG2 Cluster: Chromosome undetermined scaffold_32, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_32,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 232

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 32/84 (38%), Positives = 45/84 (53%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAY N  + +  +    +       ++         Y L  K + E  +LIFDLG GT 
Sbjct: 19  VPAYLNTIKDKPQRMLAPLLVQKFQELLMSLELLLFVYDLYNKSSYENKILIFDLGSGTL 78

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L+IE G+ EV++TAGD  FG
Sbjct: 79  DVSLLSIEVGVVEVRATAGDIDFG 102



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = +2

Query: 452 MKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA*TFSESSMN 598
           M ++ + Y+ ++VQ  VI+ P    T+KDKPQ+M  P L   F E  M+
Sbjct: 1   MDDSIDMYV-QSVQIIVISVPAYLNTIKDKPQRMLAPLLVQKFQELLMS 48


>UniRef50_Q8SWH2 Cluster: Similarity to HSP70-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: Similarity to
           HSP70-RELATED PROTEIN - Encephalitozoon cuniculi
          Length = 687

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 8/92 (8%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA--YGLDKKG------TGERNVLI 663
           VPAYF+ +Q  AT  A  ++G     I  EP+AAA A  Y L +KG        + N+ +
Sbjct: 193 VPAYFDVNQVAATIKAAEMAGFPTPIIWKEPSAAAFAHTYDLIRKGITTKEEVDDMNICV 252

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           FDLGGGTFDVSI+    G   V S  G+   G
Sbjct: 253 FDLGGGTFDVSIVESSGGFMMVPSYGGNNFLG 284



 Score = 39.5 bits (88), Expect = 0.088
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           + ++ AVGIDLGTTYSC+ V+         + +  G  T PS V F       GD  K++
Sbjct: 27  LRESVAVGIDLGTTYSCISVYSPSSKDTRFVLSPGGEETYPSVVYFKKLPE--GDGKKSK 84


>UniRef50_A7DID8 Cluster: Glutamate dehydrogenase; n=14;
           Alphaproteobacteria|Rep: Glutamate dehydrogenase -
           Methylobacterium extorquens PA1
          Length = 728

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 35/81 (43%), Positives = 47/81 (58%)
 Frame = -1

Query: 750 GVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQ 571
           GVA    HLE  + D KD HVEG AAEV D+    +  L V+ V  R   R +DD+++ +
Sbjct: 456 GVAVRRLHLEHAVADLKDRHVEGAAAEVVDR--DGAGLLLVEAVGERRRRRLVDDAQHFE 513

Query: 570 ARDGTCIFCGLSLRVIEVRGN 508
           A D   I  GL+L V+EV G+
Sbjct: 514 AGDLAGILGGLTLGVVEVGGH 534


>UniRef50_A4EA23 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 516

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 33/80 (41%), Positives = 52/80 (65%)
 Frame = -1

Query: 756 KVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSEN 577
           +V +A GG +L+  + + +DG VEGTAA+VKD+  +    L V+ +   SS R +DD+ +
Sbjct: 296 QVVIARGGQNLKHAVGEVEDGDVEGTAAQVKDQN-TLVGALLVQAIGQSSSGRLVDDTLD 354

Query: 576 VQARDGTCIFCGLSLRVIEV 517
           V+A D T +  GL+L V+EV
Sbjct: 355 VEAGDLTGVLGGLTLGVVEV 374


>UniRef50_A2DZ76 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 641

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 5/89 (5%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           +P  FN  Q +  K A  ++GL+++  I EPTAAAI+ G+      ++ ++IFD GGGT 
Sbjct: 150 IPVAFNVEQCERIKTAAKVAGLDIIATIYEPTAAAISSGM--MTDKDKKLMIFDFGGGTL 207

Query: 688 DVSILTIE-----DGIFEVKSTAGDTHFG 759
           DV+I+ I+     +  FE  + +GD   G
Sbjct: 208 DVTIMQIKKKDQNESFFETIAESGDPDLG 236



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +2

Query: 260 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSS 436
           P N++ + KR+IG++ +D  +Q    +W F +V D  G    +V   G+     PEE +S
Sbjct: 64  PGNSLHNIKRIIGKRLDDPDIQRRKDNWDFTLVKDERGMAAFQVNDNGKKVIVKPEEAAS 123

Query: 437 MVLTKM 454
            + TK+
Sbjct: 124 KIFTKL 129



 Score = 34.3 bits (75), Expect = 3.3
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFTD 212
           MAK   V ID GTT SC+ +  H G+  +     GN   P+ + F D
Sbjct: 1   MAKKSGVAIDFGTTNSCIAIALHTGQDTMPILIDGNNYVPTNLTFVD 47


>UniRef50_Q1NQZ1 Cluster: Glutamate dehydrogenase precursor; n=1;
           delta proteobacterium MLMS-1|Rep: Glutamate
           dehydrogenase precursor - delta proteobacterium MLMS-1
          Length = 656

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 30/78 (38%), Positives = 49/78 (62%)
 Frame = -1

Query: 750 GVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQ 571
           GVA GG + +D + D +DG++EG+A +VKD+ +  +  L V+ +  R     +DD  ++Q
Sbjct: 426 GVAVGGLYFKDPVADLQDGNIEGSATKVKDRDLLLA--LLVQAIGQRGGGGLVDDPLDIQ 483

Query: 570 ARDGTCIFCGLSLRVIEV 517
           A D T +  GL+L +IEV
Sbjct: 484 AGDLTGVLGGLALGIIEV 501



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = -2

Query: 248 LVLGGISDETLG-VCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDS 96
           L LG +  + LG V + + RR G + L VGD L      D +ARV G+Q++S
Sbjct: 589 LALGHLPHQPLGGVVKSHHRRGGAITLGVGDHLGFTAFHDRHARVGGSQVNS 640


>UniRef50_Q01M68 Cluster: OSIGBa0114M03.5 protein; n=4; Oryza
           sativa|Rep: OSIGBa0114M03.5 protein - Oryza sativa
           (Rice)
          Length = 581

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 28/81 (34%), Positives = 52/81 (64%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VP++FN+ QR+    AG  +GL +L++I+EP AAA++    K+G     V++F +G G++
Sbjct: 108 VPSFFNEQQREDIMSAGRRAGLEILQLIDEPIAAALSSTTIKEGV----VVVFGMGAGSY 163

Query: 688 DVSILTIEDGIFEVKSTAGDT 750
            V++L +     E+++  GD+
Sbjct: 164 SVAVLHVSGMNIEMRAQCGDS 184



 Score = 41.1 bits (92), Expect = 0.029
 Identities = 21/67 (31%), Positives = 39/67 (58%)
 Frame = +2

Query: 260 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 439
           P++ +F+ K LIG+ F D+ VQ   K  PF ++ +G + +  V   G   +  P E+++ 
Sbjct: 28  PSDVVFNVKNLIGKHFNDSCVQEMRKRLPFSII-EGPEGESCVEIHGIKLS--PVEITTA 84

Query: 440 VLTKMKE 460
           + TK+K+
Sbjct: 85  IFTKLKD 91


>UniRef50_A0PTC6 Cluster: Chaperone protein DnaK1; n=3;
           Mycobacterium|Rep: Chaperone protein DnaK1 -
           Mycobacterium ulcerans (strain Agy99)
          Length = 512

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 34/92 (36%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT---GERNVLI 663
           E +  VPA  + +QR  T DA   +G  V+ ++NEP+AA++ Y    + T       V+I
Sbjct: 118 EAAISVPANASSAQRFLTLDAFVAAGFQVVALLNEPSAASLEYAHRYRSTITAKSEYVVI 177

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +DLGGGTFD S+L +   I +V  + G    G
Sbjct: 178 YDLGGGTFDASLLKMTGHINDVVRSEGIQRLG 209


>UniRef50_Q00YD5 Cluster: Heat shock protein 91-Arabidopsis
           thaliana; n=1; Ostreococcus tauri|Rep: Heat shock
           protein 91-Arabidopsis thaliana - Ostreococcus tauri
          Length = 779

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 34/92 (36%), Positives = 49/92 (53%), Gaps = 3/92 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG--TGER-NVLI 663
           +C   VP Y  D+ R+A  DA ++ GLNVLR+++E TA A++YG+ K    T E  NV  
Sbjct: 167 DCVISVPVYATDAHRRAMLDAASMCGLNVLRLLHETTATALSYGIFKTAEFTDEPVNVAF 226

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            D+G     V I        ++ ST  D + G
Sbjct: 227 VDVGHSAMQVCIAQFTKSGLKILSTGFDRNLG 258



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 30/88 (34%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEV 430
           + P NT+   KRL+GR F+D  VQ D++   + V     G+   ++ Y G+ K F PE+ 
Sbjct: 86  MKPRNTVTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQC 145

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
            + +L+ +K  AE   G  V + VI+ P
Sbjct: 146 VASILSDLKRIAEKDNGTKVTDCVISVP 173



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/53 (35%), Positives = 32/53 (60%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           VGID G   + V + +   ++++ ND+  R TPS V F + +R IG AA +++
Sbjct: 32  VGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKI 84


>UniRef50_Q98159 Cluster: ORF1 protein; n=2; Little cherry virus
           1|Rep: ORF1 protein - Little cherry virus 1
          Length = 618

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI-AYGLDKKGTGERNVLIFD 669
           E +  VPA +   QR   +    + G+ V RIINEP+AAA+    ++ K   E N ++FD
Sbjct: 139 EVNISVPADYTTRQRIYMRSIVNLLGIPVRRIINEPSAAAMHQLFINPK---ENNFVVFD 195

Query: 670 LGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            GGGTFDVS +     I  +  TAGD   G
Sbjct: 196 FGGGTFDVSYIKKHGKIVSIIDTAGDLFLG 225


>UniRef50_A6NJU0 Cluster: Uncharacterized protein HSPA14; n=2;
           Eutheria|Rep: Uncharacterized protein HSPA14 - Homo
           sapiens (Human)
          Length = 143

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53


>UniRef50_P38788 Cluster: Ribosome-associated complex subunit SSZ1;
           n=12; Saccharomycetales|Rep: Ribosome-associated complex
           subunit SSZ1 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 538

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 28/84 (33%), Positives = 48/84 (57%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VP  F++ Q+ A K +    GL +++ INEP+AA +A+        + NV++ D GG   
Sbjct: 145 VPTNFSEEQKTALKASAAKIGLQIVQFINEPSAALLAHAEQFPFEKDVNVVVADFGGIRS 204

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           D +++ + +GIF + +TA D   G
Sbjct: 205 DAAVIAVRNGIFTILATAHDLSLG 228



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 28/86 (32%), Positives = 42/86 (48%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTI + +  IG  F+   V       P  V  DG    +    +G+++    +EV S
Sbjct: 62  NPKNTIINFRDFIGLPFDKCDVSKCANGAP-AVEVDGKVGFVISRGEGKEEKLTVDEVVS 120

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
             L ++K  AE Y+G  V+ AV+T P
Sbjct: 121 RHLNRLKLAAEDYIGSAVKEAVLTVP 146


>UniRef50_A7BCD2 Cluster: Putative uncharacterized protein; n=1;
           Actinomyces odontolyticus ATCC 17982|Rep: Putative
           uncharacterized protein - Actinomyces odontolyticus ATCC
           17982
          Length = 504

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 3/82 (3%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERN-VLIFDLGG 678
           +PA+   +QR  T +A   +G +VL ++NEP+AA   Y     GT   +R  +L++DLGG
Sbjct: 129 IPAHAWSAQRFLTLEAFRRAGWDVLAMVNEPSAAGFEYTHRHAGTLNSKRTAILVYDLGG 188

Query: 679 GTFDVSILTIEDGIFEVKSTAG 744
           GTFD SI++    + EVK + G
Sbjct: 189 GTFDASIVSATGTLHEVKGSRG 210


>UniRef50_UPI000049A3E9 Cluster: 70 kDa heat shock protein; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: 70 kDa heat shock
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 674

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 31/84 (36%), Positives = 46/84 (54%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VP  F+DSQR AT+ A  ++G+  + IINEP+A  + Y  +        V++ D GGGT 
Sbjct: 152 VPVNFSDSQRLATERAVRLAGVKDVNIINEPSATILLYQNEFHIKEGNRVVVIDFGGGTL 211

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV    I+    +V S  G+ + G
Sbjct: 212 DVCCCVIQKDGIKVLSNGGNQNLG 235



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 3/83 (3%)
 Frame = +2

Query: 275 FDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV--AYKGEDKTFFPEEVSSMVLT 448
           +D+KRL+GRK  D  +  + + W FEVV   G   + +      E++ F  EEVS  ++ 
Sbjct: 72  YDSKRLVGRKV-DEIMDWEKRLWSFEVVEKYGMSALSIYNPLTEENEVFVAEEVSGFLVR 130

Query: 449 KMKETAE-AYLGKTVQNAVITFP 514
           K+ +  +       ++  V+T P
Sbjct: 131 KLMDIVKGTQSNPIIEGVVVTVP 153



 Score = 33.5 bits (73), Expect = 5.8
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 4/61 (6%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER----LIGDAAKNQ 248
           K  +VGIDLGTT   V   + G    I         PS+++ ++ +     +IG+AAKN 
Sbjct: 5   KIVSVGIDLGTTCCYVACIEDGNEPKILLMNNEDYLPSWISLSNVKNGLGVIIGEAAKNN 64

Query: 249 V 251
           +
Sbjct: 65  I 65


>UniRef50_UPI0000499107 Cluster: 70 kDa heat shock protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 70 kDa heat shock
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 559

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 33/85 (38%), Positives = 53/85 (62%), Gaps = 4/85 (4%)
 Frame = +2

Query: 272 IFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKV--AYKGEDKTFFPEEVSSMV 442
           ++D+KR+IG    D + + D KHWPF V+ ++ GK  ++V   +K +D+ F PEE+S MV
Sbjct: 72  LYDSKRIIGSDISDISDE-DKKHWPFTVIGNNNGKACMEVYNPFKQKDEIFEPEEISGMV 130

Query: 443 LTKMKETAEAYLGKT-VQNAVITFP 514
           L  +   A++ L  T + N V+T P
Sbjct: 131 LKNLILMAKSKLDNTEIGNIVVTVP 155



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG--TGERNVLIFDLGGG 681
           VP  F+D +R AT  A  ++G+  + ++NEP AA + Y        + +  V++ D GGG
Sbjct: 154 VPTEFDDKKRNATLAACKLAGIENVTLVNEPVAALVEYKRTHNDVLSNDSKVVVIDFGGG 213

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           T D+    ++       S  GD + G
Sbjct: 214 TLDICCCKLQGKDISTVSVGGDKNLG 239



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 5/76 (6%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQH-GKVEIIANDQ-GNRTTPSYVAFTDTER---LIGDAAKNQVA* 257
           VGID GTT+S +  +    K +   ND+ GN+  PS+V+F   E    +IG+ AKN++  
Sbjct: 9   VGIDFGTTFSSIAYYNPLNKTDCTINDEGGNKQIPSWVSFAQMENSGVIIGNGAKNEIFG 68

Query: 258 TPTTQYSMPNVSSDVS 305
                 S   + SD+S
Sbjct: 69  ECVLYDSKRIIGSDIS 84


>UniRef50_Q9GYV8 Cluster: 70-kDa heat shock protein; n=5; Entamoeba
           histolytica|Rep: 70-kDa heat shock protein - Entamoeba
           histolytica
          Length = 558

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 34/88 (38%), Positives = 50/88 (56%), Gaps = 4/88 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT---GERNVLIFDLGG 678
           VP  FND QR AT  A  ++ +  + ++NEPTAA + Y  +   +   G+R +L+ D GG
Sbjct: 156 VPVDFNDRQRDATLLACKLAEIKNVELVNEPTAAIVEYKREYPNSLKDGDR-ILVIDFGG 214

Query: 679 GTFDVSIL-TIEDGIFEVKSTAGDTHFG 759
           GT DV+    I D   +V+S+ GD   G
Sbjct: 215 GTLDVACCKIINDNNIKVESSGGDQDLG 242



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 32/90 (35%), Positives = 46/90 (51%), Gaps = 4/90 (4%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT---FFPEE 427
           N    I+D+KR+IGR   D   + D  +WPFEV S          Y  + ++   F PEE
Sbjct: 69  NNECVIYDSKRIIGRGECDVNYE-DRDNWPFEVKSRNNGSAYIECYNPQTQSAEEFEPEE 127

Query: 428 VSSMVLTKMKETAEAYL-GKTVQNAVITFP 514
           +S M+L  M + A+A L    V N ++T P
Sbjct: 128 ISGMILKHMYDIAQASLKNGQVTNVIVTVP 157



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 6/59 (10%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTER----LIGDAAKNQ 248
           ++GIDLGTTYS +  +    G+  I+ ++ G     S+V+ +  ++    +IG++AKN+
Sbjct: 9   SIGIDLGTTYSSIAYYDITRGESVIVQDELGKEQVASWVSLSRLDKSGYTIIGNSAKNE 67


>UniRef50_Q86JV8 Cluster: Similar to heat shock protein; n=2;
           Dictyostelium discoideum|Rep: Similar to heat shock
           protein - Dictyostelium discoideum (Slime mold)
          Length = 926

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/89 (31%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +1

Query: 469 SLSWQNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE 648
           S +  +  +C+  +P YF   QRQA  DA  ++GLNVL +I++  AAA+++ +D+    +
Sbjct: 156 SYAGSSIKDCAITIPPYFTQQQRQALLDAAQLAGLNVLSLIHDVNAAALSFAMDRTFLEK 215

Query: 649 -RNVLIFDLGGGTFDVSILTIEDGIFEVK 732
             +V+ +D+G     VS++  E    ++K
Sbjct: 216 NESVIFYDMGARHTSVSLVEFESHNEQIK 244



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/88 (25%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWP--FEVVSDGGKPKIKVAYKGEDKTFFPEEV 430
           NP       +  +G K+++  V+      P  F+V +D  +  + + Y  +D  +  EE+
Sbjct: 84  NPKQNYNLIQAFLGIKYKEGLVEEISNGLPLGFKVKNDTVRNTVSIVYD-DDTNYSAEEL 142

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           + M+L ++K+ A +Y G ++++  IT P
Sbjct: 143 TGMLLRRVKDMASSYAGSSIKDCAITIP 170



 Score = 37.1 bits (82), Expect = 0.47
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA* 257
           A +  +GIDLG+    V + + G  E + N+Q  R T S V +   ERL    + +  A 
Sbjct: 24  ANSMVIGIDLGSQTFKVSLIKPGAFETVLNEQSGRKTISSVGWFKDERLFSSDSFSVWAR 83

Query: 258 TPTTQYSM 281
            P   Y++
Sbjct: 84  NPKQNYNL 91


>UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative gdh;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           putative gdh - Nasonia vitripennis
          Length = 486

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 30/80 (37%), Positives = 48/80 (60%)
 Frame = -1

Query: 756 KVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSEN 577
           +V V  GG  LED+++DG+   ++GT  +V+D+ +   S L VKTVS+      +DD  +
Sbjct: 299 QVSVTVGGNDLEDSVVDGQKTDIKGTTTQVEDENV-LLSVLLVKTVSDGGGGGLVDDPHH 357

Query: 576 VQARDGTCIFCGLSLRVIEV 517
           ++  D + I  GL L V+EV
Sbjct: 358 LETGDDSGILGGLPLSVVEV 377



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 28/86 (32%), Positives = 46/86 (53%)
 Frame = -3

Query: 514 RERDNCILHSFAKISFGSFLHFRKHHGTDFLGEKGFVFTLICYLDLRFASITDNLERPVL 335
           R+ D+ +     ++S   FLH  K+H  DFL  + FV      LD+  A + D+ ER  L
Sbjct: 379 RDGDDGVGDLLTEVSLRGFLHLSKNHSRDFLRSEDFVALAGGDLDMGLAVLLDDFEREEL 438

Query: 334 HVGLHSSIFELTSDETFGIEYCVVGV 257
            + L+ S+    ++ET G+E+ V+ V
Sbjct: 439 DIVLNGSVGPFATNETLGVEHGVLRV 464


>UniRef50_Q8NN35 Cluster: Molecular chaperone; n=3;
           Corynebacterium|Rep: Molecular chaperone -
           Corynebacterium glutamicum (Brevibacterium flavum)
          Length = 484

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 32/87 (36%), Positives = 51/87 (58%), Gaps = 3/87 (3%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT---GERNVLIFDLGG 678
           VPA  + +QR  T  A + +G+ V+ ++NEP+AAA  Y      T     + ++++DLGG
Sbjct: 127 VPANSHSAQRLLTMSAFSATGITVVGLVNEPSAAAFEYTHRHARTLNSKRQAIVVYDLGG 186

Query: 679 GTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GTFD S++ I+    EV S+ G +  G
Sbjct: 187 GTFDSSLIRIDGTHHEVVSSIGISRLG 213


>UniRef50_A5VT75 Cluster: Putative NAD-specific glutamate
           dehydrogenase encoded in antisense gene pair with dnaKJ;
           n=1; Brucella ovis ATCC 25840|Rep: Putative NAD-specific
           glutamate dehydrogenase encoded in antisense gene pair
           with dnaKJ - Brucella ovis (strain ATCC 25840 / 63/290 /
           NCTC 10512)
          Length = 1124

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 34/84 (40%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = -1

Query: 756 KVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDKY-ISFSSTLFVKTVSNRSSSRFIDDSE 580
           K  VA GG H ++ + D ++ HVE TAA+V D   ++F+    V+T+  RS  R +DD++
Sbjct: 457 KERVAIGGLHFKNAVADFQNRHVESTAAKVIDSDGLAFA---LVETIGKRSRGRLVDDAQ 513

Query: 579 NVQARDGTCIFCGLSLRVIEVRGN 508
           N Q  D   I  GL+L V+EV  N
Sbjct: 514 NFQTGDLAGILGGLTLGVVEVGRN 537



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 2/67 (2%)
 Frame = -3

Query: 514 RERDNCILHSFAKISFGSFLHFRKHHGTDFLGEKGFVFTLICYLD--LRFASITDNLERP 341
           R RD+ + + FAK+ F  FLH  K HG D L  + F   L  +LD  +   ++ D +   
Sbjct: 536 RNRDDGLRNGFAKVGFSRFLHLLKDHGGD-LRRRIF---LAVHLDPGIAIVALDDLVRNK 591

Query: 340 VLHVGLH 320
           +L +G H
Sbjct: 592 ILVLGDH 598


>UniRef50_A2EFJ4 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 719

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 5/89 (5%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           +P  FN  Q +  K A   +G++++  I EPTAAAI+ G+      ++ ++IFD GGGT 
Sbjct: 153 IPVAFNVEQCERIKLAARAAGIDIIATIYEPTAAAISSGM--MAATDKKLMIFDFGGGTL 210

Query: 688 DVSILTIEDG-----IFEVKSTAGDTHFG 759
           DV+I+ ++ G     +F   +  GD   G
Sbjct: 211 DVTIMQVQRGQNGSSVFTTIAETGDPDLG 239



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMV 442
           N I + KR+IG+K  D  +Q  +  W F++V D  G    KV  K ++    PE+ ++++
Sbjct: 69  NCIHNIKRIIGKKLNDPDIQKHINKWDFKLVEDNKGMAAFKVVSKNKEIIVTPEQAATLI 128

Query: 443 LTKM 454
             K+
Sbjct: 129 FKKL 132


>UniRef50_P87142 Cluster: Heat shock protein 70 homolog C57A7.12;
           n=1; Schizosaccharomyces pombe|Rep: Heat shock protein
           70 homolog C57A7.12 - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 566

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 25/88 (28%), Positives = 52/88 (59%)
 Frame = +1

Query: 496 CSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLG 675
           C   VP YF D+QR+A + A   +GL VL++I++P A  +A    ++   ++ V++ + G
Sbjct: 166 CVMSVPVYFTDAQRKALESAANEAGLPVLQLIHDPAAVILALMYSEEVLIDKTVVVANFG 225

Query: 676 GGTFDVSILTIEDGIFEVKSTAGDTHFG 759
               +VS+++++ G+  + ++  D + G
Sbjct: 226 ATRSEVSVVSVKGGLMTILASVHDENLG 253



 Score = 39.5 bits (88), Expect = 0.088
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           +GI  G   S +   + GK +++AN++GNR  PS +++   +   G  A+ Q+
Sbjct: 27  IGISFGNQNSSIAFNRDGKTDVLANEEGNRQIPSILSYHGDQEYHGVQARGQL 79


>UniRef50_O71192 Cluster: 59 kDa protein; n=26; Grapevine
           leafroll-associated virus 3|Rep: 59 kDa protein -
           Grapevine leafroll-associated virus 3
          Length = 549

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 33/84 (39%), Positives = 46/84 (54%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA +N  +R    +A    G+ V  ++NEPTAAA+ Y L K    +  + +FD GGGTF
Sbjct: 145 VPADYNSFKRSFVVEALKGLGIPVRGVVNEPTAAAL-YSLAKSRVEDLLLAVFDFGGGTF 203

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS +  +  I  V  + GD   G
Sbjct: 204 DVSFVKKKGNILCVIFSVGDNFLG 227


>UniRef50_A0ZXN0 Cluster: Heat shock protein 70-like; n=1; Fig leaf
           mottle-associated virus 2|Rep: Heat shock protein
           70-like - Fig leaf mottle-associated virus 2
          Length = 208

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 26/61 (42%), Positives = 37/61 (60%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA +N  +R     A    G+N   ++NEPTAAA+   +  K T  R++L++D GGGTF
Sbjct: 148 VPADYNSYKRTFISLASQEVGVNTAGVVNEPTAAALFSSMSSKSTPTRSILVYDFGGGTF 207

Query: 688 D 690
           D
Sbjct: 208 D 208


>UniRef50_Q1YJU7 Cluster: Possible chaperone protein; n=1;
           Aurantimonas sp. SI85-9A1|Rep: Possible chaperone
           protein - Aurantimonas sp. SI85-9A1
          Length = 628

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 31/99 (31%), Positives = 52/99 (52%), Gaps = 7/99 (7%)
 Frame = +1

Query: 484 NCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY--GLDKKGT----- 642
           N  +    +P  F   +R+A + A + +G+ V++ ++EP AA  A+   LD         
Sbjct: 116 NVRQAVMTIPVNFGGPERRALRAAASKAGIGVVQFVHEPVAALYAHLRSLDNFAREVARM 175

Query: 643 GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           G+RN+L+FD GGGT D+++  I+ G      + GD   G
Sbjct: 176 GDRNMLVFDWGGGTLDLTLCRIQGGTIHQIESLGDNEVG 214


>UniRef50_Q57VU9 Cluster: Heat shock 70 kDa protein, putative; n=4;
           Trypanosoma|Rep: Heat shock 70 kDa protein, putative -
           Trypanosoma brucei
          Length = 870

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 34/97 (35%), Positives = 56/97 (57%), Gaps = 13/97 (13%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG--------TGERNV-- 657
           VPA+F   Q+ AT+DA   +G +VL +I+EP+AA +A+ + +          +G + +  
Sbjct: 211 VPAFFTPQQKVATEDAALAAGFDVLEVIDEPSAACLAHTVLQPSNASSREHLSGSKRIVR 270

Query: 658 -LIFDLGGGTFDVSILTIE--DGIFEVKSTAGDTHFG 759
            L+FDLGGGT D +++  +   G F + +T GD   G
Sbjct: 271 SLVFDLGGGTLDCAVMENDRRRGTFTLVATHGDPLLG 307


>UniRef50_Q9Y4L1 Cluster: Hypoxia up-regulated protein 1 precursor;
           n=39; Deuterostomia|Rep: Hypoxia up-regulated protein 1
           precursor - Homo sapiens (Human)
          Length = 999

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 25/71 (35%), Positives = 48/71 (67%), Gaps = 3/71 (4%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK---GTGERNVLIFDLGG 678
           VP +FN ++R+A   A  ++GL VL++IN+ TA A++YG+ ++    T  +N++ +D+G 
Sbjct: 176 VPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGS 235

Query: 679 GTFDVSILTIE 711
           G+   +I+T +
Sbjct: 236 GSTVCTIVTYQ 246



 Score = 36.3 bits (80), Expect = 0.82
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWP-FEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           NP  T+   + L+G++ ++  V      +P  E+  D  +  +      + + F PEEV 
Sbjct: 92  NPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQ-FSPEEVL 150

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
            MVL   +  AE +  + +++AVIT P
Sbjct: 151 GMVLNYSRSLAEDFAEQPIKDAVITVP 177



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93


>UniRef50_Q7T733 Cluster: P60; n=2; Little cherry virus 2|Rep: P60 -
           Little cherry virus 2
          Length = 544

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 684
           VPA +N  +R    ++  +    ++ ++NEPTAAA+   L    + +  +V ++D GGGT
Sbjct: 151 VPADYNSYKRSFLLESSKLLDQEIIAVVNEPTAAALYSALKLVSSNKAEHVAVYDFGGGT 210

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FDVS L +      V  TAGD   G
Sbjct: 211 FDVSYLCLYGRSATVLDTAGDLFLG 235


>UniRef50_A0NRW0 Cluster: Heat shock protein Hsp70; n=1; Stappia
           aggregata IAM 12614|Rep: Heat shock protein Hsp70 -
           Stappia aggregata IAM 12614
          Length = 815

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 33/85 (38%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA-YGLDKKGTGERNVLIFDLGGGT 684
           +PA FN  Q +AT  A  ++GL  + ++ EP AAA+A     KK  G    L++DLGGGT
Sbjct: 94  IPAAFNQMQNEATISAAKMAGLKRVSLLQEPVAAAMASIAHSKKRDGV--FLVYDLGGGT 151

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
           FDV+++    G   V +  G    G
Sbjct: 152 FDVALVLSTQGAVNVIAHEGINMLG 176


>UniRef50_Q7M2S5 Cluster: DnaK-type molecular chaperone; n=1; Sus
           scrofa domestica|Rep: DnaK-type molecular chaperone -
           Sus scrofa domestica (domestic pig)
          Length = 167

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 29/38 (76%), Positives = 32/38 (84%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 621
           VPAYFND      +DAGTI+GLNV+RIINEPTAAAIAY
Sbjct: 50  VPAYFND------RDAGTIAGLNVMRIINEPTAAAIAY 81


>UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 876

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGL---NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGG 678
           VPA F++++    ++A  I+       + +I EP+AA+I + +    T     LI+D GG
Sbjct: 147 VPANFDEAETTDVRNAIKIAKFPHPEKVTLIKEPSAASICF-VHTASTANARALIYDFGG 205

Query: 679 GTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GTFD+S++ I+    EVK   GD H G
Sbjct: 206 GTFDLSLVEIKGTTIEVKDNHGDPHLG 232



 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 25/83 (30%), Positives = 49/83 (59%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 445
           N ++D+KR++G+ ++   ++ D+ +W F+V+    KP IK+     D+  FP +VS+ +L
Sbjct: 72  NVVYDSKRMLGKSYDQ--IKEDIPNWTFDVIEKDSKPVIKL---DGDREIFPYQVSATIL 126

Query: 446 TKMKETAEAYLGKTVQNAVITFP 514
             +++  E   G  + N +IT P
Sbjct: 127 DYLRQQLEK-KGIPLDNVIITVP 148



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +3

Query: 66  KYKMAKAPA-VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 242
           K K  + P  +GIDLGTTY  V  +++ K+E I    G  T PS V + +    +G  A+
Sbjct: 4   KEKPQQPPVYIGIDLGTTYCSVAKYENNKLETI-EFNGTSTIPSRVYYGEFNS-VGYQAQ 61

Query: 243 NQV 251
            Q+
Sbjct: 62  QQM 64


>UniRef50_Q3VZ88 Cluster: Heat shock protein Hsp70; n=1; Frankia sp.
           EAN1pec|Rep: Heat shock protein Hsp70 - Frankia sp.
           EAN1pec
          Length = 579

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +1

Query: 511 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFD 690
           PA ++D +R   +DA  ++GL  + ++ EPTAAA+ Y   ++      + I+DLGGGTFD
Sbjct: 119 PATWSDHRRGLMEDAAGLAGLGQVGLVAEPTAAAMYYAAQERLEPGALLGIYDLGGGTFD 178

Query: 691 VSILTIEDGIFEV-KSTAGDTHFG 759
            ++L    G FE+     GD   G
Sbjct: 179 ATVLRKTAGGFELCGDPGGDDEIG 202



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 84  APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*T 260
           A A+GID+GTT++   +++ G+ E       +   PS +   D    L+G+AA+ +    
Sbjct: 2   AYALGIDVGTTFTAGAIWRDGRAEAFGLGTHSTAVPSVLFLRDDGVMLVGEAAEQRAVTE 61

Query: 261 PT 266
           P+
Sbjct: 62  PS 63


>UniRef50_Q5C1F3 Cluster: SJCHGC04997 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC04997 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 252

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +N  NT  D  RL+G++  D TV    K    +V  S  G+  +     GE  +F PE++
Sbjct: 59  MNTRNTFTDFTRLLGKRLSDLTVVDGRKFTTHQVEESSDGRITLSAVLNGEKTSFVPEQI 118

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
            ++ + K+KE AEA +G  V + V+  P
Sbjct: 119 LAIQMNKLKEVAEATIGSKVVDVVVNVP 146



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 5/90 (5%)
 Frame = +1

Query: 505 HVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-----RNVLIFD 669
           +VP Y+ D++R+A  DA  ++GLN ++++N+ TA   AYG  K    +     + V    
Sbjct: 144 NVPTYYTDTERRAVLDATKVAGLNCVKVVNDITAIGTAYGFYKTDLPQPELPPKVVAFVS 203

Query: 670 LGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +G  T  V I +   G  +V +T  D   G
Sbjct: 204 VGYSTTQVGICSFNIGKLKVLATTCDAFLG 233



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/52 (46%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG D+GT  S +GV + G +E+I N+   R TP+ VAF+    L+G AAK Q
Sbjct: 5   VGFDIGTLTSYIGVARGGGIEVITNEYSERATPTCVAFSGELVLVGTAAKLQ 56


>UniRef50_Q805J2 Cluster: Heat shock protein 70-like protein; n=139;
           Crinivirus|Rep: Heat shock protein 70-like protein -
           Strawberry pallidosis associated virus
          Length = 556

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 33/92 (35%), Positives = 47/92 (51%)
 Frame = +1

Query: 484 NCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLI 663
           N    +  VPA +   QR   K        ++ RIINEP+AAAI Y + K     +  L+
Sbjct: 138 NIISLNVSVPADYKCKQRMFMKSVCDSLNFSLRRIINEPSAAAI-YSVSKY-PNYKYFLM 195

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +D GGGTFD S++  +  +  V  T GD+  G
Sbjct: 196 YDFGGGTFDTSLIVRDGKVVTVADTEGDSFLG 227


>UniRef50_Q22CW2 Cluster: Heat shock protein 70 homolog; n=1;
           Tetrahymena thermophila SB210|Rep: Heat shock protein 70
           homolog - Tetrahymena thermophila SB210
          Length = 146

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVA-FTDTERLIGDAAKNQVA 254
           +GIDLGTT SCV + +    +II N +G RTTPS VA   D  RL+G  AK QV+
Sbjct: 27  IGIDLGTTNSCVAIMEGSAPKIIENAEGFRTTPSVVAILPDGSRLVGAPAKRQVS 81


>UniRef50_A2EMY0 Cluster: DnaK protein; n=4; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 626

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 31/87 (35%), Positives = 45/87 (51%), Gaps = 3/87 (3%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGL---NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGG 678
           VPA+F   Q    ++A  I+       + +  EP+AAA+ +        ER VL++D GG
Sbjct: 143 VPAHFTQKQLDEVRNAVRIAQFPNPEKIFLFKEPSAAALCFTNSISLDKERTVLVYDFGG 202

Query: 679 GTFDVSILTIEDGIFEVKSTAGDTHFG 759
           GTFD+S++ I     EV    GD H G
Sbjct: 203 GTFDLSLVKISPDQIEVIDQDGDAHLG 229



 Score = 39.5 bits (88), Expect = 0.088
 Identities = 19/38 (50%), Positives = 23/38 (60%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF 206
           +GIDLGTTY     ++ GKVEII    G    PSYV +
Sbjct: 6   IGIDLGTTYCSAAAYKDGKVEII-EFNGKNAFPSYVFY 42



 Score = 36.3 bits (80), Expect = 0.82
 Identities = 20/67 (29%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMV 442
           + ++D+KR++G+ ++D  ++ ++  W F+V SD  G P I +          P EVS+ +
Sbjct: 64  SVVYDSKRMLGKTYKD--LENEIPTWTFDVKSDSNGNPIIPIDNGKMLIKVKPCEVSASI 121

Query: 443 LTKMKET 463
           L  ++ET
Sbjct: 122 LNYIRET 128


>UniRef50_Q2INJ2 Cluster: Putative NAD-specific glutamate
           dehydrogenase; n=1; Anaeromyxobacter dehalogenans
           2CP-C|Rep: Putative NAD-specific glutamate dehydrogenase
           - Anaeromyxobacter dehalogenans (strain 2CP-C)
          Length = 655

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 30/81 (37%), Positives = 46/81 (56%)
 Frame = -1

Query: 756 KVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSEN 577
           +V V  GG HLED +L  +DGHVE  AA+V  +    +    V+ V +R   R +   ++
Sbjct: 410 EVRVTDGGQHLEDALLQPQDGHVERAAAQVVHR--EHALRALVEAVRHRRRGRLVQQPQH 467

Query: 576 VQARDGTCIFCGLSLRVIEVR 514
           V+  +   +  GL+LRV+EVR
Sbjct: 468 VEPGEPARVLGGLALRVVEVR 488


>UniRef50_A7CRR2 Cluster: Glutamate dehydrogenase; n=1; Opitutaceae
           bacterium TAV2|Rep: Glutamate dehydrogenase -
           Opitutaceae bacterium TAV2
          Length = 705

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 30/83 (36%), Positives = 50/83 (60%)
 Frame = -1

Query: 756 KVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSEN 577
           ++GV  GGF  ++ + D +DG V+G AAEV+D    F   LFV++V       F+DD+ +
Sbjct: 477 ELGVTIGGFDFKNAVADFEDGDVKGAAAEVEDG--DFFVFLFVESVGEGGRGGFVDDAFD 534

Query: 576 VQARDGTCIFCGLSLRVIEVRGN 508
            +A +   +  GL+L ++EV G+
Sbjct: 535 FEAGNLAGVLGGLTLGIVEVGGD 557


>UniRef50_A2E4A6 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 844

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 6/90 (6%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL--DKKGTGERN----VLIFD 669
           V  ++ +SQR+   DA  ISG+ +++++N  TA AI Y +    K   E+     V   D
Sbjct: 144 VSPWWGESQRRVILDAAKISGVKIMKLLNSTTAQAICYSMYHRSKLPAEKEKAVPVAFID 203

Query: 670 LGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            G  + +VSI  +  G  ++KS A D HFG
Sbjct: 204 FGDSSLNVSIAQLHQGAVDIKSFACDEHFG 233



 Score = 39.9 bits (89), Expect = 0.067
 Identities = 19/55 (34%), Positives = 28/55 (50%)
 Frame = +3

Query: 84  APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           A  + +DLG     + + Q+G V+I  N    R TP+ VA  +  R  G+ AK Q
Sbjct: 2   ASVIAVDLGNQNCVIALPQNGGVDIANNQSSQRLTPTMVAIDNDRRYAGEFAKTQ 56


>UniRef50_Q1E6G2 Cluster: Heat shock protein 70 homolog; n=17;
           Pezizomycotina|Rep: Heat shock protein 70 homolog -
           Coccidioides immitis
          Length = 577

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 27/85 (31%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY-GLDKKGTGERNVLIFDLGGGT 684
           VP  F+++QR A K A   +G++V++ ++EP AA +AY  + +    ++ V++ D GG  
Sbjct: 158 VPTDFSEAQRTALKVAAKEAGVDVIQFVHEPVAALLAYDAIPEAQVKDKLVVVADFGGTR 217

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
            D++I+    G++ V +T  D   G
Sbjct: 218 SDIAIIASRGGMYTVLATVHDPELG 242



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP- 263
           A+GI  G + S +  +   GK ++IAN++G+R  PS +++ + E   G  AK Q+   P 
Sbjct: 17  AIGISFGNSNSSIAHISPEGKPQVIANEEGDRHIPSVLSYVEGEEYHGAQAKAQLVRNPK 76

Query: 264 -TTQYSMPNVSSDVSS 308
            T  Y    +  D  S
Sbjct: 77  NTIAYFRDYLGKDFKS 92



 Score = 33.9 bits (74), Expect = 4.4
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 2/88 (2%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFE--DATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEV 430
           NP NTI   +  +G+ F+  D T      H P ++        ++     E  T    E+
Sbjct: 74  NPKNTIAYFRDYLGKDFKSIDPTPAHASAH-P-QLHDSSVAFTVRDTAAEEPNTITVSEI 131

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           ++  L ++K++A  +LGK V  AV+T P
Sbjct: 132 TTRHLRRLKQSASDFLGKDVNAAVVTVP 159


>UniRef50_A4AEG2 Cluster: Putative uncharacterized protein; n=1;
           marine actinobacterium PHSC20C1|Rep: Putative
           uncharacterized protein - marine actinobacterium
           PHSC20C1
          Length = 98

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 32/56 (57%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = -3

Query: 247 WFLAASPMRRSVS-VNAT*DGVVLLPWSLAMISTFPCWKTPTQEYVVPRSIPTAGA 83
           W  A SP R S S VNAT DGVV +P + AM    P  +T T E+VVPRSIPTA A
Sbjct: 14  WRFAVSPTRTSPSLVNATTDGVVRIPSAFAMTVGSPPSRTATTEFVVPRSIPTARA 69


>UniRef50_Q0WM51 Cluster: HSP like protein; n=11; Magnoliophyta|Rep:
           HSP like protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 701

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 1/60 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-GTGERNVLIFDLGGGT 684
           VP YF  ++R+    A  ++G+NVL ++NE + AA+ YG+DK    G R+V+ +D+G  +
Sbjct: 3   VPPYFGQAERRGLIQASQLAGVNVLSLVNEHSGAALQYGIDKDFANGSRHVIFYDMGSSS 62


>UniRef50_O23508 Cluster: Growth regulator like protein; n=6;
           Magnoliophyta|Rep: Growth regulator like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 912

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 1/60 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-GTGERNVLIFDLGGGT 684
           VP YF  ++R+    A  ++G+NVL ++NE + AA+ YG+DK    G R+V+ +D+G  +
Sbjct: 597 VPPYFGQAERRGLIQASQLAGVNVLSLVNEHSGAALQYGIDKDFANGSRHVIFYDMGSSS 656



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 4/71 (5%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGV--FQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 245
           +++  + +DLG+ +  V V   + G+  + +  N+   R +P+ VAF   +RL+G+ A  
Sbjct: 450 SESAVLSVDLGSEWVKVAVVNLKRGQSPISVAINEMSKRKSPALVAFQSGDRLLGEEAAG 509

Query: 246 QVA*TPTTQYS 278
             A  P   YS
Sbjct: 510 ITARYPNKVYS 520



 Score = 33.1 bits (72), Expect = 7.7
 Identities = 21/103 (20%), Positives = 45/103 (43%), Gaps = 3/103 (2%)
 Frame = +2

Query: 215 RASHRRCRQEPGGVN---PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIK 385
           ++  R   +E  G+    PN      + ++G+ F+      D  + PF++V D  +  + 
Sbjct: 497 QSGDRLLGEEAAGITARYPNKVYSQLRDMVGKPFKHVKDFIDSVYLPFDIVED-SRGAVG 555

Query: 386 VAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           +        +  EE+ +M+L      AE +    V++ V++ P
Sbjct: 556 IKIDDGSTVYSVEELLAMILGYASNLAEFHAKIPVKDMVVSVP 598


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 834,188,964
Number of Sequences: 1657284
Number of extensions: 18506708
Number of successful extensions: 62779
Number of sequences better than 10.0: 476
Number of HSP's better than 10.0 without gapping: 58313
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 62357
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 62969581935
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -