SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20053
         (739 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q240Q6 Cluster: ABC transporter family protein; n=1; Te...    34   4.2  
UniRef50_Q7R6G6 Cluster: GLP_170_203862_194038; n=2; Eukaryota|R...    33   7.3  

>UniRef50_Q240Q6 Cluster: ABC transporter family protein; n=1;
           Tetrahymena thermophila SB210|Rep: ABC transporter
           family protein - Tetrahymena thermophila SB210
          Length = 1411

 Score = 33.9 bits (74), Expect = 4.2
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -3

Query: 428 YKQIYFSISQFTSHQARIFFLT**SRDSLIF-FSYTLKFYTKIL 300
           YK +Y+S+SQ +  +   F L    RD+++F  SY  KFY K++
Sbjct: 508 YKGVYYSVSQISFAEQEPFILQGTVRDNILFGKSYDEKFYKKVV 551


>UniRef50_Q7R6G6 Cluster: GLP_170_203862_194038; n=2; Eukaryota|Rep:
            GLP_170_203862_194038 - Giardia lamblia ATCC 50803
          Length = 3274

 Score = 33.1 bits (72), Expect = 7.3
 Identities = 26/114 (22%), Positives = 52/114 (45%), Gaps = 5/114 (4%)
 Frame = -2

Query: 327  HPKILHKNINFVLFRRVFYGSFRFCSNAKNLYFNG*TTDCFTQDNTSTE-CEKDVFLSI- 154
            HPK+  K    VLF ++   +    SN K+   +G T +   ++ T    C   ++L I 
Sbjct: 723  HPKLTPKPQTLVLFVKLSDTAISMKSNTKDGSIDGGTIETHVEEETIVRPCSVSIYLQIP 782

Query: 153  -LDGKDTSSIDTKI--LVFFFFNLRHVTDLTLMSSYNLVHRLLHFENAKS*LVP 1
             + G   + +   +  +V    +++ +  L    +Y L+H  +H +NA + + P
Sbjct: 783  LVTGPMIADVSQSLFDIVLTTASIQSLMLLCSRYAYELLHIPIHRQNAMNAVAP 836


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 593,786,182
Number of Sequences: 1657284
Number of extensions: 10557878
Number of successful extensions: 21939
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 21234
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21935
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 60088620670
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -