SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20054
         (677 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B50C7 Cluster: PREDICTED: similar to GA14409-PA...   149   5e-35
UniRef50_Q9V4A7 Cluster: Plexin-B precursor; n=5; Diptera|Rep: P...   132   6e-30
UniRef50_A5D6Q5 Cluster: Plxna3 protein; n=5; Mammalia|Rep: Plxn...   103   4e-21
UniRef50_A7SBD7 Cluster: Predicted protein; n=2; Nematostella ve...   101   2e-20
UniRef50_O75051 Cluster: Plexin-A2 precursor; n=112; Vertebrata|...   100   3e-20
UniRef50_Q4SZC1 Cluster: Chromosome undetermined SCAF11724, whol...    99   5e-20
UniRef50_Q4T5C4 Cluster: Chromosome undetermined SCAF9327, whole...    98   1e-19
UniRef50_UPI0000E45FEF Cluster: PREDICTED: similar to Plexin-A4;...    93   4e-18
UniRef50_UPI0000D8DBE3 Cluster: Plexin-B1 precursor (Semaphorin ...    93   7e-18
UniRef50_O15031 Cluster: Plexin-B2 precursor; n=33; Euteleostomi...    87   4e-16
UniRef50_UPI0000EB4A9C Cluster: Plexin-A3 precursor (Plexin-4) (...    86   6e-16
UniRef50_O96681 Cluster: Plexin A; n=18; Coelomata|Rep: Plexin A...    86   9e-16
UniRef50_Q4SY41 Cluster: Chromosome undetermined SCAF12205, whol...    84   3e-15
UniRef50_Q8CJH3 Cluster: Plexin-B1 precursor; n=14; Euteleostomi...    83   5e-15
UniRef50_O45657 Cluster: Plexin-2 precursor; n=2; Caenorhabditis...    83   8e-15
UniRef50_Q4T033 Cluster: Chromosome undetermined SCAF11372, whol...    82   1e-14
UniRef50_Q4T1S7 Cluster: Chromosome undetermined SCAF10488, whol...    59   1e-14
UniRef50_O43157 Cluster: Plexin-B1 precursor; n=8; Euteleostomi|...    81   2e-14
UniRef50_UPI00006A072B Cluster: Plexin-A2 precursor (Semaphorin ...    80   4e-14
UniRef50_Q4TAV0 Cluster: Chromosome undetermined SCAF7250, whole...    80   6e-14
UniRef50_UPI00004D20A0 Cluster: Plexin-B3 precursor.; n=1; Xenop...    77   3e-13
UniRef50_UPI0000EB4A6B Cluster: Plexin-B3 precursor.; n=1; Canis...    76   9e-13
UniRef50_Q9ULL4 Cluster: Plexin-B3 precursor; n=12; Theria|Rep: ...    76   9e-13
UniRef50_UPI0000E499F6 Cluster: PREDICTED: similar to plexinB1; ...    74   3e-12
UniRef50_UPI0000E4A4A2 Cluster: PREDICTED: similar to Plexin-A4;...    74   4e-12
UniRef50_UPI0000E49DAA Cluster: PREDICTED: similar to plexin A2;...    74   4e-12
UniRef50_UPI0000E488A9 Cluster: PREDICTED: similar to plexin b, ...    74   4e-12
UniRef50_Q4RJU9 Cluster: Chromosome 9 SCAF15033, whole genome sh...    73   6e-12
UniRef50_Q8TA58 Cluster: Plexin A; n=4; Caenorhabditis|Rep: Plex...    73   6e-12
UniRef50_Q9Y4D7 Cluster: Plexin-D1 precursor; n=39; Euteleostomi...    73   6e-12
UniRef50_UPI0000E499F0 Cluster: PREDICTED: similar to plexin A2;...    70   6e-11
UniRef50_UPI0000E48B48 Cluster: PREDICTED: similar to mKIAA0407 ...    69   1e-10
UniRef50_UPI000155CC28 Cluster: PREDICTED: similar to KIAA0407; ...    65   1e-09
UniRef50_UPI0000E25F31 Cluster: PREDICTED: plexin A3; n=1; Pan t...    65   2e-09
UniRef50_UPI0000E4A226 Cluster: PREDICTED: similar to four domai...    61   3e-08
UniRef50_O60486 Cluster: Plexin-C1 precursor; n=19; Tetrapoda|Re...    56   8e-07
UniRef50_UPI000069F27C Cluster: Plexin-C1 precursor (Virus-encod...    51   2e-05
UniRef50_UPI0000E47B48 Cluster: PREDICTED: similar to Plexin-A4,...    45   0.001
UniRef50_Q8CHG6 Cluster: MKIAA0315 protein; n=2; Eukaryota|Rep: ...    44   0.005
UniRef50_UPI0000E47AE8 Cluster: PREDICTED: similar to Plexin-A4;...    43   0.008
UniRef50_Q4SST8 Cluster: Chromosome undetermined SCAF14347, whol...    41   0.032
UniRef50_Q6F1H5 Cluster: UPF0090 protein Mfl291; n=1; Mesoplasma...    35   1.6  
UniRef50_Q84F12 Cluster: SMC protein; n=4; Flexibacteraceae|Rep:...    35   2.1  
UniRef50_UPI000023CE5A Cluster: hypothetical protein FG10986.1; ...    34   2.8  
UniRef50_Q2AHD8 Cluster: Glycosyl transferase, group 1; n=1; Hal...    34   2.8  
UniRef50_A3VBU0 Cluster: Outer membrane protein, OMP85 family pr...    34   3.7  
UniRef50_Q4HK87 Cluster: Putative uncharacterized protein; n=3; ...    33   6.4  
UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    33   6.4  
UniRef50_A4M884 Cluster: CRISPR-associated protein Cas6; n=1; Pe...    33   8.4  
UniRef50_A1YRL8 Cluster: Cassette chromosome recombinase A; n=66...    33   8.4  
UniRef50_Q4QEV6 Cluster: Putative uncharacterized protein; n=3; ...    33   8.4  
UniRef50_Q23RT4 Cluster: Putative uncharacterized protein; n=1; ...    33   8.4  
UniRef50_Q22WH3 Cluster: Putative uncharacterized protein; n=1; ...    33   8.4  
UniRef50_Q8TTV9 Cluster: Phosphoribosylglycinamide formyltransfe...    33   8.4  

>UniRef50_UPI00015B50C7 Cluster: PREDICTED: similar to GA14409-PA;
            n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
            GA14409-PA - Nasonia vitripennis
          Length = 1952

 Score =  149 bits (362), Expect = 5e-35
 Identities = 67/82 (81%), Positives = 77/82 (93%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            FLLFKAIKHQIEKG VD +TH+ARYSLSEE+LL+EQID+  VTLH+VQD+ DEK+QCKVL
Sbjct: 1508 FLLFKAIKHQIEKGPVDVVTHDARYSLSEERLLREQIDHSIVTLHVVQDDLDEKIQCKVL 1567

Query: 191  DCDSISQVKSKILDALFKNTPF 256
            DCD+ISQVKSKILDAL+KNTPF
Sbjct: 1568 DCDTISQVKSKILDALYKNTPF 1589



 Score =  129 bits (311), Expect = 7e-29
 Identities = 58/87 (66%), Positives = 68/87 (78%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            SLRP+VHEVDLEWRHGRGGH+TLQDED+TTK    W+K+NTLAHYGVKESA+MSLI RQN
Sbjct: 1590 SLRPSVHEVDLEWRHGRGGHLTLQDEDLTTKCCGDWKKINTLAHYGVKESAVMSLIPRQN 1649

Query: 436  DSFNTPYKIPCKNCTGIYCSNSHIPYT 516
            D F+   K PC  C+    S  HI ++
Sbjct: 1650 DGFSLSCKQPCHTCS--KTSQHHIQHS 1674


>UniRef50_Q9V4A7 Cluster: Plexin-B precursor; n=5; Diptera|Rep:
            Plexin-B precursor - Drosophila melanogaster (Fruit fly)
          Length = 2051

 Score =  132 bits (320), Expect = 6e-30
 Identities = 62/82 (75%), Positives = 73/82 (89%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            FLLFKAIKHQIEKG+VDAIT++ARYSLSEE+LL EQ+ +  V LHI+QD+ DEKVQC+V 
Sbjct: 1601 FLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDDLDEKVQCRVN 1660

Query: 191  DCDSISQVKSKILDALFKNTPF 256
            D D+ISQVK KILDA+FKNTPF
Sbjct: 1661 DWDTISQVKLKILDAIFKNTPF 1682



 Score =  130 bits (313), Expect = 4e-29
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S+RP+V+EVDLEWRHGRGGH+TLQDED+TTKT+NGW++LNTLAHYGVKESA+MSLI+RQN
Sbjct: 1683 SMRPSVNEVDLEWRHGRGGHLTLQDEDLTTKTVNGWKRLNTLAHYGVKESAVMSLIARQN 1742

Query: 436  DSFNTPY-----KIPCKNCTGIYCSNSHI 507
            D+++ PY       P  N   I  S SHI
Sbjct: 1743 DNYHIPYSKNQNSAPYHNFYFINNSQSHI 1771


>UniRef50_A5D6Q5 Cluster: Plxna3 protein; n=5; Mammalia|Rep: Plxna3
            protein - Mus musculus (Mouse)
          Length = 1795

 Score =  103 bits (247), Expect = 4e-21
 Identities = 49/84 (58%), Positives = 66/84 (78%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
            FLL+ AIK Q+EKG +DAIT EARYSLSE+KL+++QIDY+T+TLH V  + E   +V  K
Sbjct: 1361 FLLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVCPESEGSAQVPVK 1420

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VL+CDSI+Q K K+LD ++K  P+
Sbjct: 1421 VLNCDSITQAKDKLLDTVYKGIPY 1444



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 28/64 (43%), Positives = 45/64 (70%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   + LQDED+TTK    W+++N+LAHY V + ++++L+ +Q 
Sbjct: 1445 SQRPKAEDMDLEWRQGRMARIILQDEDITTKIECDWKRVNSLAHYQVTDGSLVALVPKQV 1504

Query: 436  DSFN 447
             ++N
Sbjct: 1505 SAYN 1508


>UniRef50_A7SBD7 Cluster: Predicted protein; n=2; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1940

 Score =  101 bits (241), Expect = 2e-20
 Identities = 46/84 (54%), Positives = 64/84 (76%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            F++FKAIK Q+ KG VDA+T EARYSLSE+KLL++ IDY+ + +++  ++        VL
Sbjct: 1457 FMMFKAIKRQVGKGPVDAVTGEARYSLSEDKLLRQTIDYEEIRVNVTFED-QPPTMVTVL 1515

Query: 191  DCDSISQVKSKILDALFKNTPFHS 262
            DCDS+SQ KSK+LDA++KN PF S
Sbjct: 1516 DCDSVSQAKSKMLDAVYKNVPFSS 1539



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/60 (36%), Positives = 31/60 (51%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S R     + L+W    G    L+D+D ++     WRKLNTL HY V + A + L  RQ+
Sbjct: 1538 SSRVEAETLQLDWHLTDGSVKPLRDDDASSVVEGQWRKLNTLGHYKVTDGANLKLSPRQS 1597


>UniRef50_O75051 Cluster: Plexin-A2 precursor; n=112; Vertebrata|Rep:
            Plexin-A2 precursor - Homo sapiens (Human)
          Length = 1909

 Score =  100 bits (240), Expect = 3e-20
 Identities = 47/84 (55%), Positives = 68/84 (80%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
            F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QI+Y+T+ L+ V   +E   ++  K
Sbjct: 1474 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVK 1533

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VL+CD+I+QVK KILDA++KN P+
Sbjct: 1534 VLNCDTITQVKEKILDAVYKNVPY 1557



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 32/66 (48%), Positives = 45/66 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   V LQDED+TTK    W++LNTL HY V + ++++L+ +Q 
Sbjct: 1558 SQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQT 1617

Query: 436  DSFNTP 453
             S+N P
Sbjct: 1618 SSYNIP 1623


>UniRef50_Q4SZC1 Cluster: Chromosome undetermined SCAF11724, whole
           genome shotgun sequence; n=22; Eukaryota|Rep: Chromosome
           undetermined SCAF11724, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 485

 Score =   99 bits (238), Expect = 5e-20
 Identities = 50/114 (43%), Positives = 79/114 (69%), Gaps = 5/114 (4%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
           F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QI+Y+T+TLH    ++E   +V  K
Sbjct: 118 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLTLHCANPENESAPEVTFK 177

Query: 185 VLDCDSISQVKSKILDALFKNTPFHSDLLSMKLISSGVMVEV---DMLRFKTRM 337
            L+CD+++QVK K+LDA++K +P+     +  ++   ++      D LR +T M
Sbjct: 178 CLNCDTVTQVKEKLLDAVYKGSPYSQRPKASDMVLESMLKTASSPDSLRSRTPM 231


>UniRef50_Q4T5C4 Cluster: Chromosome undetermined SCAF9327, whole
            genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome undetermined SCAF9327, whole genome shotgun
            sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1541

 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 46/84 (54%), Positives = 66/84 (78%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV--QDEFDEKVQCK 184
            F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QIDY+ +TL  +  + E   +V  K
Sbjct: 1042 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKQLTLMCIPPEGEAGTEVPVK 1101

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VL+CD+++QVK K+LDA++K  PF
Sbjct: 1102 VLNCDTVTQVKDKLLDAVYKGIPF 1125



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 25/44 (56%), Positives = 29/44 (65%)
 Frame = +1

Query: 265  PAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGV 396
            P    V  EWR GR   + LQDEDVTTK  + W++LNTLAHY V
Sbjct: 1156 PDCVSVSPEWRQGRMTRIILQDEDVTTKIESDWKRLNTLAHYQV 1199


>UniRef50_UPI0000E45FEF Cluster: PREDICTED: similar to Plexin-A4;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Plexin-A4 - Strongylocentrotus purpuratus
          Length = 550

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 45/83 (54%), Positives = 62/83 (74%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV-QDEFDEKVQCKV 187
           F LF AIK Q+EKG VD++T EARYSL+E KL+++Q+D + +TL     D     V+ KV
Sbjct: 392 FKLFYAIKQQVEKGPVDSVTGEARYSLTEGKLIRQQVDVKQLTLKAQGPDRNTPMVEVKV 451

Query: 188 LDCDSISQVKSKILDALFKNTPF 256
           LDCD+ISQ K+KILDA++K +P+
Sbjct: 452 LDCDTISQTKAKILDAIYKTSPY 474


>UniRef50_UPI0000D8DBE3 Cluster: Plexin-B1 precursor (Semaphorin
            receptor SEP).; n=1; Danio rerio|Rep: Plexin-B1 precursor
            (Semaphorin receptor SEP). - Danio rerio
          Length = 1778

 Score = 92.7 bits (220), Expect = 7e-18
 Identities = 40/86 (46%), Positives = 66/86 (76%), Gaps = 4/86 (4%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFD----EKVQ 178
            ++LF+AIKHQ++KG VDA+T +A+Y+L++ +LL+E ++Y+T+T++++         + V 
Sbjct: 1360 YMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDLEYRTLTVNVLMQGIGMNEAQPVA 1419

Query: 179  CKVLDCDSISQVKSKILDALFKNTPF 256
             KVLDCD+I+QVK KILD ++K T F
Sbjct: 1420 AKVLDCDTITQVKEKILDQVYKGTSF 1445



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 28/57 (49%), Positives = 36/57 (63%)
 Frame = +1

Query: 250  SISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
            S S RP    VDLEWR G  GH+ L DED+T+     W++LNTL HY V + A ++L
Sbjct: 1444 SFSHRPHTDSVDLEWRSGVAGHLILSDEDLTSVVQGNWKRLNTLQHYKVPDGATVAL 1500


>UniRef50_O15031 Cluster: Plexin-B2 precursor; n=33; Euteleostomi|Rep:
            Plexin-B2 precursor - Homo sapiens (Human)
          Length = 1838

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 40/82 (48%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH-IVQDEFDEKVQCKV 187
            + LFKAIKHQ+EKG VDA+  +A+Y+L++  LL + ++Y  +T+  IVQDE  + +  KV
Sbjct: 1422 YKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKV 1481

Query: 188  LDCDSISQVKSKILDALFKNTP 253
            L+CD+ISQVK KI+D +++  P
Sbjct: 1482 LNCDTISQVKEKIIDQVYRGQP 1503



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +1

Query: 265  PAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
            P    V LEWR G    + L D D+T++    W+++NTL HY V++ A + L
Sbjct: 1508 PRPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKRVNTLMHYNVRDGATLIL 1558


>UniRef50_UPI0000EB4A9C Cluster: Plexin-A3 precursor (Plexin-4)
            (Semaphorin receptor SEX).; n=2; Mammalia|Rep: Plexin-A3
            precursor (Plexin-4) (Semaphorin receptor SEX). - Canis
            familiaris
          Length = 2057

 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 44/87 (50%), Positives = 61/87 (70%), Gaps = 5/87 (5%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEK-----V 175
            F+L+ AIK Q+EKG +DAIT EARYSLSE+KL+++QIDY+T+       +         V
Sbjct: 1672 FMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLVSGGPGGQGSRHGGGGGV 1731

Query: 176  QCKVLDCDSISQVKSKILDALFKNTPF 256
              KVL+CDSI+Q K K+LDA++K  P+
Sbjct: 1732 PVKVLNCDSITQAKDKLLDAVYKGLPY 1758



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 29/64 (45%), Positives = 45/64 (70%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   + LQDEDVTTK    W+++N+LAHY V + ++++L+ +Q 
Sbjct: 1759 SQRPKAEDMDLEWRQGRMARIILQDEDVTTKIECDWKRVNSLAHYQVTDGSLVALVPKQV 1818

Query: 436  DSFN 447
             ++N
Sbjct: 1819 SAYN 1822


>UniRef50_O96681 Cluster: Plexin A; n=18; Coelomata|Rep: Plexin A -
            Drosophila melanogaster (Fruit fly)
          Length = 1945

 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 43/94 (45%), Positives = 63/94 (67%), Gaps = 13/94 (13%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH--IVQD--------- 157
            ++LF+A+K Q++KG VDA THEARYSLSEEKL+++ ID++ + ++  I+Q          
Sbjct: 1498 YMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDM 1557

Query: 158  --EFDEKVQCKVLDCDSISQVKSKILDALFKNTP 253
                 E V  KVLDCD+I QVK K L+ +++N P
Sbjct: 1558 LPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIP 1591



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 33/64 (51%), Positives = 44/64 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR G  G V L DEDVT+KT + W+KLNTL HY V + A +SL+ +Q+
Sbjct: 1593 SPRPPKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQS 1652

Query: 436  DSFN 447
              +N
Sbjct: 1653 SIYN 1656


>UniRef50_Q4SY41 Cluster: Chromosome undetermined SCAF12205, whole
           genome shotgun sequence; n=3; Tetraodontidae|Rep:
           Chromosome undetermined SCAF12205, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 629

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 38/89 (42%), Positives = 64/89 (71%), Gaps = 7/89 (7%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV-------QDEFDE 169
           ++LF+AIKHQ++KG VD +T +A+Y+L++ +LL+E ++Y+T+TL+++            +
Sbjct: 200 YMLFRAIKHQVDKGPVDVVTGKAKYTLNDNRLLREDVEYRTLTLNVLIPAAATCSGATTQ 259

Query: 170 KVQCKVLDCDSISQVKSKILDALFKNTPF 256
            V  KVLDCD+I+QVK KI++  +K T F
Sbjct: 260 IVPAKVLDCDTITQVKEKIVEQTWKGTSF 288



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 27/60 (45%), Positives = 38/60 (63%)
 Frame = +1

Query: 250 SISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISR 429
           S S RP +  + LEWR G  GH+ L DED+T+   + W+ LNTL HY V + A ++L+ R
Sbjct: 287 SFSQRPHIGSLQLEWRAGVAGHLILSDEDLTSVVQDSWKHLNTLQHYKVPDGATVALVPR 346


>UniRef50_Q8CJH3 Cluster: Plexin-B1 precursor; n=14; Euteleostomi|Rep:
            Plexin-B1 precursor - Mus musculus (Mouse)
          Length = 2119

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 38/86 (44%), Positives = 62/86 (72%), Gaps = 5/86 (5%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH--IVQDEFDEKVQC- 181
            ++LF+ IKHQ++KG VD++T +A+Y+L++ +LL+E ++Y+ +TL+  +       + QC 
Sbjct: 1692 YMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQCV 1751

Query: 182  --KVLDCDSISQVKSKILDALFKNTP 253
              KVLDCD+ISQ K K+LD L+K  P
Sbjct: 1752 PVKVLDCDTISQAKEKMLDQLYKGVP 1777



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 26/57 (45%), Positives = 38/57 (66%)
 Frame = +1

Query: 253  ISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLI 423
            ++ RP    +D+EWR G  GH+ L DEDVT++    WR+LNTL HY V + A ++L+
Sbjct: 1778 LAQRPDSCTLDVEWRSGVAGHLILSDEDVTSELQGLWRRLNTLQHYKVPDGATVALV 1834


>UniRef50_O45657 Cluster: Plexin-2 precursor; n=2; Caenorhabditis|Rep:
            Plexin-2 precursor - Caenorhabditis elegans
          Length = 1764

 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 34/83 (40%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQ-DEFDEKVQCKV 187
            F L+KA+++Q +KG VDA+T +ARY+++E KLL+E +D +T+ + ++  ++ DE +  +V
Sbjct: 1331 FYLYKALQYQTDKGPVDAVTGDARYTINEAKLLRESVDTKTLKIRVIPFEKCDESIDLEV 1390

Query: 188  LDCDSISQVKSKILDALFKNTPF 256
              CD+I QVK K+  A+++ TP+
Sbjct: 1391 HACDAICQVKQKVASAVYRETPY 1413


>UniRef50_Q4T033 Cluster: Chromosome undetermined SCAF11372, whole
            genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome undetermined SCAF11372, whole genome shotgun
            sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1200

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHI-VQDEFDEKVQCKV 187
            + LFKA+KHQ+EKG VDA   +A+Y+L++  LL + ++Y  +TL + V  E  +    KV
Sbjct: 759  YKLFKALKHQVEKGPVDAKMKKAKYTLNDTGLLGDDVEYSVLTLQVLVHGEGPDVTPVKV 818

Query: 188  LDCDSISQVKSKILDALFKNTPF 256
            L+CD+I+QVK K++D +++N P+
Sbjct: 819  LNCDTITQVKEKVIDQVYRNMPY 841



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 25/47 (53%), Positives = 30/47 (63%)
 Frame = +1

Query: 256 SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGV 396
           S RP V  V LEWR G  G + L D D+T++    W+KLNTLAHY V
Sbjct: 842 SQRPKVECVALEWRPGSTGQI-LSDLDLTSQKEGRWKKLNTLAHYNV 887


>UniRef50_Q4T1S7 Cluster: Chromosome undetermined SCAF10488, whole
            genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome undetermined SCAF10488, whole genome shotgun
            sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1388

 Score = 59.3 bits (137), Expect(2) = 1e-14
 Identities = 21/44 (47%), Positives = 39/44 (88%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTL 142
            ++LF+AIKHQ++KG VDA+T +A+Y+L++ +LL+E ++Y+T+ +
Sbjct: 924  YMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLVI 967



 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 24/51 (47%), Positives = 34/51 (66%)
 Frame = +1

Query: 283  DLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            D EWR G  GH+ L DED+T+     W++LNTL HY V E A ++L++R +
Sbjct: 1059 DPEWRSGVAGHLILSDEDLTSVVQGSWKRLNTLQHYKVPEGATVALVARHS 1109



 Score = 42.7 bits (96), Expect(2) = 1e-14
 Identities = 20/43 (46%), Positives = 30/43 (69%), Gaps = 4/43 (9%)
 Frame = +2

Query: 164  DEKVQCKVLDCDSISQVKSKILDALFKNTPF----HSDLLSMK 280
            ++ +  KVLDCD+I+QVK K+LD ++K T F    HSD L ++
Sbjct: 1008 NQPLPTKVLDCDTITQVKEKLLDQVYKGTSFSHRPHSDSLDLE 1050


>UniRef50_O43157 Cluster: Plexin-B1 precursor; n=8; Euteleostomi|Rep:
            Plexin-B1 precursor - Homo sapiens (Human)
          Length = 2135

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 37/86 (43%), Positives = 61/86 (70%), Gaps = 5/86 (5%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFD-----EKV 175
            ++LF+ IKHQ++KG VD++T +A+Y+L++ +LL+E ++Y+ +TL+ +          + V
Sbjct: 1708 YMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQGV 1767

Query: 176  QCKVLDCDSISQVKSKILDALFKNTP 253
              KVLDCD+ISQ K K+LD L+K  P
Sbjct: 1768 PVKVLDCDTISQAKEKMLDQLYKGVP 1793



 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 26/57 (45%), Positives = 38/57 (66%)
 Frame = +1

Query: 253  ISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLI 423
            ++ RP    +D+EWR G  GH+ L DEDVT++    WR+LNTL HY V + A ++L+
Sbjct: 1794 LTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALV 1850


>UniRef50_UPI00006A072B Cluster: Plexin-A2 precursor (Semaphorin
            receptor OCT).; n=1; Xenopus tropicalis|Rep: Plexin-A2
            precursor (Semaphorin receptor OCT). - Xenopus tropicalis
          Length = 1434

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 46/102 (45%), Positives = 67/102 (65%), Gaps = 20/102 (19%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVT----------------- 139
            F+L  AIK Q+EKG +D+IT EARYSLSE+KL+++QI+Y+T+                  
Sbjct: 981  FMLHCAIKQQMEKGPIDSITGEARYSLSEDKLIRQQIEYKTLVSTPKTALYSSSLAGGKQ 1040

Query: 140  -LHIV--QDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPF 256
             L+ V   +E   ++  KVL+CD+I+QVK KILDA++KN P+
Sbjct: 1041 ILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPY 1082



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 32/66 (48%), Positives = 45/66 (68%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP   ++DLEWR GR   V LQDED+TTK    W++LNTL HY V + ++++L+ +Q 
Sbjct: 1083 SQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQT 1142

Query: 436  DSFNTP 453
             S+N P
Sbjct: 1143 SSYNIP 1148


>UniRef50_Q4TAV0 Cluster: Chromosome undetermined SCAF7250, whole
           genome shotgun sequence; n=5; Tetraodontidae|Rep:
           Chromosome undetermined SCAF7250, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 848

 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 35/82 (42%), Positives = 58/82 (70%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
           ++L++AIK+Q++KG VD++T +A+ +L++  LL+E IDY  +TL +      +    KVL
Sbjct: 481 YMLYRAIKYQVDKGPVDSVTGKAKRTLNDSHLLREDIDYSAMTLMVKNGVEVQTCPVKVL 540

Query: 191 DCDSISQVKSKILDALFKNTPF 256
           D D+I+QVK KILD +++  PF
Sbjct: 541 DIDTITQVKDKILDQVYRGAPF 562


>UniRef50_UPI00004D20A0 Cluster: Plexin-B3 precursor.; n=1; Xenopus
            tropicalis|Rep: Plexin-B3 precursor. - Xenopus tropicalis
          Length = 1798

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 38/84 (45%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDE--KVQCK 184
            ++L+ AIK+Q++KG VDA+T +A+ +L++  LL+E IDY  +TL ++     E   V  +
Sbjct: 1356 YMLYCAIKYQVDKGPVDAVTGKAKRTLNDCHLLREDIDYHPMTLTVIVKSGRETHHVPVR 1415

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VLD D+I+QVK KIL+ ++K TPF
Sbjct: 1416 VLDTDTITQVKQKILNQVYKGTPF 1439



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISR-Q 432
            S RPA   +DLEWR G  GH+TL DED+T+   + W++LNTL HY V ++A ++LI R  
Sbjct: 1440 SQRPAATTLDLEWRSGNAGHLTLSDEDLTSLIQDQWKRLNTLHHYKVPDNATVALIPRLH 1499

Query: 433  NDSFNTP 453
            N+   TP
Sbjct: 1500 NNQCETP 1506


>UniRef50_UPI0000EB4A6B Cluster: Plexin-B3 precursor.; n=1; Canis
            lupus familiaris|Rep: Plexin-B3 precursor. - Canis
            familiaris
          Length = 1467

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 34/75 (45%), Positives = 48/75 (64%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S RP+ H +DLEWR G  GH+TL DED+T+ T N W++LNTL HY V + A + LI + +
Sbjct: 1118 SQRPSAHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGLIPQLH 1177

Query: 436  DSFNTPYKIPCKNCT 480
            +       +  +NCT
Sbjct: 1178 NGGAVSQSL-AQNCT 1191



 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 32/91 (35%), Positives = 63/91 (69%), Gaps = 9/91 (9%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDE---------F 163
            ++L +AI++Q++KG VDA+T +A+ +L++ +LL+E ++++ +TL ++             
Sbjct: 1027 YMLLRAIQYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFRPLTLMVLAGPRAGGAAGGGA 1086

Query: 164  DEKVQCKVLDCDSISQVKSKILDALFKNTPF 256
             ++V  +VLD D+I+QVK K+L+ ++K TPF
Sbjct: 1087 VQRVPARVLDTDTITQVKEKVLEQVYKGTPF 1117


>UniRef50_Q9ULL4 Cluster: Plexin-B3 precursor; n=12; Theria|Rep:
            Plexin-B3 precursor - Homo sapiens (Human)
          Length = 1909

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 35/91 (38%), Positives = 64/91 (70%), Gaps = 9/91 (9%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV---------QDEF 163
            ++LF+AI++Q++KG VDA+T +A+ +L++ +LL+E +++Q +TL ++             
Sbjct: 1475 YMLFRAIQYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSE 1534

Query: 164  DEKVQCKVLDCDSISQVKSKILDALFKNTPF 256
             ++V  +VLD D+I+QVK K+LD ++K TPF
Sbjct: 1535 MQRVPARVLDTDTITQVKEKVLDQVYKGTPF 1565



 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 31/56 (55%), Positives = 41/56 (73%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLI 423
            S RP+VH +DLEWR G  GH+TL DED+T+ T N W++LNTL HY V + A + L+
Sbjct: 1566 SQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGLV 1621


>UniRef50_UPI0000E499F6 Cluster: PREDICTED: similar to plexinB1; n=7;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            plexinB1 - Strongylocentrotus purpuratus
          Length = 1900

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 34/80 (42%), Positives = 57/80 (71%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            +LL+++IK Q+EKG +D  T ++ +SL+ E LL+E++++  +TL +V  +   K   KVL
Sbjct: 1491 YLLYQSIKMQVEKGPIDITTGQSVFSLNFECLLEEEVEFNELTLSVVGRDRHHKYYVKVL 1550

Query: 191  DCDSISQVKSKILDALFKNT 250
            D D ++QVK KILDA ++N+
Sbjct: 1551 DVDCMTQVKQKILDAAYRNS 1570



 Score = 37.9 bits (84), Expect = 0.22
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)
 Frame = +1

Query: 274  HEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKL--NTLAHYGVKESAIMSLI 423
            HE+DL W H  G    L+D D   KT+   + L  NT+  YGV +   ++LI
Sbjct: 1579 HEMDLLWYHPGGEERILKDRDELNKTVGNTKDLFINTVKTYGVSDGCQVALI 1630


>UniRef50_UPI0000E4A4A2 Cluster: PREDICTED: similar to Plexin-A4; n=4;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            Plexin-A4 - Strongylocentrotus purpuratus
          Length = 1796

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 35/75 (46%), Positives = 53/75 (70%)
 Frame = +2

Query: 17   LFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVLDC 196
            ++K ++ Q++KG VDAIT +A +SL+ + LL E ++++ VTL IV  E     Q KVLD 
Sbjct: 1375 MYKHLQGQVDKGPVDAITGQAHFSLNFDYLLDEDVEFEDVTLQIVDKEHKVLEQVKVLDV 1434

Query: 197  DSISQVKSKILDALF 241
            D+I+Q K KILDA++
Sbjct: 1435 DTITQAKQKILDAVY 1449



 Score = 41.1 bits (92), Expect = 0.024
 Identities = 20/64 (31%), Positives = 34/64 (53%)
 Frame = +1

Query: 274  HEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQNDSFNTP 453
            +EVDL   +G  G + L+D D  T+T   W K NT+  Y +   + ++++ +Q D  N  
Sbjct: 1461 NEVDLVLLNGCMGRLVLKDRDPITETRGHWIKANTIKAYKISNGSSVAIVKKQ-DGTNPE 1519

Query: 454  YKIP 465
            +  P
Sbjct: 1520 FSAP 1523


>UniRef50_UPI0000E49DAA Cluster: PREDICTED: similar to plexin A2; n=1;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            plexin A2 - Strongylocentrotus purpuratus
          Length = 1384

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 38/82 (46%), Positives = 54/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIV-QDEFDEKVQCKV 187
            ++L++AIK Q+EKG +D IT  A +SL+ E LL E + +  V L +  Q +  E    KV
Sbjct: 938  YMLYQAIKFQVEKGPIDIITGHAHFSLNYEYLLDEDVTFAEVGLEVENQVQKGETSTVKV 997

Query: 188  LDCDSISQVKSKILDALFKNTP 253
            LD D+I+QVK K+LDA+F N P
Sbjct: 998  LDVDTITQVKEKVLDAVFLNKP 1019



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKT--LNGWRKLNTLAHYGVKESAIMSLISR 429
            S R    EVDL  R G+ G + L+D D TT+   +  W K+NT+ HY + + A++ L+ +
Sbjct: 1021 SERKIAAEVDLVLRSGKLGQLVLRDTDNTTEKPDVPRWAKVNTIQHYRITDGAVVGLVYK 1080

Query: 430  Q---NDSFNTP 453
            Q   N S  TP
Sbjct: 1081 QDNPNASLATP 1091


>UniRef50_UPI0000E488A9 Cluster: PREDICTED: similar to plexin b,
            partial; n=5; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to plexin b, partial -
            Strongylocentrotus purpuratus
          Length = 3637

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 34/80 (42%), Positives = 57/80 (71%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            +LL+++IK Q+EKG +D  T ++ +SL+ E LL+E++++  +TL +V  +   K   KVL
Sbjct: 1723 YLLYQSIKIQVEKGPIDITTGQSVFSLNFECLLEEEVEFNELTLSVVGRDRHHKYYVKVL 1782

Query: 191  DCDSISQVKSKILDALFKNT 250
            D D ++QVK KILDA ++N+
Sbjct: 1783 DVDCMTQVKQKILDAAYRNS 1802



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 274  HEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKL--NTLAHYGVKESAIMSLISRQN 435
            HE+DL W H  G    L+D D   KT+   + L  NT+  YGV +   ++LI + +
Sbjct: 1811 HEMDLLWYHPGGEERILKDRDELNKTIGNTKGLFINTIKTYGVSDGCQVALIVKSS 1866


>UniRef50_Q4RJU9 Cluster: Chromosome 9 SCAF15033, whole genome shotgun
            sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 9
            SCAF15033, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1526

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 37/83 (44%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHI-VQDEFDEKVQCKV 187
            FLL  AIK QI KG +DAIT +ARY+L+EE LL+E ++ +   +++  Q    + +  +V
Sbjct: 1116 FLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENVEARPQNINVSFQGCGMDSLSVRV 1175

Query: 188  LDCDSISQVKSKILDALFKNTPF 256
            +  D+I QVK KI++A +KN PF
Sbjct: 1176 MHTDTICQVKEKIIEAFYKNLPF 1198



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/52 (40%), Positives = 30/52 (57%)
 Frame = +1

Query: 265  PAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
            P   +VDLEW    G    LQD D ++   +G +KLNT+ HY V E A +++
Sbjct: 1202 PRAEDVDLEWLDSGGNSKLLQDLDNSSVMEDGRKKLNTVFHYQVPEGASLAM 1253


>UniRef50_Q8TA58 Cluster: Plexin A; n=4; Caenorhabditis|Rep: Plexin A
            - Caenorhabditis elegans
          Length = 1951

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 4/84 (4%)
 Frame = +2

Query: 17   LFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDE----FDEKVQCK 184
            LF  IK Q+EKG  DA+T EARYSLSEEKLL+   +Y+ + + +   +      + +  +
Sbjct: 1491 LFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIPVR 1550

Query: 185  VLDCDSISQVKSKILDALFKNTPF 256
            VLDCD+I+QVK K LDA ++   F
Sbjct: 1551 VLDCDTITQVKEKCLDAKYRGYRF 1574



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query: 247  YSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNG-WRKLNTLAHYGVKESAIMSLI 423
            Y  + RPA  +++LEW+ G  G + LQD D +++   G W++LNTLAHY V  +AI++L 
Sbjct: 1572 YRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWKRLNTLAHYNVPNNAILTLT 1631

Query: 424  SRQNDSFN 447
            S+ N  +N
Sbjct: 1632 SKSNSLYN 1639


>UniRef50_Q9Y4D7 Cluster: Plexin-D1 precursor; n=39; Euteleostomi|Rep:
            Plexin-D1 precursor - Homo sapiens (Human)
          Length = 1925

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 38/83 (45%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHI-VQDEFDEKVQCKV 187
            FLL  AIK QI KG +DAIT +ARY+L+EE LL+E I+ +   L++  Q    + +  + 
Sbjct: 1515 FLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRA 1574

Query: 188  LDCDSISQVKSKILDALFKNTPF 256
            +D D+++QVK KIL+A  KN P+
Sbjct: 1575 MDTDTLTQVKEKILEAFCKNVPY 1597



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 205  ITSKIEDTRCSLQKYSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLA 384
            +  KI +  C    YS    P   +VDLEW         L+D D T+   +G +KLNTLA
Sbjct: 1583 VKEKILEAFCKNVPYS--QWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLA 1640

Query: 385  HYGVKESA--IMSLISRQNDS 441
            HY + E A   MSLI +++++
Sbjct: 1641 HYKIPEGASLAMSLIDKKDNT 1661


>UniRef50_UPI0000E499F0 Cluster: PREDICTED: similar to plexin A2; n=1;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            plexin A2 - Strongylocentrotus purpuratus
          Length = 1684

 Score = 69.7 bits (163), Expect = 6e-11
 Identities = 44/110 (40%), Positives = 68/110 (61%), Gaps = 3/110 (2%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            + L++AIK Q EKG VDA T ++ +SLS + LL E  +++ VTL++  +   E V  KVL
Sbjct: 1223 YKLYQAIKIQCEKGPVDAATGQSYFSLSFDNLLTESPEFEEVTLNVESELGQESV--KVL 1280

Query: 191  DCDSISQVKSKILDALF--KNTPFHSDLLSMKLI-SSGVMVEVDMLRFKT 331
            + D+I+QVK KILDA++  K+T +      + L+  SG   E+ +  F T
Sbjct: 1281 NVDTITQVKEKILDAMYRKKHTKYQRSAREVDLVLKSGGQGELIVSDFDT 1330



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/56 (33%), Positives = 30/56 (53%)
 Frame = +1

Query: 268  AVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            +  EVDL  + G  G + + D D +T    GW  +NTL HYG+     +SL  +++
Sbjct: 1307 SAREVDLVLKSGGQGELIVSDFDTSTTASMGWCPINTLQHYGISSGVPVSLTDKKD 1362


>UniRef50_UPI0000E48B48 Cluster: PREDICTED: similar to mKIAA0407
           protein, partial; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to mKIAA0407 protein,
           partial - Strongylocentrotus purpuratus
          Length = 760

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 29/80 (36%), Positives = 54/80 (67%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
           ++L++A+K Q EKG +D +T +A Y+L   KLL ++I++ ++ + +V ++    +   VL
Sbjct: 391 YMLYQAVKAQAEKGPIDVVTGDAYYTLEFSKLLDQEIEFYSLGIDVVDEDGHVYLHMTVL 450

Query: 191 DCDSISQVKSKILDALFKNT 250
           D D++ Q K KILD+L+K +
Sbjct: 451 DVDTVKQAKQKILDSLWKKS 470


>UniRef50_UPI000155CC28 Cluster: PREDICTED: similar to KIAA0407; n=1;
            Ornithorhynchus anatinus|Rep: PREDICTED: similar to
            KIAA0407 - Ornithorhynchus anatinus
          Length = 2143

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/64 (43%), Positives = 39/64 (60%)
 Frame = +1

Query: 253  ISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQ 432
            + LRP    +D+EWR G  GH+ L DEDVT+     W++LNTL HY V + A ++L+ R 
Sbjct: 1728 VGLRPDPDALDVEWRSGVAGHLILSDEDVTSVVQGTWKRLNTLQHYKVPDGATVALVPRL 1787

Query: 433  NDSF 444
               F
Sbjct: 1788 TKHF 1791



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 17/31 (54%), Positives = 23/31 (74%)
 Frame = +2

Query: 158  EFDEKVQCKVLDCDSISQVKSKILDALFKNT 250
            E  + V  KVLDCD+I+QVK K+LD ++K T
Sbjct: 1696 EETQGVSVKVLDCDTITQVKEKVLDQVYKGT 1726


>UniRef50_UPI0000E25F31 Cluster: PREDICTED: plexin A3; n=1; Pan
            troglodytes|Rep: PREDICTED: plexin A3 - Pan troglodytes
          Length = 1601

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/42 (69%), Positives = 38/42 (90%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTV 136
            FLL+ AIK Q+EKG +DAIT EARYSLSE+KL+++QIDY+T+
Sbjct: 1227 FLLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTL 1268


>UniRef50_UPI0000E4A226 Cluster: PREDICTED: similar to four
            domain-type voltage-gated ion channel alpha-1 subunit;
            n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
            similar to four domain-type voltage-gated ion channel
            alpha-1 subunit - Strongylocentrotus purpuratus
          Length = 1324

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 27/78 (34%), Positives = 49/78 (62%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            ++L++AIK Q EKG +D  + EA Y+L   KL  + +++ ++ L +V ++    +   VL
Sbjct: 934  YMLYQAIKTQAEKGPIDEGSGEAYYTLEYNKLFDQTVEFHSLGLDVVDEDGQVYLHVNVL 993

Query: 191  DCDSISQVKSKILDALFK 244
            + DS+ QVK K+LD  ++
Sbjct: 994  NVDSVKQVKKKVLDCAWR 1011


>UniRef50_O60486 Cluster: Plexin-C1 precursor; n=19; Tetrapoda|Rep:
            Plexin-C1 precursor - Homo sapiens (Human)
          Length = 1568

 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 34/88 (38%), Positives = 50/88 (56%), Gaps = 9/88 (10%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEK------ 172
            +LL   +  +I KG VD IT +A Y+L+E+ LL +  ++ TV L++V ++  E       
Sbjct: 1158 YLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVC 1217

Query: 173  --VQCKVLDCDSISQVKSKILDA-LFKN 247
              +   VLDCD+I Q K KI  A L KN
Sbjct: 1218 RNISVNVLDCDTIGQAKEKIFQAFLSKN 1245


>UniRef50_UPI000069F27C Cluster: Plexin-C1 precursor (Virus-encoded
            semaphorin protein receptor) (CD232 antigen).; n=2;
            Xenopus tropicalis|Rep: Plexin-C1 precursor
            (Virus-encoded semaphorin protein receptor) (CD232
            antigen). - Xenopus tropicalis
          Length = 1353

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 6/83 (7%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKE-QIDYQTVTLHIV-----QDEFDEK 172
            +LL   +  +I KG +DAIT +A Y+L+E+ LL +    + ++ L++      ++   E 
Sbjct: 945  YLLVCMLNQRIHKGPIDAITCKALYTLNEDSLLWQINAKFSSLDLNVYFPNGSEENVTES 1004

Query: 173  VQCKVLDCDSISQVKSKILDALF 241
            ++  VLDCD++ Q K KI+   F
Sbjct: 1005 IKVTVLDCDTVGQAKEKIVQKFF 1027


>UniRef50_UPI0000E47B48 Cluster: PREDICTED: similar to Plexin-A4,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Plexin-A4, partial -
           Strongylocentrotus purpuratus
          Length = 108

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 21/50 (42%), Positives = 26/50 (52%)
 Frame = +1

Query: 292 WRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQNDS 441
           W    GG   L D+D       GWRK+NTL+HY V E A + L+  Q  S
Sbjct: 1   WYDRPGGKQILFDDDALRPMEGGWRKINTLSHYQVTEGATVYLLQAQGSS 50


>UniRef50_Q8CHG6 Cluster: MKIAA0315 protein; n=2; Eukaryota|Rep:
            MKIAA0315 protein - Mus musculus (Mouse)
          Length = 1299

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +1

Query: 265  PAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSL 420
            P    V LEWR G    + L D D+T++    W+++NTL HY V++ A + L
Sbjct: 969  PKPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKRINTLMHYNVRDGATLIL 1019


>UniRef50_UPI0000E47AE8 Cluster: PREDICTED: similar to Plexin-A4;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Plexin-A4 - Strongylocentrotus purpuratus
          Length = 880

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +2

Query: 155 DEFDEKVQCKVLDCDSISQVKSKILDALFKNTPF 256
           D+  + +Q KV  CDSISQVK KILD++++ TP+
Sbjct: 568 DKDADPLQVKVHTCDSISQVKEKILDSIYRTTPY 601



 Score = 35.9 bits (79), Expect = 0.91
 Identities = 18/59 (30%), Positives = 31/59 (52%)
 Frame = +1

Query: 256 SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQ 432
           S RP   E+DLEWR G  G   L +++        W++L  L+   V++   ++L+ +Q
Sbjct: 602 SHRPPKEELDLEWRCGLSGRKILPEDNGAVD--GDWKRLTMLSDEQVRDGDTIALVPKQ 658


>UniRef50_Q4SST8 Cluster: Chromosome undetermined SCAF14347, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF14347, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 888

 Score = 40.7 bits (91), Expect = 0.032
 Identities = 19/42 (45%), Positives = 28/42 (66%)
 Frame = +2

Query: 11  FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTV 136
           FL+  A+  QI KG VD +T +A Y+LSE+ LL +  D+ +V
Sbjct: 835 FLMVSALTQQIAKGPVDCVTEKALYTLSEDWLLWQAQDFSSV 876


>UniRef50_Q6F1H5 Cluster: UPF0090 protein Mfl291; n=1; Mesoplasma
           florum|Rep: UPF0090 protein Mfl291 - Mesoplasma florum
           (Acholeplasma florum)
          Length = 164

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 27/93 (29%), Positives = 49/93 (52%)
 Frame = +2

Query: 20  FKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVLDCD 199
           F +IK +I+K + ++I  E    + E   +    D+++  L I+ ++  E    K LD D
Sbjct: 4   FASIKDEIQK-IAESILKEYNLQIYE---INNFFDFESDVLQILVEDITEPN--KALDFD 57

Query: 200 SISQVKSKILDALFKNTPFHSDLLSMKLISSGV 298
           SI     K+ DAL +N P  S+   +++ S+G+
Sbjct: 58  SIISSNEKLSDAL-ENFPGLSEPYMLEVASAGI 89


>UniRef50_Q84F12 Cluster: SMC protein; n=4; Flexibacteraceae|Rep:
           SMC protein - Cytophaga hutchinsonii
          Length = 1178

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query: 26  AIKHQIEKGVVDAITHEARYSLSEEKL--LKEQIDYQTVTLHIVQDEFDEKVQCKVLDCD 199
           ++K ++EK   D   H A  S  E K   +K  +D +   L  +Q E DE++Q +V++ +
Sbjct: 411 SLKQELEKTTSDTSAHSANLSEFESKANEVKRTLDTKNAELETLQAE-DERIQQQVINLE 469

Query: 200 -SISQVKSKILDA 235
             I Q++ ++  A
Sbjct: 470 KEIEQIREQLTQA 482


>UniRef50_UPI000023CE5A Cluster: hypothetical protein FG10986.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG10986.1 - Gibberella zeae PH-1
          Length = 594

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 23/81 (28%), Positives = 36/81 (44%)
 Frame = +1

Query: 298 HGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQNDSFNTPYKIPCKNC 477
           HGR G ++     +    L  W+  +T+   GV  +   SL  + N     P  I   N 
Sbjct: 155 HGRSGPISSTYNRIVPDVLKPWQ--STVNKLGVPINDGGSLGGKPNGVMFQPTNIDVTNY 212

Query: 478 TGIYCSNSHIPYTIATLLIKT 540
           T  Y +NS++P   + L +KT
Sbjct: 213 TRSYSANSYLPKAGSNLKVKT 233


>UniRef50_Q2AHD8 Cluster: Glycosyl transferase, group 1; n=1;
           Halothermothrix orenii H 168|Rep: Glycosyl transferase,
           group 1 - Halothermothrix orenii H 168
          Length = 387

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 19/59 (32%), Positives = 32/59 (54%)
 Frame = +2

Query: 2   GTRFLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQ 178
           G   LL K  KH   + V+D ITH+ RY+L  +  LK+    ++ ++ ++ D+  E  Q
Sbjct: 318 GLNGLLVKPKKHIFAQAVIDLITHKTRYNLFMKNALKKA---ESFSIEVMTDKLLEGYQ 373


>UniRef50_A3VBU0 Cluster: Outer membrane protein, OMP85 family
           protein; n=1; Rhodobacterales bacterium HTCC2654|Rep:
           Outer membrane protein, OMP85 family protein -
           Rhodobacterales bacterium HTCC2654
          Length = 587

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +1

Query: 208 TSKIEDTRCSLQKYSISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLN 357
           T KI++ R     YS  ++ AV     +WRH      T++D+D+T    N
Sbjct: 122 TQKIDEFRNGEPAYSTVIQSAVESAVDDWRHAGRAKATVRDQDLTANHQN 171


>UniRef50_Q4HK87 Cluster: Putative uncharacterized protein; n=3;
           Campylobacter|Rep: Putative uncharacterized protein -
           Campylobacter lari RM2100
          Length = 530

 Score = 33.1 bits (72), Expect = 6.4
 Identities = 19/55 (34%), Positives = 34/55 (61%)
 Frame = +2

Query: 110 KEQIDYQTVTLHIVQDEFDEKVQCKVLDCDSISQVKSKILDALFKNTPFHSDLLS 274
           KE+ID + +  HI  D+F+EKV+  +   +++S+ K +IL+ L+K   +  D  S
Sbjct: 32  KEKID-EHILEHI--DKFEEKVKEAIASYEALSKEKLEILEELYKQVVYPFDFAS 83


>UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 707

 Score = 33.1 bits (72), Expect = 6.4
 Identities = 18/62 (29%), Positives = 30/62 (48%)
 Frame = +2

Query: 47  KGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVLDCDSISQVKSKI 226
           K VV  I    +Y  S  K    + + QT+T+ + Q E +   +CK++   S+ Q+   I
Sbjct: 520 KKVVKMIEKNTKYPYSRTKAYHRRSESQTITIKVAQGESEIPSECKIIGIYSV-QMPEDI 578

Query: 227 LD 232
            D
Sbjct: 579 YD 580


>UniRef50_A4M884 Cluster: CRISPR-associated protein Cas6; n=1;
           Petrotoga mobilis SJ95|Rep: CRISPR-associated protein
           Cas6 - Petrotoga mobilis SJ95
          Length = 261

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 16/62 (25%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Frame = +2

Query: 8   RFLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLH-IVQDEFDEKVQCK 184
           R ++FK + +      +D +     +SL+E+K+++ + +Y T+  + ++Q+E DE++  K
Sbjct: 71  RRMIFKGLFNIYFASPIDKLVEAVLHSLNEQKVVRIEKNYFTLRKYEVIQNEVDEEMLVK 130

Query: 185 VL 190
            L
Sbjct: 131 TL 132


>UniRef50_A1YRL8 Cluster: Cassette chromosome recombinase A; n=66;
           Staphylococcus|Rep: Cassette chromosome recombinase A -
           Staphylococcus aureus
          Length = 453

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = +2

Query: 14  LLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTL-HIVQDEFDEKVQCKVL 190
           L+ K  ++QI+   ++   H +  S SEE+         T T+ HI++D+   +     +
Sbjct: 359 LIEKLAQNQID---IETFKHLSAGSESEERYSNYSHKQITKTIRHIIKDKLTLETIAPFI 415

Query: 191 DCDSISQVKSKILDALFKNTPFH 259
           DC +I+Q K ++    FKN+P +
Sbjct: 416 DCINITQTK-QLQGIYFKNSPLN 437


>UniRef50_Q4QEV6 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 651

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +3

Query: 486 ILFEFTYTVYNSDITDQNVHYYHLVKPIEYQHIVNKSSEHSHKAI 620
           IL E    V   D+  Q   YYHLV+ I+ Q +VN++ +   + +
Sbjct: 139 ILTELFRNVGRGDVATQRDVYYHLVRHIQTQEVVNRTVQQLSRVL 183


>UniRef50_Q23RT4 Cluster: Putative uncharacterized protein; n=1;
            Tetrahymena thermophila SB210|Rep: Putative
            uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1348

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 20/54 (37%), Positives = 29/54 (53%)
 Frame = +2

Query: 80   RYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVLDCDSISQVKSKILDALF 241
            +Y LS E+LL+ + +Y   T H  Q +  E    K  +C+ IS V  KIL  L+
Sbjct: 1159 QYELSYEELLQFEKEYLE-TYHKEQVQNKELANQKPTECEKISTVNKKILQNLY 1211


>UniRef50_Q22WH3 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 595

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 23  KAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVLDCDS 202
           K I+ +IEK  + A  +   ++L  +KL + QIDY  +  HI++ E ++  +C       
Sbjct: 38  KQIQQEIEKMQIKAKQNYKNFTLEIKKLAENQIDY--IQQHIMK-EIEQMKKCNTYTQQQ 94

Query: 203 ISQVKSKILDALFK 244
           I  +K  IL+ + K
Sbjct: 95  IDDLKD-ILNQIVK 107


>UniRef50_Q8TTV9 Cluster: Phosphoribosylglycinamide
           formyltransferase; n=2; Methanosarcina|Rep:
           Phosphoribosylglycinamide formyltransferase -
           Methanosarcina acetivorans
          Length = 204

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 22/61 (36%), Positives = 40/61 (65%), Gaps = 5/61 (8%)
 Frame = +2

Query: 134 VTLHIVQDEFDE-KV--QC--KVLDCDSISQVKSKILDALFKNTPFHSDLLSMKLISSGV 298
           VT+H+V++E+D  K+  QC  +VLD D+I  +  ++L+   +   F+ +  ++KLIS GV
Sbjct: 147 VTIHLVEEEYDTGKIIRQCEIEVLDGDTIDTLSKRVLE---REHAFYVE--TLKLISEGV 201

Query: 299 M 301
           +
Sbjct: 202 I 202


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 599,043,034
Number of Sequences: 1657284
Number of extensions: 11038395
Number of successful extensions: 29543
Number of sequences better than 10.0: 54
Number of HSP's better than 10.0 without gapping: 28291
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29498
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52479343733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -