SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20052
         (684 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9VUZ8 Cluster: CG13072-PA; n=8; Eumetazoa|Rep: CG13072...   106   4e-22
UniRef50_Q5DGC1 Cluster: SJCHGC06536 protein; n=1; Schistosoma j...    86   7e-16
UniRef50_A0PJ15 Cluster: Program cell death 5-like; n=1; Penaeus...    83   5e-15
UniRef50_UPI0000583CD0 Cluster: PREDICTED: similar to programmed...    75   1e-12
UniRef50_O14737 Cluster: Programmed cell death protein 5; n=20; ...    71   3e-11
UniRef50_Q59U19 Cluster: Possible DNA binding apoptosis-related ...    66   8e-10
UniRef50_Q93408 Cluster: Uncharacterized protein D2005.3; n=2; C...    65   2e-09
UniRef50_O13929 Cluster: Uncharacterized protein C23C4.09c; n=1;...    61   2e-08
UniRef50_A3B0R3 Cluster: Putative uncharacterized protein; n=2; ...    60   5e-08
UniRef50_Q6C042 Cluster: Similar to sp|Q04773 Saccharomyces cere...    60   7e-08
UniRef50_Q9FXG0 Cluster: F1N18.11 protein; n=7; Magnoliophyta|Re...    58   2e-07
UniRef50_Q7RJX3 Cluster: Putative uncharacterized protein PY0313...    56   6e-07
UniRef50_Q8I359 Cluster: Apoptosis-related protein, putative; n=...    55   1e-06
UniRef50_Q4J8U0 Cluster: DNA-binding protein Saci_1468; n=1; Sul...    55   2e-06
UniRef50_Q6CIK8 Cluster: Similarities with ca|CA1235|IPF20079 Ca...    54   2e-06
UniRef50_A5DQL8 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_Q54YS0 Cluster: Double-stranded DNA-binding domain fami...    53   7e-06
UniRef50_A6SS54 Cluster: Putative uncharacterized protein; n=2; ...    52   2e-05
UniRef50_Q24F21 Cluster: Double-stranded DNA-binding domain cont...    50   4e-05
UniRef50_A4D9G3 Cluster: DsDNA-binding protein PDCD5, putative; ...    50   5e-05
UniRef50_A1CJB0 Cluster: DsDNA-binding protein PDCD5, putative; ...    50   5e-05
UniRef50_Q4P795 Cluster: Putative uncharacterized protein; n=1; ...    50   7e-05
UniRef50_UPI0000DA3DB9 Cluster: PREDICTED: similar to Programmed...    49   1e-04
UniRef50_UPI0000498C12 Cluster: conserved hypothetical protein; ...    49   1e-04
UniRef50_Q971I0 Cluster: DNA-binding protein ST1374; n=7; Thermo...    48   2e-04
UniRef50_Q5KCJ7 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_Q4N0R0 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_Q97CU3 Cluster: DNA-binding protein TV0008; n=6; Thermo...    47   5e-04
UniRef50_Q8TUY2 Cluster: DNA-binding protein MK1619; n=6; Archae...    46   0.001
UniRef50_A7I9J0 Cluster: DNA-binding TFAR19-related protein; n=1...    45   0.002
UniRef50_A7AMY4 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q9HNP3 Cluster: DNA-binding protein VNG2008H; n=4; Halo...    44   0.003
UniRef50_A2D8K0 Cluster: Double-stranded DNA-binding domain cont...    44   0.005
UniRef50_Q2FTJ7 Cluster: DNA-binding protein Mhun_3016; n=2; Met...    44   0.005
UniRef50_Q1JSX4 Cluster: Apoptosis-related protein, putative; n=...    43   0.006
UniRef50_A0RYF8 Cluster: DNA-binding protein CENSYa_1764; n=2; T...    42   0.019
UniRef50_Q5CR40 Cluster: Possible double-stranded DNA-binding do...    41   0.032
UniRef50_Q58103 Cluster: DNA-binding protein MJ0691; n=2; Euryar...    41   0.032
UniRef50_A7D1L7 Cluster: DNA-binding TFAR19-related protein; n=1...    37   0.40 
UniRef50_A1RRN7 Cluster: DNA-binding protein Pisl_0441; n=4; The...    37   0.40 
UniRef50_Q8TIN0 Cluster: DNA-binding protein MA_4116; n=9; Eurya...    36   0.70 
UniRef50_Q4TAR1 Cluster: Chromosome undetermined SCAF7266, whole...    33   4.9  
UniRef50_Q2NGR0 Cluster: DNA-binding protein Msp_0595; n=2; Meth...    33   6.5  
UniRef50_Q7R304 Cluster: GLP_385_19897_20319; n=1; Giardia lambl...    33   8.6  

>UniRef50_Q9VUZ8 Cluster: CG13072-PA; n=8; Eumetazoa|Rep: CG13072-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 133

 Score =  106 bits (255), Expect = 4e-22
 Identities = 47/76 (61%), Positives = 63/76 (82%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARLNT+K+ +PEKA M ENM+ RMAQMGQ++ K+ +   + ILES N QMP+S+S+
Sbjct: 54  QQARARLNTLKVSKPEKAQMFENMVIRMAQMGQVRGKLDDAQFVSILESVNAQMPQSKSS 113

Query: 435 VKFDRRRAALDSDDED 482
           VK+DRRRAA+DSDD++
Sbjct: 114 VKYDRRRAAIDSDDDE 129


>UniRef50_Q5DGC1 Cluster: SJCHGC06536 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC06536 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 112

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 44/77 (57%), Positives = 57/77 (74%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           QDARARLNTI + +PEKA M+ENM+  MAQ G++  K++E  L QIL   +    KS +T
Sbjct: 37  QDARARLNTIAITKPEKAKMVENMLINMAQTGRLGPKLSEEQLKQILLQVSSGTQKS-TT 95

Query: 435 VKFDRRRAALDSDDEDL 485
           VKFDRRRAA+DSD++ L
Sbjct: 96  VKFDRRRAAIDSDEDSL 112


>UniRef50_A0PJ15 Cluster: Program cell death 5-like; n=1; Penaeus
           monodon|Rep: Program cell death 5-like - Penaeus monodon
           (Penoeid shrimp)
          Length = 123

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 42/75 (56%), Positives = 55/75 (73%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARLNTI + +PEK   +E++I +MA  GQI  K++E DLI ++E  N Q  K+ +T
Sbjct: 49  QQARARLNTIMVAKPEKGKQVESVIVQMATSGQIGGKLSENDLIGLVERVNAQTQKT-TT 107

Query: 435 VKFDRRRAALDSDDE 479
           VKFDRRRAALD DD+
Sbjct: 108 VKFDRRRAALDDDDD 122


>UniRef50_UPI0000583CD0 Cluster: PREDICTED: similar to programmed
           cell death 5; n=2; Coelomata|Rep: PREDICTED: similar to
           programmed cell death 5 - Strongylocentrotus purpuratus
          Length = 128

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 43/76 (56%), Positives = 53/76 (69%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARLN+I L +PEKA MIENM+ +MA+ GQI  KI E  L  +LE  N +M  S + 
Sbjct: 53  QSARARLNSIALVKPEKAKMIENMLIQMARQGQIGGKINEDGLKGLLEQVNVKMGHS-TK 111

Query: 435 VKFDRRRAALDSDDED 482
           VKFD RR  +DSDD+D
Sbjct: 112 VKFD-RRYRMDSDDDD 126


>UniRef50_O14737 Cluster: Programmed cell death protein 5; n=20;
           Euteleostomi|Rep: Programmed cell death protein 5 - Homo
           sapiens (Human)
          Length = 125

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 35/76 (46%), Positives = 55/76 (72%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q ARARL+ + L +PEK   +EN + +MA+ GQ+  K++E  LI+IL+  +QQ  K+ +T
Sbjct: 50  QSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKT-TT 108

Query: 435 VKFDRRRAALDSDDED 482
           VKF+RR+  +DSD++D
Sbjct: 109 VKFNRRK-VMDSDEDD 123


>UniRef50_Q59U19 Cluster: Possible DNA binding apoptosis-related
           protein; n=5; Saccharomycetales|Rep: Possible DNA
           binding apoptosis-related protein - Candida albicans
           (Yeast)
          Length = 138

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 29/76 (38%), Positives = 50/76 (65%), Gaps = 1/76 (1%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQ-QMPKSQST 434
           +AR RL+ +K+ RP++A  +EN I ++  MGQI  K+ E D++QIL+  ++    K Q+ 
Sbjct: 58  EARERLSRVKIVRPDRAQAVENYIIKLYSMGQIHQKLGEKDIVQILDGLSRDSQQKQQTK 117

Query: 435 VKFDRRRAALDSDDED 482
           + F+R+  A D D++D
Sbjct: 118 ITFNRKNIAADDDEDD 133


>UniRef50_Q93408 Cluster: Uncharacterized protein D2005.3; n=2;
           Caenorhabditis|Rep: Uncharacterized protein D2005.3 -
           Caenorhabditis elegans
          Length = 130

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 38/98 (38%), Positives = 56/98 (57%)
 Frame = +3

Query: 186 QSTTRKNASNGTS*THYIESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCK 365
           Q+  ++ A NG      I     Q A  RL+ + + +PEKA M+E  +  MA+ GQ+  K
Sbjct: 36  QAENQETAKNGM-----ISQILDQAAMQRLSNLAVAKPEKAQMVEAALINMARRGQLSGK 90

Query: 366 ITEPDLIQILESFNQQMPKSQSTVKFDRRRAALDSDDE 479
           +T+  L  ++E  + Q  K+ S VKFDRRR  LDSD+E
Sbjct: 91  MTDDGLKALMERVSAQTQKATS-VKFDRRRNELDSDEE 127


>UniRef50_O13929 Cluster: Uncharacterized protein C23C4.09c; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23C4.09c - Schizosaccharomyces pombe (Fission yeast)
          Length = 131

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 32/75 (42%), Positives = 45/75 (60%)
 Frame = +3

Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVK 440
           AR RL  I L R ++A  +E ++ RMA+ GQI  KI+EP+LI++LE  + ++ K   T  
Sbjct: 57  ARDRLRRIALVRKDRAEAVEELLLRMAKTGQISHKISEPELIELLEKISGEVSKRNETKI 116

Query: 441 FDRRRAALDSDDEDL 485
              RR   D DD DL
Sbjct: 117 VINRRVQDDEDDWDL 131


>UniRef50_A3B0R3 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 137

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 32/73 (43%), Positives = 45/73 (61%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTV 437
           +AR RL+ I L +P+KA  +E+++ R AQ G I  K++E  LI +LE  N    K Q+ V
Sbjct: 66  EARERLSRIALVKPDKARGVEDVLLRAAQSGGISEKVSEERLISLLEQINTHTSK-QTKV 124

Query: 438 KFDRRRAALDSDD 476
              RRR+ LD DD
Sbjct: 125 TIQRRRSVLDDDD 137


>UniRef50_Q6C042 Cluster: Similar to sp|Q04773 Saccharomyces
           cerevisiae YMR074c unknown function; n=1; Yarrowia
           lipolytica|Rep: Similar to sp|Q04773 Saccharomyces
           cerevisiae YMR074c unknown function - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 140

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 28/75 (37%), Positives = 47/75 (62%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTV 437
           +AR RL+ I++ R ++A  +E+M+ R+AQ GQI+ K+ E +L+ +L   ++Q  K+    
Sbjct: 63  NARERLSRIRIVRQDRARQVEDMLIRLAQTGQIRKKVEEEELVSLLGQISKQDQKTTGNN 122

Query: 438 KFDRRRAALDSDDED 482
           K    R  LD DD+D
Sbjct: 123 KIIINRRELDDDDDD 137


>UniRef50_Q9FXG0 Cluster: F1N18.11 protein; n=7; Magnoliophyta|Rep:
           F1N18.11 protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 129

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 33/69 (47%), Positives = 43/69 (62%)
 Frame = +3

Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVK 440
           AR R+  I L +PEKA  +E++I R AQMGQI  K++E  LI +LE  N Q  K Q+ V 
Sbjct: 61  ARERIARIALVKPEKARGVEDVILRAAQMGQIVEKVSEERLITLLEQINSQTTK-QTKVT 119

Query: 441 FDRRRAALD 467
           + RRR   D
Sbjct: 120 YQRRRGVDD 128


>UniRef50_Q7RJX3 Cluster: Putative uncharacterized protein PY03132;
           n=1; Plasmodium yoelii yoelii|Rep: Putative
           uncharacterized protein PY03132 - Plasmodium yoelii
           yoelii
          Length = 170

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 30/81 (37%), Positives = 48/81 (59%)
 Frame = +3

Query: 237 IESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQM 416
           ++S    DA ARL+ I + + E A  IE++I R +QMG +  K+ E  LI+++E  + +M
Sbjct: 84  LKSLLTPDAHARLSRIAIVKEENARRIEDIIIRNSQMGLLHKKVDEDQLIKLIEQVSGRM 143

Query: 417 PKSQSTVKFDRRRAALDSDDE 479
            K +  V+  RRR   D DD+
Sbjct: 144 NKKEPVVEI-RRRKQFDDDDD 163


>UniRef50_Q8I359 Cluster: Apoptosis-related protein, putative; n=4;
           Plasmodium|Rep: Apoptosis-related protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 164

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 30/81 (37%), Positives = 48/81 (59%)
 Frame = +3

Query: 237 IESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQM 416
           ++S    +A ARL+ I + + E+A  IE++I R +QMG I  KI +  LI+I+E  N ++
Sbjct: 78  LKSLLTPEAHARLSRIAIVKEEQARKIEDIIIRNSQMGLIYNKIDDDHLIKIIEQINDKI 137

Query: 417 PKSQSTVKFDRRRAALDSDDE 479
            K    ++  RRR   D DD+
Sbjct: 138 YKKDPVIEI-RRRKQFDDDDD 157


>UniRef50_Q4J8U0 Cluster: DNA-binding protein Saci_1468; n=1;
           Sulfolobus acidocaldarius|Rep: DNA-binding protein
           Saci_1468 - Sulfolobus acidocaldarius
          Length = 96

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 1/62 (1%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKS-QST 434
           +AR RL  +KL RPE A  IEN +  +AQ G+IQ +IT+ +L QIL   N Q  K  + T
Sbjct: 30  EARQRLTNVKLVRPELAEAIENQLIALAQSGRIQAQITDDELKQILAQLNSQTRKDYKIT 89

Query: 435 VK 440
           +K
Sbjct: 90  IK 91


>UniRef50_Q6CIK8 Cluster: Similarities with ca|CA1235|IPF20079
           Candida albicans unknown function; n=2;
           Saccharomycetaceae|Rep: Similarities with
           ca|CA1235|IPF20079 Candida albicans unknown function -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 133

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 32/104 (30%), Positives = 55/104 (52%), Gaps = 6/104 (5%)
 Frame = +3

Query: 189 STTRKNASNGTS*THYIESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKI 368
           S +  N SN       +      +A+ RL+ + L RPE+   +E  + +M + G I+ K+
Sbjct: 24  SESANNGSNDGQTQAILNQILDSNAQERLSRVALVRPERVKAVEAYLLQMVRSGAIRNKL 83

Query: 369 TEPDLIQILESFNQQMPKSQST-VKFDRRR-----AALDSDDED 482
           TE D++ ILES  +   K  +T + FDRR      +++D DD++
Sbjct: 84  TEQDIVGILESVGRDEQKRNTTRIIFDRREKGTASSSVDQDDDE 127


>UniRef50_A5DQL8 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 125

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 27/86 (31%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +3

Query: 228 THYIESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFN 407
           T  +    +  AR RL+ +++ RP++A  +E  I ++A  G I  K+ E D++ IL+  +
Sbjct: 36  TSMLAQVLEPSARERLSRVRIVRPDRADAVEQYIVKLASTGAISRKLAELDVVDILDGLS 95

Query: 408 QQMPKSQST-VKFDRRRAALDSDDED 482
           +   K  +T + FDR+      DDED
Sbjct: 96  RDEKKKTATKIVFDRKNTIDAEDDED 121


>UniRef50_Q54YS0 Cluster: Double-stranded DNA-binding domain family
           protein; n=1; Dictyostelium discoideum AX4|Rep:
           Double-stranded DNA-binding domain family protein -
           Dictyostelium discoideum AX4
          Length = 150

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 28/72 (38%), Positives = 44/72 (61%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTV 437
           DAR RL+ I + +PEK+  IE++I R AQ GQ+  ++ +  LI +LE  +++  K+  T+
Sbjct: 82  DARERLSRITIVKPEKSRQIEDLIIRAAQTGQLTERVDDAKLISLLEQLSEKTKKTTITM 141

Query: 438 KFDRRRAALDSD 473
           K   RR   D D
Sbjct: 142 K---RRTIEDDD 150


>UniRef50_A6SS54 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 494

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/76 (34%), Positives = 45/76 (59%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTV 437
           +A  RL  I+L +  +A  +EN +  +A+ GQ++ KITE  L  +L S ++   +++  +
Sbjct: 417 EAADRLGRIRLVKESRAVDVENRLIMLARSGQLRSKITEEQLKDLLSSVSEAQ-ETKEKI 475

Query: 438 KFDRRRAALDSDDEDL 485
              RR+ A D DD+DL
Sbjct: 476 VVTRRKGAWDDDDDDL 491


>UniRef50_Q24F21 Cluster: Double-stranded DNA-binding domain
           containing protein; n=3; Oligohymenophorea|Rep:
           Double-stranded DNA-binding domain containing protein -
           Tetrahymena thermophila SB210
          Length = 787

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 29/80 (36%), Positives = 49/80 (61%)
 Frame = +3

Query: 237 IESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQM 416
           +++    +AR+RLN IKL +PEKA  I   + + A+MG+I  KI+E + ++++E+   Q 
Sbjct: 711 LKAILSDEARSRLNNIKLVKPEKAQQIIATLLQGAKMGRITNKISEAEFLKMVETSTTQ- 769

Query: 417 PKSQSTVKFDRRRAALDSDD 476
              ++ V F RR   LD +D
Sbjct: 770 -AQETKVSFKRR--TLDDED 786


>UniRef50_A4D9G3 Cluster: DsDNA-binding protein PDCD5, putative;
           n=1; Aspergillus fumigatus|Rep: DsDNA-binding protein
           PDCD5, putative - Aspergillus fumigatus (Sartorya
           fumigata)
          Length = 151

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 2/76 (2%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESF--NQQMPKSQS 431
           +A  RL  I+L +  +A  +EN +  +AQ GQI+ K+TE  L ++L +   NQ+  + + 
Sbjct: 72  EAADRLGRIRLVKESRAIDVENRLIMLAQTGQIRQKVTEEQLKELLNAIAENQRKDEEEQ 131

Query: 432 TVKFDRRRAALDSDDE 479
            +   RR+   D DD+
Sbjct: 132 KIVISRRKGGWDDDDD 147


>UniRef50_A1CJB0 Cluster: DsDNA-binding protein PDCD5, putative;
           n=13; Pezizomycotina|Rep: DsDNA-binding protein PDCD5,
           putative - Aspergillus clavatus
          Length = 142

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPK-SQST 434
           +A  RL  I+L +  +A  +EN +  +AQ GQI+ K+TE  L  +L +  +   K  Q  
Sbjct: 64  EAADRLGRIRLVKESRALDVENRLIMLAQTGQIRQKVTEDQLKDLLNAIAENQRKDEQEK 123

Query: 435 VKFDRRRAALDSDDE 479
           + F RR+   D DD+
Sbjct: 124 IVFTRRKGGWDDDDD 138


>UniRef50_Q4P795 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 138

 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 24/51 (47%), Positives = 36/51 (70%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQ 410
           +AR RL+ I L +P+KA  I +++ RMAQ GQI+ +ITE  LI +L+  +Q
Sbjct: 75  EARERLSRIGLVKPQKARQITDLLIRMAQSGQIRGRITEDQLIGLLDQVDQ 125


>UniRef50_UPI0000DA3DB9 Cluster: PREDICTED: similar to Programmed
           cell death protein 5 (TFAR19 protein) (TF-1 cell
           apoptosis related gene 19 protein); n=1; Rattus
           norvegicus|Rep: PREDICTED: similar to Programmed cell
           death protein 5 (TFAR19 protein) (TF-1 cell apoptosis
           related gene 19 protein) - Rattus norvegicus
          Length = 86

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/76 (35%), Positives = 47/76 (61%)
 Frame = +3

Query: 255 QDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           Q A  RL+ + L +P+K   +E+ + +MA+ GQ+   ++E   I+  E  +QQ  + ++T
Sbjct: 12  QSAWVRLSDLALVKPDKTKAVEHRV-QMARYGQLSGTVSEQGFIETPEKVSQQ-TEEKAT 69

Query: 435 VKFDRRRAALDSDDED 482
           VKF+RR    DSD++D
Sbjct: 70  VKFNRREVT-DSDEDD 84


>UniRef50_UPI0000498C12 Cluster: conserved hypothetical protein;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: conserved
           hypothetical protein - Entamoeba histolytica HM-1:IMSS
          Length = 107

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/67 (35%), Positives = 41/67 (61%)
 Frame = +3

Query: 237 IESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQM 416
           I+S  + +A+ RL +I L +PEKA  + +MI  M Q GQ+  KI E  LI +++  N+  
Sbjct: 25  IDSVLEPEAKERLASIALVKPEKARQVGDMILMMCQRGQMTGKINEGGLISMIDQINENK 84

Query: 417 PKSQSTV 437
            +++ T+
Sbjct: 85  TETKVTL 91


>UniRef50_Q971I0 Cluster: DNA-binding protein ST1374; n=7;
           Thermoprotei|Rep: DNA-binding protein ST1374 -
           Sulfolobus tokodaii
          Length = 118

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/55 (43%), Positives = 33/55 (60%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPK 422
           +AR RL  +KL +PE A  IEN +  +AQ G+IQ  IT+ +L +IL     Q  K
Sbjct: 52  EARQRLANVKLVKPELAEAIENQLIALAQSGRIQAPITDEELKEILAQLTNQTRK 106


>UniRef50_Q5KCJ7 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 145

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 1/103 (0%)
 Frame = +3

Query: 159 RGNR*PEQCQSTTRKNASNGTS*THYIESSAKQDARARLNTIKLGRPEKAAMIENMICRM 338
           RG   PE+ ++   +           I +  +  AR RL+ I L RP+ AA +E ++  M
Sbjct: 23  RGAPSPEEREAAEARARQQDEMKRTMIAAMLEPAARERLSRISLTRPQLAAQVETLLVNM 82

Query: 339 AQMGQIQCKITEPDLIQILESFNQQMP-KSQSTVKFDRRRAAL 464
            Q GQI+ ++++  L  +LE  +   P KS S+V    R   L
Sbjct: 83  GQQGQIRGQVSDEALKGLLEQVSNPAPAKSTSSVSQSSRTKTL 125


>UniRef50_Q4N0R0 Cluster: Putative uncharacterized protein; n=1;
           Theileria parva|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 115

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQ-MGQIQCKITEPDLIQILESFNQQMPKSQST 434
           +A+ RLN I   +PEKA +IEN + + AQ       K+T+ +L QI+E+  +    +  T
Sbjct: 43  EAQERLNRISSVKPEKATLIENFLLQNAQKYAYGTSKVTDQELKQIIEAITKSQ-SNTGT 101

Query: 435 VKFDRRRAALDSDDE 479
           ++  R+R   DSDDE
Sbjct: 102 IRIQRKR--WDSDDE 114


>UniRef50_Q97CU3 Cluster: DNA-binding protein TV0008; n=6;
           Thermoplasmatales|Rep: DNA-binding protein TV0008 -
           Thermoplasma volcanium
          Length = 115

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 2/62 (3%)
 Frame = +3

Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESF--NQQMPKSQST 434
           AR RLN ++L RP+ A  +EN + ++A MG+I   I E D+I IL     N++ PK +  
Sbjct: 54  ARERLNNVRLVRPDLADNVENQLIQLASMGRINRIIKESDIIDILSKLTENKREPKIERR 113

Query: 435 VK 440
            K
Sbjct: 114 SK 115


>UniRef50_Q8TUY2 Cluster: DNA-binding protein MK1619; n=6;
           Archaea|Rep: DNA-binding protein MK1619 - Methanopyrus
           kandleri
          Length = 117

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/65 (35%), Positives = 40/65 (61%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTV 437
           +AR RL  ++L RP+ A  +EN + ++AQ GQ++ KI E  L +IL+  +    K +  +
Sbjct: 54  EARERLARVRLARPQLAQAVENYLLQLAQTGQLKEKIDEDQLKRILKQVSDATRK-EYRI 112

Query: 438 KFDRR 452
           +F R+
Sbjct: 113 RFKRK 117


>UniRef50_A7I9J0 Cluster: DNA-binding TFAR19-related protein; n=1;
           Candidatus Methanoregula boonei 6A8|Rep: DNA-binding
           TFAR19-related protein - Methanoregula boonei (strain
           6A8)
          Length = 112

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/46 (43%), Positives = 32/46 (69%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQIL 395
           DAR RLNTI+L +P+ A+ +E  +  +AQ G+++ KIT+  L  +L
Sbjct: 52  DARERLNTIRLTKPDFASAVEQQLVMLAQSGRLRQKITDAQLKDLL 97


>UniRef50_A7AMY4 Cluster: Putative uncharacterized protein; n=1;
           Babesia bovis|Rep: Putative uncharacterized protein -
           Babesia bovis
          Length = 125

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/74 (31%), Positives = 39/74 (52%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTV 437
           +A+ RL+ I + +PEKA  IEN + +       + K+ + +L  ++ES +       S +
Sbjct: 49  EAQERLHRIAMVKPEKATQIENFLLQTTFKSGRRTKMDDEELRHLIESMSTNSSSKISNI 108

Query: 438 KFDRRRAALDSDDE 479
           K  R+R   DSD E
Sbjct: 109 KIQRKRWNDDSDSE 122


>UniRef50_Q9HNP3 Cluster: DNA-binding protein VNG2008H; n=4;
           Halobacteriaceae|Rep: DNA-binding protein VNG2008H -
           Halobacterium salinarium (Halobacterium halobium)
          Length = 117

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/65 (35%), Positives = 36/65 (55%)
 Frame = +3

Query: 237 IESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQM 416
           ++ +    AR RLNTI++ +PE A   E  +  +AQ G++Q +I E  + +IL       
Sbjct: 50  LKQNLTDGARKRLNTIRMSKPEFAEQAEQQVLALAQSGRVQGRIDEDQMKEILRELK--- 106

Query: 417 PKSQS 431
           P SQS
Sbjct: 107 PDSQS 111


>UniRef50_A2D8K0 Cluster: Double-stranded DNA-binding domain
           containing protein; n=2; Trichomonas vaginalis G3|Rep:
           Double-stranded DNA-binding domain containing protein -
           Trichomonas vaginalis G3
          Length = 109

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTV 437
           +A+ RL  I L +PEK+ ++E++  +MAQ   +  +I++  L++IL   +      +  +
Sbjct: 33  EAKERLGRISLVKPEKSRLVEDLCLQMAQQNNLGAQISDAQLMEILNKVSASEQTHEVKI 92

Query: 438 K-FDRRRAALDSDDE 479
           K   +   A D DDE
Sbjct: 93  KHHGKADEAWDDDDE 107


>UniRef50_Q2FTJ7 Cluster: DNA-binding protein Mhun_3016; n=2;
           Methanomicrobiales|Rep: DNA-binding protein Mhun_3016 -
           Methanospirillum hungatei (strain JF-1 / DSM 864)
          Length = 110

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/47 (44%), Positives = 32/47 (68%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILE 398
           +AR RLNTIKL +P+ A  +E  +  +AQ G+I+ KI++  L  IL+
Sbjct: 49  EARERLNTIKLTKPDFARAVEQQLVMLAQSGRIKNKISDDQLKVILQ 95


>UniRef50_Q1JSX4 Cluster: Apoptosis-related protein, putative; n=1;
           Toxoplasma gondii|Rep: Apoptosis-related protein,
           putative - Toxoplasma gondii
          Length = 122

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +3

Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVK 440
           A+ RL+ I+L + +KA  +E +I + AQ G++  K+ E  LI++L+        +++T K
Sbjct: 50  AQERLHRIQLVKADKAREVEALILQNAQRGRLADKVDEATLIELLQQ-TSAASAAKNTPK 108

Query: 441 FDRRRAALDSDDE 479
              RR   D DD+
Sbjct: 109 VTMRRRFSDDDDD 121


>UniRef50_A0RYF8 Cluster: DNA-binding protein CENSYa_1764; n=2;
           Thermoprotei|Rep: DNA-binding protein CENSYa_1764 -
           Cenarchaeum symbiosum
          Length = 95

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 24/64 (37%), Positives = 38/64 (59%)
 Frame = +3

Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVK 440
           AR RL+ I++ +PE AA +E+ +   A  G++  KI++  L QIL+S    M K +   K
Sbjct: 36  ARMRLSNIRMVKPETAAALESHLINAASQGRLAGKISDEHLKQILQS----MQKPRREFK 91

Query: 441 FDRR 452
            +RR
Sbjct: 92  INRR 95


>UniRef50_Q5CR40 Cluster: Possible double-stranded DNA-binding
           domain, small conserved protein; n=2;
           Cryptosporidium|Rep: Possible double-stranded
           DNA-binding domain, small conserved protein -
           Cryptosporidium parvum Iowa II
          Length = 130

 Score = 40.7 bits (91), Expect = 0.032
 Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = +3

Query: 270 RLNTIKLGRPEKAAMIENMICRMAQMGQIQ--CKITEPDLIQILESFNQQMPKSQSTVKF 443
           RLN I L +P+K   IE+ I R A+        KI E +LI ++   N+   KS S +K 
Sbjct: 58  RLNRIALVKPDKVLQIEDYILRTARNHGYSPYRKIQESELINMISMMNETTEKSSSRIKI 117

Query: 444 DRRRAALDSDD 476
             R+   D DD
Sbjct: 118 -CRKGVFDDDD 127


>UniRef50_Q58103 Cluster: DNA-binding protein MJ0691; n=2;
           Euryarchaeota|Rep: DNA-binding protein MJ0691 -
           Methanococcus jannaschii
          Length = 109

 Score = 40.7 bits (91), Expect = 0.032
 Identities = 20/65 (30%), Positives = 38/65 (58%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTV 437
           +AR RL  I+L RPE A  +E  + ++AQ+G++   +++ D   +LE  +  + K +  +
Sbjct: 46  EARERLERIRLARPEFAEAVEVQLIQLAQLGRLPIPLSDEDFKALLERIS-ALTKRKREI 104

Query: 438 KFDRR 452
           K  R+
Sbjct: 105 KIVRK 109


>UniRef50_A7D1L7 Cluster: DNA-binding TFAR19-related protein; n=1;
           Halorubrum lacusprofundi ATCC 49239|Rep: DNA-binding
           TFAR19-related protein - Halorubrum lacusprofundi ATCC
           49239
          Length = 172

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 22/65 (33%), Positives = 35/65 (53%)
 Frame = +3

Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVK 440
           AR RLN + + +PE    ++  +  +AQ G+IQ +I E  +  +L+   +  P  QS   
Sbjct: 113 ARQRLNAVAMSKPEFGDKVKQQVAALAQSGRIQGQIDEDQMRDLLK---ELQPDQQS--- 166

Query: 441 FDRRR 455
           FD RR
Sbjct: 167 FDIRR 171


>UniRef50_A1RRN7 Cluster: DNA-binding protein Pisl_0441; n=4;
           Thermoprotei|Rep: DNA-binding protein Pisl_0441 -
           Pyrobaculum islandicum (strain DSM 4184 / JCM 9189)
          Length = 110

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 18/52 (34%), Positives = 31/52 (59%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQ 413
           +A ARL+ I++ RPE A  +E  +  +A  G+++  I +  L +ILE+   Q
Sbjct: 50  EALARLDNIRVVRPELAEALEQQLIALASSGRVKVPIDDETLKKILEAIYSQ 101


>UniRef50_Q8TIN0 Cluster: DNA-binding protein MA_4116; n=9;
           Euryarchaeota|Rep: DNA-binding protein MA_4116 -
           Methanosarcina acetivorans
          Length = 122

 Score = 36.3 bits (80), Expect = 0.70
 Identities = 17/59 (28%), Positives = 31/59 (52%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQST 434
           +AR RL T+K+ RP     +E  +  +AQ G+++ +I +  L  +L     +  K+  T
Sbjct: 62  EARERLTTLKMSRPALGEQLEMQLISLAQSGRLKAQIDDEQLKTLLMRMQPKKRKTSIT 120


>UniRef50_Q4TAR1 Cluster: Chromosome undetermined SCAF7266, whole
           genome shotgun sequence; n=2; Clupeocephala|Rep:
           Chromosome undetermined SCAF7266, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1297

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 14/45 (31%), Positives = 27/45 (60%)
 Frame = +1

Query: 388 KFWNPLINKCPNLRAPLSLTEEGLHWTRMMKICK*LLV*VHISCL 522
           KFW+ LIN C ++   + +   G++ TR+  +C+ + + +H S L
Sbjct: 794 KFWHMLINLCFHISLTVGVFAGGINQTRLASVCQAVGILLHYSTL 838


>UniRef50_Q2NGR0 Cluster: DNA-binding protein Msp_0595; n=2;
           Methanobacteriaceae|Rep: DNA-binding protein Msp_0595 -
           Methanosphaera stadtmanae (strain DSM 3091)
          Length = 118

 Score = 33.1 bits (72), Expect = 6.5
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQIL 395
           +AR RL  ++L + E    IE  + +MAQ  ++Q  +T+  L QIL
Sbjct: 58  EARQRLANLRLTKAELVNAIEMQLIQMAQAKRLQIPVTDATLKQIL 103


>UniRef50_Q7R304 Cluster: GLP_385_19897_20319; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_385_19897_20319 - Giardia lamblia
           ATCC 50803
          Length = 140

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 258 DARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQ 389
           DA+ RL  I++  PE+A+ +E ++ +  Q GQ+  +    D+++
Sbjct: 36  DAKERLRRIEIVSPERASRVEAILLQQMQRGQLSPQSVSDDMLK 79


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 566,718,877
Number of Sequences: 1657284
Number of extensions: 9842636
Number of successful extensions: 18558
Number of sequences better than 10.0: 44
Number of HSP's better than 10.0 without gapping: 18119
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18550
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 53305790091
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -