SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20051
         (781 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P13639 Cluster: Elongation factor 2; n=491; Eukaryota|R...   124   2e-27
UniRef50_A6RAK0 Cluster: Putative uncharacterized protein; n=1; ...   114   3e-24
UniRef50_Q0CYA7 Cluster: Elongation factor 2; n=1; Aspergillus t...   112   8e-24
UniRef50_A6SB62 Cluster: Putative uncharacterized protein; n=1; ...   109   8e-23
UniRef50_P15112 Cluster: Elongation factor 2; n=2; Eukaryota|Rep...    96   8e-19
UniRef50_Q7R0C7 Cluster: GLP_608_18578_21274; n=2; Giardia intes...    96   1e-18
UniRef50_UPI0000D62D3D Cluster: UPI0000D62D3D related cluster; n...    91   3e-17
UniRef50_Q8SQT7 Cluster: TRANSLATION ELONGATION FACTOR 2; n=3; M...    88   3e-16
UniRef50_A0DRB1 Cluster: Chromosome undetermined scaffold_60, wh...    85   2e-15
UniRef50_Q54JK7 Cluster: Putative uncharacterized protein; n=1; ...    79   1e-13
UniRef50_O74945 Cluster: GTPase Ria1; n=1; Schizosaccharomyces p...    74   5e-12
UniRef50_Q23U41 Cluster: Elongation factor G, domain IV family p...    72   1e-11
UniRef50_Q6C8W8 Cluster: Yarrowia lipolytica chromosome D of str...    70   8e-11
UniRef50_Q4Q9N1 Cluster: Elongation factor 2-like protein; n=6; ...    69   1e-10
UniRef50_Q54WF2 Cluster: Putative uncharacterized protein; n=1; ...    69   1e-10
UniRef50_A1DDI0 Cluster: Ribosome biogenesis protein Ria1, putat...    69   2e-10
UniRef50_A6NKY5 Cluster: Uncharacterized protein EFTUD1; n=35; E...    68   2e-10
UniRef50_A6S9S7 Cluster: Putative uncharacterized protein; n=1; ...    68   2e-10
UniRef50_UPI0000DB7182 Cluster: PREDICTED: similar to elongation...    67   4e-10
UniRef50_UPI0000DA1A06 Cluster: PREDICTED: similar to elongation...    67   4e-10
UniRef50_A7S2I1 Cluster: Predicted protein; n=1; Nematostella ve...    67   4e-10
UniRef50_A2R3P3 Cluster: Contig An14c0170, complete genome; n=7;...    67   4e-10
UniRef50_Q17ME5 Cluster: Translation elongation factor; n=2; Cul...    66   7e-10
UniRef50_UPI0000D55A65 Cluster: PREDICTED: similar to CG33158-PB...    66   9e-10
UniRef50_Q9VV61 Cluster: CG33158-PB; n=4; Sophophora|Rep: CG3315...    66   9e-10
UniRef50_A0E802 Cluster: Chromosome undetermined scaffold_82, wh...    66   9e-10
UniRef50_Q4UIT0 Cluster: Elongation factor 2, putative; n=2; The...    65   2e-09
UniRef50_P53893 Cluster: Uncharacterized GTP-binding protein YNL...    65   2e-09
UniRef50_UPI0001509D7A Cluster: Elongation factor Tu GTP binding...    65   2e-09
UniRef50_A0RW30 Cluster: Translation elongation factor; n=4; Cre...    64   3e-09
UniRef50_UPI000049A247 Cluster: Elongation factor 2; n=1; Entamo...    64   4e-09
UniRef50_A3FPW4 Cluster: Elongation factor-like protein; n=3; Cr...    64   4e-09
UniRef50_Q754P1 Cluster: AFR031Cp; n=1; Eremothecium gossypii|Re...    64   4e-09
UniRef50_Q5KQ62 Cluster: Translation elongation factor 2, putati...    64   5e-09
UniRef50_Q6BJX4 Cluster: Debaryomyces hansenii chromosome F of s...    63   7e-09
UniRef50_Q6IRN1 Cluster: MGC83880 protein; n=7; Coelomata|Rep: M...    63   9e-09
UniRef50_Q7RLB9 Cluster: Elongation factor Tu family, putative; ...    63   9e-09
UniRef50_A2Y5K4 Cluster: Putative uncharacterized protein; n=3; ...    62   1e-08
UniRef50_Q8TXJ4 Cluster: Elongation factor 2 (EF-2) [Contains: M...    62   1e-08
UniRef50_A7AVU9 Cluster: Elongation factor Tu-like protein; n=1;...    62   2e-08
UniRef50_Q00RU6 Cluster: Elongation factor Tu family protein; n=...    61   3e-08
UniRef50_Q96VE6 Cluster: Putative translation elongation factor ...    60   6e-08
UniRef50_Q8IDL6 Cluster: Elongation factor Tu, putative; n=2; Pl...    60   8e-08
UniRef50_O17944 Cluster: Putative uncharacterized protein; n=3; ...    60   8e-08
UniRef50_Q8SQV5 Cluster: TRANSLATION ELONGATION FACTOR 2; n=1; E...    60   8e-08
UniRef50_A5K8C0 Cluster: Translation elongation factor, putative...    59   1e-07
UniRef50_Q8ZZC1 Cluster: Elongation factor 2; n=17; Thermoprotei...    59   1e-07
UniRef50_Q9LS91 Cluster: Elongation factor EF-2; n=1; Arabidopsi...    56   1e-06
UniRef50_A2EAD8 Cluster: Elongation factor Tu GTP binding domain...    56   1e-06
UniRef50_Q73R08 Cluster: Elongation factor G 1; n=2; Treponema|R...    56   1e-06
UniRef50_Q8KCJ5 Cluster: GTP-binding elongation factor family pr...    55   2e-06
UniRef50_A7QSS1 Cluster: Chromosome chr4 scaffold_162, whole gen...    55   2e-06
UniRef50_Q9VAX8 Cluster: CG4849-PA; n=6; Eukaryota|Rep: CG4849-P...    55   2e-06
UniRef50_Q0AXN1 Cluster: Elongation factor G 1; n=1; Syntrophomo...    55   2e-06
UniRef50_Q969S9-2 Cluster: Isoform 2 of Q969S9 ; n=8; Tetrapoda|...    54   3e-06
UniRef50_Q7QS70 Cluster: GLP_449_30827_27231; n=1; Giardia lambl...    54   3e-06
UniRef50_Q969S9 Cluster: Elongation factor G 2, mitochondrial pr...    54   3e-06
UniRef50_A6GCI1 Cluster: Elongation factor G; n=2; Proteobacteri...    54   4e-06
UniRef50_Q4QA83 Cluster: Elongation factor, putative; n=5; Trypa...    54   5e-06
UniRef50_UPI0000519D80 Cluster: PREDICTED: similar to mitochondr...    53   7e-06
UniRef50_Q38BU9 Cluster: GTP-binding protein, putative; n=3; Try...    53   7e-06
UniRef50_A0DDX3 Cluster: Chromosome undetermined scaffold_47, wh...    53   7e-06
UniRef50_Q2JUX5 Cluster: Elongation factor G; n=58; Bacteria|Rep...    53   7e-06
UniRef50_P34811 Cluster: Elongation factor G, chloroplast precur...    53   7e-06
UniRef50_A2XK54 Cluster: Putative uncharacterized protein; n=3; ...    53   9e-06
UniRef50_Q4XZI7 Cluster: Elongation factor G, putative; n=6; Pla...    52   1e-05
UniRef50_O87844 Cluster: Elongation factor G 2; n=2; Streptomyce...    52   1e-05
UniRef50_A7HB64 Cluster: Translation elongation factor G; n=2; A...    52   2e-05
UniRef50_Q4P257 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_Q15029 Cluster: 116 kDa U5 small nuclear ribonucleoprot...    52   2e-05
UniRef50_Q7MA53 Cluster: Elongation factor G; n=36; Bacteria|Rep...    52   2e-05
UniRef50_Q7UN30 Cluster: Elongation factor G; n=2; Planctomyceta...    52   2e-05
UniRef50_A7CUV7 Cluster: Translation elongation factor G; n=1; O...    52   2e-05
UniRef50_Q6ESY0 Cluster: Putative elongation factor 2; n=2; Oryz...    52   2e-05
UniRef50_A1CA46 Cluster: Translation elongation factor G2, putat...    51   3e-05
UniRef50_Q803Q6 Cluster: Eftud2 protein; n=9; Eumetazoa|Rep: Eft...    51   4e-05
UniRef50_Q7SXL2 Cluster: Eftud2 protein; n=2; Eukaryota|Rep: Eft...    51   4e-05
UniRef50_Q3AK84 Cluster: GTP-binding protein TypA; n=15; Bacteri...    51   4e-05
UniRef50_A1ZR77 Cluster: Translation elongation factor G; n=2; B...    51   4e-05
UniRef50_Q384D0 Cluster: Elongation factor G2-like protein; n=5;...    51   4e-05
UniRef50_A7AM19 Cluster: Translation elongation factor G, putati...    51   4e-05
UniRef50_Q9HWD2 Cluster: Elongation factor G 1; n=46; Bacteria|R...    51   4e-05
UniRef50_Q4SZZ9 Cluster: Chromosome 3 SCAF11420, whole genome sh...    50   5e-05
UniRef50_Q9AIG7 Cluster: Elongation factor G; n=2; Candidatus Ca...    50   5e-05
UniRef50_Q9AA65 Cluster: Elongation factor Tu family protein; n=...    50   7e-05
UniRef50_Q7PZ10 Cluster: ENSANGP00000017855; n=7; Eukaryota|Rep:...    50   7e-05
UniRef50_Q4UGL7 Cluster: Translation elongation factor G (EF-G),...    50   7e-05
UniRef50_Q4Q3F0 Cluster: GTP-binding protein, putative; n=3; Lei...    50   7e-05
UniRef50_Q4N936 Cluster: Translation elongation factor G 2, puta...    50   7e-05
UniRef50_A3LWR2 Cluster: Mitochondrial elongation factor G-like ...    50   7e-05
UniRef50_Q660H9 Cluster: Elongation factor G 2; n=3; Borrelia bu...    50   7e-05
UniRef50_Q7VCA7 Cluster: Predicted membrane GTPase; n=3; Bacteri...    50   9e-05
UniRef50_Q72B39 Cluster: Translation elongation factor G; n=3; D...    50   9e-05
UniRef50_Q0E3S2 Cluster: Os02g0157700 protein; n=4; cellular org...    50   9e-05
UniRef50_A2XIM0 Cluster: Putative uncharacterized protein; n=1; ...    50   9e-05
UniRef50_Q4Q219 Cluster: Mitochondrial elongation factor G, puta...    50   9e-05
UniRef50_A0Q2C8 Cluster: Translation elongation factor G; n=1; C...    49   1e-04
UniRef50_Q23FM4 Cluster: Elongation factor G, domain IV family p...    49   1e-04
UniRef50_Q6FDS6 Cluster: Elongation factor G; n=157; cellular or...    49   1e-04
UniRef50_Q96RP9 Cluster: Elongation factor G 1, mitochondrial pr...    49   1e-04
UniRef50_UPI0000D56919 Cluster: PREDICTED: similar to CG31159-PA...    49   2e-04
UniRef50_A4YUJ6 Cluster: Protein chain elongation factor EF-G, G...    49   2e-04
UniRef50_A2Y968 Cluster: Putative uncharacterized protein; n=2; ...    49   2e-04
UniRef50_Q7Q1K8 Cluster: ENSANGP00000010217; n=2; Coelomata|Rep:...    49   2e-04
UniRef50_A0D5J3 Cluster: Chromosome undetermined scaffold_39, wh...    49   2e-04
UniRef50_A0C617 Cluster: Chromosome undetermined scaffold_151, w...    49   2e-04
UniRef50_P34617 Cluster: Uncharacterized GTP-binding protein ZK1...    49   2e-04
UniRef50_Q74A61 Cluster: Elongation factor G 1; n=6; Desulfuromo...    49   2e-04
UniRef50_UPI0000E46328 Cluster: PREDICTED: similar to G elongati...    48   2e-04
UniRef50_A1FR56 Cluster: Translation elongation factor G; n=1; S...    48   2e-04
UniRef50_Q4N321 Cluster: U5 small nuclear ribonucleoprotein, put...    48   2e-04
UniRef50_A6QTV7 Cluster: 116 kDa U5 small nuclear ribonucleoprot...    48   2e-04
UniRef50_Q9UXB6 Cluster: Putative uncharacterized protein ORF-c1...    48   2e-04
UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog; ...    48   2e-04
UniRef50_Q39SN2 Cluster: Elongation factor G 2; n=4; Bacteria|Re...    48   2e-04
UniRef50_Q9VRH6 Cluster: CG1410-PA, isoform A; n=3; Drosophila m...    48   3e-04
UniRef50_Q95Y73 Cluster: Putative uncharacterized protein; n=2; ...    48   3e-04
UniRef50_Q8I592 Cluster: Elongation factor g, putative; n=1; Pla...    48   3e-04
UniRef50_Q59LI8 Cluster: Potential spliceosomal translocase-like...    48   3e-04
UniRef50_Q5K8D2 Cluster: GTP-Binding protein lepA, putative; n=5...    48   3e-04
UniRef50_Q4PDC2 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_A5DTX8 Cluster: Putative uncharacterized protein; n=3; ...    48   3e-04
UniRef50_P44910 Cluster: GTP-binding protein typA/bipA homolog; ...    48   3e-04
UniRef50_Q4MYM5 Cluster: Elongation factor G, putative; n=2; The...    47   5e-04
UniRef50_Q6CBI0 Cluster: Yarrowia lipolytica chromosome C of str...    47   5e-04
UniRef50_Q4PDX0 Cluster: Putative uncharacterized protein; n=1; ...    47   5e-04
UniRef50_Q7XQQ7 Cluster: OSJNBa0091D06.15 protein; n=66; cellula...    47   6e-04
UniRef50_Q22AK9 Cluster: Translation elongation factor G; n=3; O...    47   6e-04
UniRef50_A2R994 Cluster: Contig An17c0030, complete genome; n=1;...    47   6e-04
UniRef50_O07631 Cluster: GTP-binding protein typA/bipA homolog; ...    47   6e-04
UniRef50_Q92IQ1 Cluster: GTP-binding protein lepA; n=187; Bacter...    47   6e-04
UniRef50_P0A557 Cluster: Elongation factor G; n=248; Bacteria|Re...    47   6e-04
UniRef50_A6C5F4 Cluster: Elongation factor G; n=1; Planctomyces ...    46   8e-04
UniRef50_P39677 Cluster: Elongation factor G 2, mitochondrial pr...    46   8e-04
UniRef50_Q4Q870 Cluster: Elongation factor G2-like protein; n=3;...    46   0.001
UniRef50_A5DX67 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q7MWJ5 Cluster: GTP-binding protein TypA; n=31; Bacteri...    46   0.001
UniRef50_Q5CU80 Cluster: Snu114p GTpase, U5 snRNP-specific prote...    46   0.001
UniRef50_Q4N072 Cluster: GTP-binding elongation factor, putative...    46   0.001
UniRef50_P0A3B4 Cluster: GTP-binding protein typA/bipA; n=97; Ba...    46   0.001
UniRef50_Q2S6X1 Cluster: Elongation factor G 2; n=1; Hahella che...    46   0.001
UniRef50_Q64MT7 Cluster: GTP-binding elongation factor family pr...    45   0.002
UniRef50_Q1ZVV6 Cluster: GTP-binding regulator BipA/TypA; n=4; V...    45   0.002
UniRef50_A2U1S4 Cluster: GTP-binding elongation factor family pr...    45   0.002
UniRef50_Q4Y6S3 Cluster: Elongation factor g, putative; n=4; Pla...    45   0.002
UniRef50_P46943 Cluster: GTP-binding protein GUF1; n=37; root|Re...    45   0.002
UniRef50_Q8N442 Cluster: GTP-binding protein GUF1 homolog; n=108...    45   0.002
UniRef50_Q1II96 Cluster: GTP-binding protein TypA; n=2; Bacteria...    45   0.002
UniRef50_Q24BY4 Cluster: Elongation factor Tu GTP binding domain...    45   0.002
UniRef50_A7ATU9 Cluster: U5 small nuclear ribonuclear protein, p...    45   0.002
UniRef50_A0DDX4 Cluster: Chromosome undetermined scaffold_47, wh...    45   0.002
UniRef50_A6SDI5 Cluster: Putative uncharacterized protein; n=2; ...    45   0.002
UniRef50_Q9A9F4 Cluster: GTP-binding protein lepA; n=519; cellul...    45   0.002
UniRef50_Q8F983 Cluster: Elongation factor G; n=98; cellular org...    45   0.002
UniRef50_UPI00006CB620 Cluster: hypothetical protein TTHERM_0044...    44   0.003
UniRef50_Q8C3X4-2 Cluster: Isoform 2 of Q8C3X4 ; n=3; Murinae|Re...    44   0.003
UniRef50_A3LLY2 Cluster: GTP-binding protein LepA; n=4; Bacteria...    44   0.003
UniRef50_Q4UAD2 Cluster: U5 snRNP subunit, putative; n=1; Theile...    44   0.003
UniRef50_Q2JDK2 Cluster: GTP-binding protein lepA; n=24; Actinom...    44   0.003
UniRef50_UPI00003933D9 Cluster: COG1217: Predicted membrane GTPa...    44   0.004
UniRef50_Q00ZZ1 Cluster: GTP-binding membrane protein LepA homol...    44   0.004
UniRef50_Q6FJ88 Cluster: Similar to sp|P36048 Saccharomyces cere...    44   0.004
UniRef50_Q98QW3 Cluster: GTP-binding protein lepA; n=52; cellula...    44   0.004
UniRef50_Q88T65 Cluster: GTP-binding protein lepA 2; n=2; Lactob...    44   0.004
UniRef50_Q2IJP9 Cluster: Peptide chain release factor 3; n=2; Ba...    44   0.006
UniRef50_Q1VQ31 Cluster: Tetracycline resistance protein; n=1; P...    44   0.006
UniRef50_Q8KCH0 Cluster: GTP-binding protein lepA; n=31; cellula...    44   0.006
UniRef50_O94429 Cluster: Elongation factor G 2, mitochondrial pr...    44   0.006
UniRef50_Q6F0Z6 Cluster: GTP-binding membrane protein, elongatio...    43   0.007
UniRef50_Q5FDV4 Cluster: GTP-binding protein TypA/BipA homolog; ...    43   0.007
UniRef50_A0JYS6 Cluster: GTP-binding protein TypA; n=101; Bacter...    43   0.007
UniRef50_Q7Q3I6 Cluster: ENSANGP00000010178; n=1; Anopheles gamb...    43   0.007
UniRef50_Q55G92 Cluster: Putative uncharacterized protein; n=1; ...    43   0.010
UniRef50_Q55002 Cluster: Oxytetracycline resistance protein; n=2...    43   0.010
UniRef50_O51115 Cluster: GTP-binding protein lepA; n=9; Bacteria...    43   0.010
UniRef50_A7PLZ9 Cluster: Chromosome chr14 scaffold_21, whole gen...    42   0.013
UniRef50_Q4T508 Cluster: Chromosome 1 SCAF9472, whole genome sho...    42   0.017
UniRef50_A7MKJ4 Cluster: Putative uncharacterized protein; n=1; ...    42   0.017
UniRef50_Q9VCX4 Cluster: CG31159-PA; n=4; Diptera|Rep: CG31159-P...    42   0.017
UniRef50_Q22A26 Cluster: Elongation factor Tu GTP binding domain...    42   0.017
UniRef50_A5JZM2 Cluster: GTP-binding protein TypA, putative; n=7...    42   0.017
UniRef50_Q5WBK2 Cluster: Translation elongation factor G; n=1; B...    42   0.023
UniRef50_A6G6E0 Cluster: Protein translation elongation factor G...    42   0.023
UniRef50_A4FHF5 Cluster: Tetracycline resistance protein; n=1; S...    42   0.023
UniRef50_A0ED84 Cluster: Chromosome undetermined scaffold_9, who...    42   0.023
UniRef50_Q8GDR1 Cluster: GTP-binding protein LepA; n=1; Heliobac...    41   0.030
UniRef50_Q5GBH8 Cluster: TetT; n=2; Lactobacillales|Rep: TetT - ...    41   0.030
UniRef50_A6ET18 Cluster: GTP-binding elongation factor family pr...    41   0.030
UniRef50_Q7RJ38 Cluster: Elongation factor Tu family, putative; ...    41   0.030
UniRef50_A7AQT2 Cluster: Elongation factor G 2, mitochondrial, p...    41   0.030
UniRef50_A0CDU0 Cluster: Chromosome undetermined scaffold_17, wh...    41   0.030
UniRef50_Q7S9B4 Cluster: Putative uncharacterized protein NCU070...    41   0.030
UniRef50_Q6CGB0 Cluster: Yarrowia lipolytica chromosome A of str...    41   0.030
UniRef50_Q0V3J4 Cluster: Putative uncharacterized protein; n=1; ...    41   0.030
UniRef50_Q8TV36 Cluster: Translation initiation factor 2, GTPase...    41   0.030
UniRef50_Q02652 Cluster: Tetracycline resistance protein tetM; n...    41   0.030
UniRef50_Q3ZYA7 Cluster: Translation elongation factor G; n=4; B...    41   0.040
UniRef50_Q8I335 Cluster: GTP-binding protein, putative; n=1; Pla...    41   0.040
UniRef50_Q4UIN6 Cluster: GTP-binding protein, LepA subfamily, pu...    41   0.040
UniRef50_Q81NX9 Cluster: GTP-binding elongation factor protein, ...    40   0.053
UniRef50_A7PJC5 Cluster: Chromosome chr12 scaffold_18, whole gen...    40   0.053
UniRef50_A5AF37 Cluster: Putative uncharacterized protein; n=1; ...    40   0.053
UniRef50_A3LU88 Cluster: ATP dependent RNA helicase and U5 mRNA ...    40   0.053
UniRef50_A7ARF7 Cluster: GTP binding protein, putative; n=1; Bab...    40   0.070
UniRef50_Q97KR3 Cluster: Tetracycline resistance protein tetP, c...    40   0.092
UniRef50_Q8UFQ0 Cluster: Tetracycline resistance protein, tetM/t...    40   0.092
UniRef50_Q0RNV6 Cluster: Elongation factor G; n=1; Frankia alni ...    40   0.092
UniRef50_Q46306 Cluster: Tetracycline resistance protein tetP (T...    40   0.092
UniRef50_Q2S3F5 Cluster: Elongation factor G; n=1; Salinibacter ...    39   0.12 
UniRef50_A5ZXF5 Cluster: Putative uncharacterized protein; n=2; ...    39   0.12 
UniRef50_Q5FLA9 Cluster: Peptide chain release factor 3; n=66; B...    39   0.12 
UniRef50_Q8G811 Cluster: Putative uncharacterized protein; n=2; ...    39   0.16 
UniRef50_Q0S473 Cluster: Elongation factor EF2; n=1; Rhodococcus...    39   0.16 
UniRef50_A5V1W8 Cluster: Translation elongation factor G; n=4; C...    39   0.16 
UniRef50_UPI000023CBB6 Cluster: hypothetical protein FG05083.1; ...    38   0.21 
UniRef50_A4E859 Cluster: Putative uncharacterized protein; n=1; ...    38   0.21 
UniRef50_A0UWB2 Cluster: Small GTP-binding protein; n=14; Bacter...    38   0.21 
UniRef50_A7AQ93 Cluster: GTP-binding protein LepA family protein...    38   0.21 
UniRef50_A4RKP1 Cluster: Putative uncharacterized protein; n=1; ...    38   0.21 
UniRef50_A6BAW2 Cluster: BipA protein; n=1; Vibrio parahaemolyti...    38   0.28 
UniRef50_A5K6I6 Cluster: GTP-binding protein, putative; n=2; cel...    38   0.28 
UniRef50_A0CSQ6 Cluster: Chromosome undetermined scaffold_26, wh...    38   0.28 
UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS (T...    38   0.28 
UniRef50_Q9RXC2 Cluster: Elongation factor G; n=2; Deinococcus|R...    38   0.37 
UniRef50_A6GK83 Cluster: Translation initiation factor IF-2; n=1...    38   0.37 
UniRef50_Q4Y0B9 Cluster: TetQ family GTPase, putative; n=5; Plas...    38   0.37 
UniRef50_Q8F2N6 Cluster: Peptide chain release factor 3; n=8; Ba...    37   0.49 
UniRef50_Q4AGI8 Cluster: Elongation factor G, C-terminal:Protein...    37   0.49 
UniRef50_A7CTC1 Cluster: Peptide chain release factor 3; n=2; Ba...    37   0.49 
UniRef50_A6LU84 Cluster: Small GTP-binding protein; n=1; Clostri...    37   0.49 
UniRef50_A5Z9F8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.49 
UniRef50_A1SQK9 Cluster: Small GTP-binding protein; n=2; Actinom...    37   0.49 
UniRef50_Q8I568 Cluster: TetQ family GTPase, putative; n=1; Plas...    37   0.49 
UniRef50_Q5DC59 Cluster: SJCHGC08038 protein; n=1; Schistosoma j...    37   0.49 
UniRef50_Q381P2 Cluster: U5 small nuclear ribonucleoprotein comp...    37   0.49 
UniRef50_Q19072 Cluster: Elongation factor Tu homologue precurso...    37   0.65 
UniRef50_A5K8L7 Cluster: TetQ family GTPase, putative; n=1; Plas...    37   0.65 
UniRef50_Q9PGX4 Cluster: Peptide chain release factor 3; n=302; ...    37   0.65 
UniRef50_O07170 Cluster: Elongation factor G-like protein; n=24;...    37   0.65 
UniRef50_Q2AH04 Cluster: Translation elongation factor G:Small G...    36   0.86 
UniRef50_Q1NNQ3 Cluster: Small GTP-binding protein domain; n=4; ...    36   0.86 
UniRef50_Q18CA6 Cluster: Putative translation elongation factor;...    36   0.86 
UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large subu...    36   0.86 
UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9; Ac...    36   0.86 
UniRef50_P70882 Cluster: Tetracycline resistance protein tetQ (T...    36   0.86 
UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-lik...    36   1.1  
UniRef50_A0L3V8 Cluster: Translation elongation factor G; n=1; M...    36   1.1  
UniRef50_A4S2B0 Cluster: Mitochondrial translation initiation fa...    36   1.1  
UniRef50_A5K760 Cluster: U5 small nuclear ribonuclear protein, p...    36   1.1  
UniRef50_A2E2N4 Cluster: Elongation factor G, domain IV family p...    36   1.1  
UniRef50_Q5QXU1 Cluster: Peptide chain release factor 3; n=5; Ga...    36   1.1  
UniRef50_UPI00005A4365 Cluster: PREDICTED: similar to Elongation...    36   1.5  
UniRef50_Q1IY97 Cluster: Peptide chain release factor 3; n=1; De...    36   1.5  
UniRef50_A6PUV8 Cluster: Small GTP-binding protein; n=1; Victiva...    36   1.5  
UniRef50_A6EB22 Cluster: Translation initiation factor IF-2; n=2...    36   1.5  
UniRef50_A6C5G4 Cluster: Protein translation elongation factor G...    36   1.5  
UniRef50_A5KIG4 Cluster: Putative uncharacterized protein; n=1; ...    36   1.5  
UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4; Fungi/M...    36   1.5  
UniRef50_Q67MT5 Cluster: Peptide chain release factor 3; n=13; B...    36   1.5  
UniRef50_Q6AJD2 Cluster: Peptide chain release factor 3; n=41; B...    36   1.5  
UniRef50_Q8A2A1 Cluster: Translation initiation factor IF-2; n=1...    36   1.5  
UniRef50_Q8KG26 Cluster: Translation elongation factor G; n=10; ...    35   2.0  
UniRef50_A6G5J6 Cluster: Translation initiation factor IF-2; n=1...    35   2.0  
UniRef50_A7TGR5 Cluster: Putative uncharacterized protein; n=1; ...    35   2.0  
UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1, sub...    35   2.0  
UniRef50_P73473 Cluster: Peptide chain release factor 3; n=49; B...    35   2.0  
UniRef50_Q606M6 Cluster: Peptide chain release factor 3; n=3; Pr...    35   2.0  
UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial pre...    35   2.0  
UniRef50_UPI00006CBFC8 Cluster: Elongation factor Tu GTP binding...    35   2.6  
UniRef50_Q5P806 Cluster: Translation elongation factor G; n=14; ...    35   2.6  
UniRef50_Q9U1S7 Cluster: Putative uncharacterized protein pkd-2;...    35   2.6  
UniRef50_P36048 Cluster: 114 kDa U5 small nuclear ribonucleoprot...    35   2.6  
UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial pre...    35   2.6  
UniRef50_Q8R7R5 Cluster: Translation elongation and release fact...    34   3.5  
UniRef50_Q0S4R5 Cluster: Peptide chain release factor RF3; n=22;...    34   3.5  
UniRef50_A7IC08 Cluster: Translation initiation factor IF-2; n=2...    34   3.5  
UniRef50_A6GAE2 Cluster: Peptide chain release factor 3; n=1; Pl...    34   3.5  
UniRef50_A3TP61 Cluster: Translation elongation factor EF-G; n=1...    34   3.5  
UniRef50_Q9VAV2 Cluster: CG12413-PA; n=7; Endopterygota|Rep: CG1...    34   3.5  
UniRef50_Q4DXM7 Cluster: Mucin TcMUCII, putative; n=3; Trypanoso...    34   3.5  
UniRef50_Q68WI4 Cluster: Translation initiation factor IF-2; n=1...    34   3.5  
UniRef50_Q98R05 Cluster: Translation initiation factor IF-2; n=8...    34   3.5  
UniRef50_Q74CT3 Cluster: Translation initiation factor IF-2; n=2...    34   3.5  
UniRef50_P17889 Cluster: Translation initiation factor IF-2; n=6...    34   3.5  
UniRef50_Q8YQJ1 Cluster: Translation initiation factor IF-2; n=7...    34   3.5  
UniRef50_UPI0000EBF232 Cluster: PREDICTED: similar to mucin 16; ...    34   4.6  
UniRef50_UPI000055CE95 Cluster: hypothetical protein PdenDRAFT_0...    34   4.6  
UniRef50_UPI00004996CE Cluster: 116 kda u5 small nuclear ribonuc...    34   4.6  
UniRef50_UPI000049849B Cluster: vacuolar ATP synthase subunit H;...    34   4.6  
UniRef50_Q2S1N7 Cluster: Translation initiation factor IF-2; n=1...    34   4.6  
UniRef50_Q9XD39 Cluster: Elongation factor G; n=5; Leptospira|Re...    34   4.6  
UniRef50_Q11PK5 Cluster: Translation initiation factor IF-2; n=1...    34   4.6  
UniRef50_A2VTQ7 Cluster: Elongation factor EF-Tu; n=1; Burkholde...    34   4.6  
UniRef50_Q98RS6 Cluster: U5 small nuclear ribonucleoprotein 116 ...    34   4.6  
UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu), mitochond...    34   4.6  
UniRef50_A4VCU9 Cluster: GTP-binding protein enga; n=1; Tetrahym...    34   4.6  
UniRef50_Q2HI64 Cluster: Putative uncharacterized protein; n=1; ...    34   4.6  
UniRef50_Q9XEK9 Cluster: Translation initiation factor IF-2, chl...    34   4.6  
UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellul...    34   4.6  
UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397; ro...    34   4.6  
UniRef50_Q5FIL0 Cluster: Mucus binding protein; Mub; n=1; Lactob...    33   6.1  
UniRef50_A7HDJ0 Cluster: Elongation factor G domain IV; n=2; Ana...    33   6.1  
UniRef50_A6CF43 Cluster: Translation initiation factor IF-2; n=1...    33   6.1  
UniRef50_A5FJF9 Cluster: Translation initiation factor IF-2; n=6...    33   6.1  
UniRef50_Q757Y4 Cluster: AEL124Wp; n=1; Eremothecium gossypii|Re...    33   6.1  
UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1; ...    33   6.1  
UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5...    33   6.1  
UniRef50_Q7VA20 Cluster: Translation initiation factor IF-2; n=2...    33   6.1  
UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porph...    33   6.1  
UniRef50_UPI000023D468 Cluster: hypothetical protein FG10436.1; ...    33   8.0  
UniRef50_Q890E6 Cluster: Elongation factor G; n=2; Lactobacillus...    33   8.0  
UniRef50_Q1IH98 Cluster: Translation elongation factor G; n=2; A...    33   8.0  
UniRef50_Q1GFM6 Cluster: Peptide chain release factor 3; n=41; P...    33   8.0  
UniRef50_A4E6U7 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  
UniRef50_Q4Q555 Cluster: Small nuclear ribonucleoprotein compone...    33   8.0  
UniRef50_Q6MTQ0 Cluster: Translation initiation factor IF-2; n=2...    33   8.0  
UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular org...    33   8.0  

>UniRef50_P13639 Cluster: Elongation factor 2; n=491; Eukaryota|Rep:
           Elongation factor 2 - Homo sapiens (Human)
          Length = 858

 Score =  124 bits (300), Expect = 2e-27
 Identities = 61/102 (59%), Positives = 70/102 (68%), Gaps = 2/102 (1%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKP+L MNKMDR            YQTFQRIVENVNVII+
Sbjct: 131 CVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIIS 190

Query: 638 TYND-DGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
           TY + + GPMG + +DP  G+VGFGSGLHGWAFTLKQF+EMY
Sbjct: 191 TYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMY 232



 Score =  124 bits (298), Expect = 3e-27
 Identities = 59/66 (89%), Positives = 62/66 (93%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTVD+IR +MDKK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA ARAGETRFTDTR
Sbjct: 1   MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR 60

Query: 238 KDEQDR 255
           KDEQ+R
Sbjct: 61  KDEQER 66



 Score =  107 bits (258), Expect = 2e-22
 Identities = 58/85 (68%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAIS+F+EL E DL FI    ++ K   GFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 67  CITIKSTAISLFYELSENDLNFI----KQSKDGAGFLINLIDSPGHVDFSSEVTAALRVT 122

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 123 DGALVVVDCVSGVCVQTETVLRQAI 147


>UniRef50_A6RAK0 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 631

 Score =  114 bits (274), Expect = 3e-24
 Identities = 53/66 (80%), Positives = 60/66 (90%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTV+EIR +MD+  NIRNMSVIAHVDHGKSTLTDSLV +AGII+ A+AGE RFTDTR
Sbjct: 1   MVNFTVEEIRQLMDRPANIRNMSVIAHVDHGKSTLTDSLVQRAGIISAAKAGEARFTDTR 60

Query: 238 KDEQDR 255
           +DEQDR
Sbjct: 61  QDEQDR 66



 Score = 96.3 bits (229), Expect = 8e-19
 Identities = 49/102 (48%), Positives = 63/102 (61%), Gaps = 1/102 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +       ERIKP+  +NK+DR            YQ+F R +E+VNVIIA
Sbjct: 132 CVSGVCVQTETVLRQALGERIKPVCIINKVDRALLELQVTKEDLYQSFSRTIESVNVIIA 191

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
           TY D    +G+V+V P KG+V FGSGLHGWAFT++QF+  YA
Sbjct: 192 TYFDKA--LGDVQVYPYKGTVAFGSGLHGWAFTVRQFAVKYA 231



 Score = 90.2 bits (214), Expect = 5e-17
 Identities = 52/85 (61%), Positives = 60/85 (70%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAIS++  L + D +    P + + +E  FLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 67  CITIKSTAISLYAHLPDPDDLKDI-PQKVDGNE--FLINLIDSPGHVDFSSEVTAALRVT 123

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 124 DGALVVVDCVSGVCVQTETVLRQAL 148


>UniRef50_Q0CYA7 Cluster: Elongation factor 2; n=1; Aspergillus
           terreus NIH2624|Rep: Elongation factor 2 - Aspergillus
           terreus (strain NIH 2624)
          Length = 744

 Score =  112 bits (270), Expect = 8e-24
 Identities = 51/66 (77%), Positives = 60/66 (90%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFT++EIR +MD++ NIRNMSVIAHVDHGKSTL+DSLV +AGII+ A+AGETRF DTR
Sbjct: 1   MVNFTIEEIRSLMDRQANIRNMSVIAHVDHGKSTLSDSLVQRAGIISAAKAGETRFMDTR 60

Query: 238 KDEQDR 255
            DEQDR
Sbjct: 61  PDEQDR 66



 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 44/84 (52%), Positives = 58/84 (69%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ERIKP+L +NK+DR            YQ+F R +E+VNVIIATY D    +G+ +V P +
Sbjct: 138 ERIKPVLIINKVDRALLELQVSKEDLYQSFSRTIESVNVIIATYFDK--VLGDCQVYPDR 195

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V FGSGLHGWAFT++QF+  YA
Sbjct: 196 GTVAFGSGLHGWAFTVRQFAVKYA 219



 Score = 83.0 bits (196), Expect = 8e-15
 Identities = 54/86 (62%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 CITIKSTAISMFFEL-EEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRV 431
           CITIKSTAIS++ +  +E+DL  I  P + + SE  FLINLIDSPGHVDFSSEVTAALRV
Sbjct: 67  CITIKSTAISLYAQFPDEEDLKEI--PQKVDGSE--FLINLIDSPGHVDFSSEVTAALRV 122

Query: 432 TDGALXXXXXXXXXXXQTETVLRQAM 509
           TDGAL            TETVLRQA+
Sbjct: 123 TDGAL------------TETVLRQAL 136


>UniRef50_A6SB62 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 774

 Score =  109 bits (262), Expect = 8e-23
 Identities = 50/66 (75%), Positives = 59/66 (89%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFTV+E+R +MDK  N+RNMSVIAHVDHGKSTLTDSL+SKAGII+ A+AG+ R TDTR
Sbjct: 1   MVNFTVEEVRQLMDKATNVRNMSVIAHVDHGKSTLTDSLLSKAGIISAAKAGDARATDTR 60

Query: 238 KDEQDR 255
            DEQ+R
Sbjct: 61  ADEQER 66



 Score = 96.7 bits (230), Expect = 6e-19
 Identities = 43/84 (51%), Positives = 60/84 (71%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ERIKP++ +NK+DR            YQ+F R +E+VNV+I+TY D    +G+V+V P K
Sbjct: 151 ERIKPVVIINKVDRALLELQVSKEDLYQSFSRTIESVNVVISTYFDKS--LGDVQVYPGK 208

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V FGSGLHGWAFT++QF++ YA
Sbjct: 209 GTVAFGSGLHGWAFTIRQFAQRYA 232



 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 51/85 (60%), Positives = 60/85 (70%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 ITIKSTAISMFFEL-EEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           ITIKSTAIS++  L +++DL  I     ++   + FLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 68  ITIKSTAISLYGNLPDDEDLKDIVG---QKTDGRDFLINLIDSPGHVDFSSEVTAALRVT 124

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 125 DGALVVVDTIEGVCVQTETVLRQAL 149


>UniRef50_P15112 Cluster: Elongation factor 2; n=2; Eukaryota|Rep:
           Elongation factor 2 - Dictyostelium discoideum (Slime
           mold)
          Length = 830

 Score = 96.3 bits (229), Expect = 8e-19
 Identities = 42/66 (63%), Positives = 55/66 (83%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVNFT+D+IR +MD++ NIRNMSVIAHVDHGK+TL+DSL+ +AGIIA   +G+ R+   R
Sbjct: 1   MVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKVSGDMRYMSCR 60

Query: 238 KDEQDR 255
            DEQ+R
Sbjct: 61  ADEQER 66



 Score = 92.7 bits (220), Expect = 9e-18
 Identities = 46/102 (45%), Positives = 62/102 (60%), Gaps = 1/102 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKP+LF+NK+DR            Y +F+R +E+VNVI+ 
Sbjct: 129 CVEGVCVQTETVLRQAVAERIKPVLFVNKVDRFLLELQLNTEEAYLSFRRAIESVNVIVG 188

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
             N +    G+V V P KG+V FGSGLHGW FTL +F+++YA
Sbjct: 189 --NTEDKEFGDVTVSPEKGTVAFGSGLHGWGFTLGRFAKLYA 228



 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 49/84 (58%), Positives = 58/84 (69%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITIKS+++S+ FE+ ++D +    P      E  FLINLIDSPGHVDFSSEVTAALRVTD
Sbjct: 68  ITIKSSSVSLHFEMPKEDKL----PAGCTSHE--FLINLIDSPGHVDFSSEVTAALRVTD 121

Query: 438 GALXXXXXXXXXXXQTETVLRQAM 509
           GAL           QTETVLRQA+
Sbjct: 122 GALVVIDCVEGVCVQTETVLRQAV 145


>UniRef50_Q7R0C7 Cluster: GLP_608_18578_21274; n=2; Giardia
           intestinalis|Rep: GLP_608_18578_21274 - Giardia lamblia
           ATCC 50803
          Length = 898

 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 45/66 (68%), Positives = 54/66 (81%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           M +FT ++IR  MD +  IRNMSVIAHVDHGKSTLTDSL++ AGII+   AG TRFTDTR
Sbjct: 1   MPHFTTEQIRECMDHQDRIRNMSVIAHVDHGKSTLTDSLIAHAGIISMGSAGNTRFTDTR 60

Query: 238 KDEQDR 255
           +DE+DR
Sbjct: 61  QDEKDR 66



 Score = 76.2 bits (179), Expect = 9e-13
 Identities = 38/51 (74%), Positives = 40/51 (78%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           G+LINLIDSPGHVDFSSEVTAALRVTDGAL           QTETVLRQA+
Sbjct: 132 GYLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCAEGVCVQTETVLRQAL 182



 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 35/95 (36%), Positives = 51/95 (53%), Gaps = 11/95 (11%)
 Frame = +2

Query: 509 AERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDG----------- 655
           +ER+ P L +NK+DR            +  F++ +  VN +IATY D             
Sbjct: 183 SERVIPCLMLNKVDRVIMELKLSGEDAFLMFEKTIGEVNQLIATYQDKTLFNEKKYKKIF 242

Query: 656 GPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
           G   ++ VDPS+G+V FGSGLHGW FT+  F+ +Y
Sbjct: 243 GNRTDLCVDPSRGNVAFGSGLHGWGFTVTHFARIY 277


>UniRef50_UPI0000D62D3D Cluster: UPI0000D62D3D related cluster; n=1;
           Mus musculus|Rep: UPI0000D62D3D UniRef100 entry - Mus
           musculus
          Length = 787

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 48/65 (73%), Positives = 53/65 (81%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MVN TVD+IR +MDK  NI+NMSVIAHVDHGKS LTD+LV K GII   R GETRFTDT 
Sbjct: 1   MVNCTVDQIRAIMDKA-NIQNMSVIAHVDHGKSMLTDTLVCKVGII--DRIGETRFTDTC 57

Query: 238 KDEQD 252
           KDEQ+
Sbjct: 58  KDEQE 62



 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 47/84 (55%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYN-DDGGPMGEVRVDPS 688
           ERIKP+L MNKM +            YQTFQ I        +TY+ DD GPMG +  D  
Sbjct: 141 ERIKPVLTMNKMYQALPERQLEPGELYQTFQSI--------STYSKDDSGPMGNIMSD-- 190

Query: 689 KGSVGFGSGLHGWAFTLKQFSEMY 760
             SVGFGSGLHGWAFTLKQFSEMY
Sbjct: 191 --SVGFGSGLHGWAFTLKQFSEMY 212



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 41/64 (64%), Positives = 44/64 (68%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAI  F+EL E DL FI       K   GFLIN IDSPGH+DF SE+  AL VT
Sbjct: 64  CITIKSTAI--FYELAENDLYFIKFITTI-KDGSGFLINFIDSPGHLDFFSEMRTALSVT 120

Query: 435 DGAL 446
           DGAL
Sbjct: 121 DGAL 124


>UniRef50_Q8SQT7 Cluster: TRANSLATION ELONGATION FACTOR 2; n=3;
           Microsporidia|Rep: TRANSLATION ELONGATION FACTOR 2 -
           Encephalitozoon cuniculi
          Length = 850

 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 50/84 (59%), Positives = 57/84 (67%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITIKS+AIS+ F++++  L   T       +E  FLINLIDSPGHVDFSSEVTAALRVTD
Sbjct: 67  ITIKSSAISLHFQVQKDVLEAYTKEGDTNGTE--FLINLIDSPGHVDFSSEVTAALRVTD 124

Query: 438 GALXXXXXXXXXXXQTETVLRQAM 509
           GAL           QTETVL QAM
Sbjct: 125 GALVVVDCVDGICVQTETVLGQAM 148



 Score = 72.9 bits (171), Expect = 8e-12
 Identities = 35/66 (53%), Positives = 49/66 (74%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           M +F + ++  +M  ++NIRN+SVIAHVDHGKSTLTD LV KA I++   +G  R+ D+R
Sbjct: 1   MADFHISKVHELMMNQKNIRNISVIAHVDHGKSTLTDCLVIKAKIVS-KDSGGGRYMDSR 59

Query: 238 KDEQDR 255
           +DEQ R
Sbjct: 60  EDEQQR 65



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 35/102 (34%), Positives = 46/102 (45%), Gaps = 2/102 (1%)
 Frame = +2

Query: 461 CVWCVCTN*NSTASGYA--ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVII 634
           CV  +C     T  G A  ERI P L +NK+DR             +  +R VE  N  +
Sbjct: 132 CVDGICVQ-TETVLGQAMNERIIPTLVLNKLDRAILELEYPQEKLGEVLRRRVEGFNAKL 190

Query: 635 ATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
           +T    G       + P K  + F SGL GW FTL+QF+  Y
Sbjct: 191 STL---GYNFKVESLLPEKNEISFCSGLQGWGFTLRQFARFY 229


>UniRef50_A0DRB1 Cluster: Chromosome undetermined scaffold_60, whole
            genome shotgun sequence; n=4; Eukaryota|Rep: Chromosome
            undetermined scaffold_60, whole genome shotgun sequence -
            Paramecium tetraurelia
          Length = 1348

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 49/84 (58%), Positives = 56/84 (66%)
 Frame = +3

Query: 258  ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
            ITIKST +S+++E +  D           K+ + FLINLIDSPGHVDFSSEVTAALRVTD
Sbjct: 1117 ITIKSTGVSLYYEYDIYD----------NKTLEKFLINLIDSPGHVDFSSEVTAALRVTD 1166

Query: 438  GALXXXXXXXXXXXQTETVLRQAM 509
            GAL           QTETVLRQAM
Sbjct: 1167 GALVVVDCVEGVCVQTETVLRQAM 1190



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 41/107 (38%), Positives = 58/107 (54%), Gaps = 1/107 (0%)
 Frame = +2

Query: 461  CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
            CV  VC    +       E+IKP++ +NK+DR            YQ F R+V+ VNVII 
Sbjct: 1174 CVEGVCVQTETVLRQAMQEKIKPVVMVNKIDRAILELKHDGETMYQNFVRVVDMVNVIIN 1233

Query: 638  TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
            TY  +   MG++ V P  GSV FGSG   WAF+  +F+ +YA   ++
Sbjct: 1234 TYQQE--DMGDLLVHPELGSVSFGSGKECWAFSCTRFARIYANKFKV 1278


>UniRef50_Q54JK7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 839

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 37/84 (44%), Positives = 48/84 (57%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+KPILF+NK DR            Y + QR +E  N I     DD   +G+V V P  
Sbjct: 136 ERVKPILFLNKFDRFILELKLDSSGIYNSLQRSIERFNSIATCQKDD--LLGDVEVSPEN 193

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+VGFGS L+GWAF L  F+ +Y+
Sbjct: 194 GTVGFGSSLYGWAFNLSTFARLYS 217



 Score = 37.5 bits (83), Expect = 0.37
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = +1

Query: 76  DEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSL 174
           DE++ MM+ ++NIRN+ +I  VD G  TL D L
Sbjct: 8   DEMKNMMNNRQNIRNIGIIGRVDTGIRTLIDIL 40


>UniRef50_O74945 Cluster: GTPase Ria1; n=1; Schizosaccharomyces
           pombe|Rep: GTPase Ria1 - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 1000

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 43/83 (51%), Positives = 56/83 (67%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+KS+AIS+FF++       I+  D++ + EK +LINLIDSPGHVDFSSEV++A R+ D
Sbjct: 68  ITMKSSAISLFFKV-------ISQNDEK-RVEKDYLINLIDSPGHVDFSSEVSSASRLCD 119

Query: 438 GALXXXXXXXXXXXQTETVLRQA 506
           GA            QT TVLRQA
Sbjct: 120 GAFVLVDAVEGVCSQTITVLRQA 142



 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 28/60 (46%), Positives = 41/60 (68%)
 Frame = +1

Query: 76  DEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +++  +   + NIRN +++AHVDHGK+TL DSL++  GII+   AG  RF D R+DE  R
Sbjct: 7   EKLVSLQKNQENIRNFTLLAHVDHGKTTLADSLLASNGIISSKLAGTVRFLDFREDEITR 66



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 34/95 (35%), Positives = 45/95 (47%), Gaps = 10/95 (10%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY----------NDDG 655
           + +RIK IL +NKMDR            +    R+VE VN +I T+          ND+ 
Sbjct: 143 WIDRIKVILVINKMDRLITELKLSPIEAHYHLLRLVEQVNAVIGTFYTGELMQLADNDEV 202

Query: 656 GPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
                +   P +G+V F S   GWAF L QFSE Y
Sbjct: 203 ISDEGIYFAPEQGNVVFASAYDGWAFCLDQFSEFY 237


>UniRef50_Q23U41 Cluster: Elongation factor G, domain IV family
           protein; n=6; Tetrahymena thermophila|Rep: Elongation
           factor G, domain IV family protein - Tetrahymena
           thermophila SB210
          Length = 941

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 43/83 (51%), Positives = 53/83 (63%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITIKST +S++++          N   +++S    +INLIDSPGH+DFS EVTAALRVTD
Sbjct: 167 ITIKSTGVSLYYQ----------NTVTKQES----IINLIDSPGHIDFSGEVTAALRVTD 212

Query: 438 GALXXXXXXXXXXXQTETVLRQA 506
           GAL           QTETVLRQA
Sbjct: 213 GALVVVDAVEGVAVQTETVLRQA 235



 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 34/65 (52%), Positives = 45/65 (69%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           M    +++IR +M     IRNMSVIAHVDHGK+TLTDSL+++AGII+   AG+    DT 
Sbjct: 100 MKTLQIEKIRELMMNPNQIRNMSVIAHVDHGKTTLTDSLLARAGIISENNAGKACLMDTD 159

Query: 238 KDEQD 252
             EQ+
Sbjct: 160 PKEQE 164



 Score = 62.9 bits (146), Expect = 9e-09
 Identities = 31/84 (36%), Positives = 46/84 (54%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ERI+P+L +NK+DR            YQ   +I+  VN I+  + +D   +    +DPS 
Sbjct: 238 ERIRPVLVINKLDRLFSELKDDYENIYQRLVKIIAKVNSILEMHENDS--IRGYTLDPSL 295

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F SG   W FTLK F+ +Y+
Sbjct: 296 GNVAFSSGKQCWGFTLKTFARIYS 319


>UniRef50_Q6C8W8 Cluster: Yarrowia lipolytica chromosome D of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome D of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 1018

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 39/83 (46%), Positives = 50/83 (60%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT++S+AIS+ F    +D      P +     K FLINL+DSPGH+DFSSEV+ A R+ D
Sbjct: 67  ITMESSAISLHFRTFRRDPSSTEEPPKMVP--KDFLINLVDSPGHIDFSSEVSTASRLCD 124

Query: 438 GALXXXXXXXXXXXQTETVLRQA 506
           GA+           QT TVLRQA
Sbjct: 125 GAVVLVDAVEGVCSQTVTVLRQA 147



 Score = 62.9 bits (146), Expect = 9e-09
 Identities = 26/59 (44%), Positives = 43/59 (72%)
 Frame = +1

Query: 79  EIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           ++R +     +IRN+ ++AHVDHGK++L+D L++  GII+   AG+ R+ D+R DEQ+R
Sbjct: 7   QLRKLQSDPSSIRNICILAHVDHGKTSLSDCLLASNGIISQKMAGKLRYLDSRPDEQER 65



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 19/105 (18%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYND-----------D 652
           + E++KPIL +NK+DR            +   ++++E VNV++  +             +
Sbjct: 148 WMEQLKPILVINKIDRLVEELQLTPAEAFTHLKKLIEGVNVVLGGFYASNRMAADLEWRE 207

Query: 653 GGPMG--------EVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
            G  G        E+   P K +V F S + GW FT+ QF  +YA
Sbjct: 208 SGKTGTFEDEDDSELYFSPEKNNVIFASAIDGWGFTVAQFVAIYA 252


>UniRef50_Q4Q9N1 Cluster: Elongation factor 2-like protein; n=6;
           Trypanosomatidae|Rep: Elongation factor 2-like protein -
           Leishmania major
          Length = 887

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 30/60 (50%), Positives = 43/60 (71%)
 Frame = +1

Query: 76  DEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           D ++ + +K  NIRN  ++AHVDHGK+TL+D LV+  GI++   AGE R  D+R DEQ+R
Sbjct: 7   DAVQKLSEKPENIRNFCMVAHVDHGKTTLSDYLVASNGILSPQLAGEVRLLDSRPDEQER 66



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 24/58 (41%), Positives = 35/58 (60%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSASSL 527
           K  ++NL+DSPGH+DFS EV+ A+R+ DGA+           QT ++LRQ      S+
Sbjct: 84  KTHVLNLVDSPGHIDFSCEVSTAMRLCDGAVVIVDVVDGVTQQTSSILRQTYQEGLSM 141



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 12/97 (12%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDD----------- 652
           Y E +   L +NK+D             Y   + I+E  N I+A+Y +            
Sbjct: 135 YQEGLSMCLVLNKIDLLVTTQQYTAEEAYLRLRSIIEICNAILASYANQMKIQELDQDMK 194

Query: 653 -GGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
              P  +V  DPSKG+V F S   GWA ++  F  +Y
Sbjct: 195 REDPSDDVWFDPSKGNVLFCSCYDGWAVSVDFFVRLY 231


>UniRef50_Q54WF2 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1164

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 38/83 (45%), Positives = 49/83 (59%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+K++AIS+ F+                  ++ FLINLIDSPGHVDFSSEV+ A+R+TD
Sbjct: 68  ITMKASAISLLFQQPSSS--------SSSNDKESFLINLIDSPGHVDFSSEVSTAVRITD 119

Query: 438 GALXXXXXXXXXXXQTETVLRQA 506
           GAL           QT  VL+QA
Sbjct: 120 GALVLVDAVEGVCIQTHAVLKQA 142



 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 38/88 (43%), Positives = 57/88 (64%), Gaps = 8/88 (9%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           M + + + +  + D  +NIRN+ V+AHVDHGK+TL+D L+S  GII+   AG+ R+ D  
Sbjct: 1   MPSISPNLLASLQDHTKNIRNICVLAHVDHGKTTLSDCLISSNGIISPEMAGKLRYLDFL 60

Query: 238 KDEQDR-----ASPLNL---RPSLCSSS 297
           +DEQ+R     AS ++L   +PS  SSS
Sbjct: 61  EDEQEREITMKASAISLLFQQPSSSSSS 88



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 34/107 (31%), Positives = 47/107 (43%), Gaps = 23/107 (21%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY-------------- 643
           Y E++KP L +NK+DR            YQ   +I+E VNVI  T               
Sbjct: 143 YQEKVKPCLVLNKIDRLILELHMTPLEAYQHLSKIIEQVNVITGTLTSEEIILKESSEDY 202

Query: 644 ---NDDGG-----PMG-EVRVDPSKGSVGFGSGLHGWAFTLKQFSEM 757
              +DD        +G E    P KG+V F +   GW FT+KQF ++
Sbjct: 203 IESSDDSNLNFNENIGTEYYFSPQKGNVAFTTAFDGWGFTIKQFIDL 249


>UniRef50_A1DDI0 Cluster: Ribosome biogenesis protein Ria1,
           putative; n=8; Pezizomycotina|Rep: Ribosome biogenesis
           protein Ria1, putative - Neosartorya fischeri (strain
           ATCC 1020 / DSM 3700 / NRRL 181)(Aspergillus
           fischerianus (strain ATCC 1020 / DSM 3700 / NRRL 181))
          Length = 1087

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 38/82 (46%), Positives = 53/82 (64%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT++S+AIS++F +  +     ++PD   +  + +LINLIDSPGH+DFSSEV+ A R+ D
Sbjct: 68  ITMESSAISLYFSMMRR-----SSPDAAPQPRE-YLINLIDSPGHIDFSSEVSTASRLCD 121

Query: 438 GALXXXXXXXXXXXQTETVLRQ 503
           GAL           QT TVLRQ
Sbjct: 122 GALVLVDAVEGVCSQTVTVLRQ 143



 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 28/61 (45%), Positives = 44/61 (72%)
 Frame = +1

Query: 73  VDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQD 252
           VD++  +  +  +IRN+ ++AHVDHGK++LTD L++  GII+   AG+ R+ D+R DEQ 
Sbjct: 6   VDDLVRLQQRSEDIRNICILAHVDHGKTSLTDGLIATNGIISPKLAGKIRYLDSRPDEQL 65

Query: 253 R 255
           R
Sbjct: 66  R 66



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 14/31 (45%), Positives = 21/31 (67%)
 Frame = +2

Query: 668 EVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
           E+   P K +V F S + GWAFT++QF+ +Y
Sbjct: 244 EIYFAPEKNNVIFCSAIDGWAFTVRQFAALY 274



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY 643
           + E++KP+L +NK+DR            Y    R++E VN +I ++
Sbjct: 145 WVEQLKPLLVINKIDRLVGELKMSPSEAYSHLSRLLEQVNAVIGSF 190


>UniRef50_A6NKY5 Cluster: Uncharacterized protein EFTUD1; n=35;
           Euteleostomi|Rep: Uncharacterized protein EFTUD1 - Homo
           sapiens (Human)
          Length = 867

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 32/66 (48%), Positives = 46/66 (69%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV  ++D++  +     NIRN+ V+AHVDHGK+TL D L+S  GII+   AG+ R+ D+R
Sbjct: 1   MVLNSLDKMIQLQKNTANIRNICVLAHVDHGKTTLADCLISSNGIISSRLAGKLRYMDSR 60

Query: 238 KDEQDR 255
           +DEQ R
Sbjct: 61  EDEQIR 66



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 28/49 (57%), Positives = 34/49 (69%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +LINLIDSPGHVDFSSEV+ A+R+ DG +           QT+ VLRQA
Sbjct: 86  YLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAVEGVCPQTQAVLRQA 134


>UniRef50_A6S9S7 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 1041

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 38/82 (46%), Positives = 54/82 (65%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT++S+AIS++F +  ++    T P+++E     +LINLIDSPGH+DFSSEV+ A R+ D
Sbjct: 68  ITMESSAISLYFSMLRRNAPDAT-PEKKE-----YLINLIDSPGHIDFSSEVSTASRLCD 121

Query: 438 GALXXXXXXXXXXXQTETVLRQ 503
           GA+           QT TVLRQ
Sbjct: 122 GAVVLVDAVEGVCSQTVTVLRQ 143



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query: 76  DEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +++  +     +IRN+ ++AHVDHGK++L+D+L++  GII+   AG+ R+ D+R DEQ R
Sbjct: 7   EKLVALQQNAPDIRNICILAHVDHGKTSLSDALIATNGIISPKLAGKIRYLDSRPDEQTR 66

Query: 256 ASPLNLRP-SLCSSSLKR 306
              +     SL  S L+R
Sbjct: 67  GITMESSAISLYFSMLRR 84



 Score = 33.9 bits (74), Expect = 4.6
 Identities = 13/46 (28%), Positives = 24/46 (52%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY 643
           + E +KP+L +NKMDR            Y    +++E VN ++ ++
Sbjct: 145 WVEHMKPLLVINKMDRLITELKMTPAEAYTHLSKLLEQVNAVLGSF 190


>UniRef50_UPI0000DB7182 Cluster: PREDICTED: similar to elongation
           factor Tu GTP binding domain containing 1; n=2;
           Apocrita|Rep: PREDICTED: similar to elongation factor Tu
           GTP binding domain containing 1 - Apis mellifera
          Length = 1065

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 30/60 (50%), Positives = 43/60 (71%)
 Frame = +1

Query: 76  DEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +++  +  K  NIRN+ ++AHVDHGK+TL DSLV+  GII+   AG+ R+ D+R DEQ R
Sbjct: 7   EKLSEIQSKPANIRNICILAHVDHGKTTLADSLVASNGIISNKLAGKLRYLDSRPDEQLR 66



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 24/46 (52%), Positives = 30/46 (65%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVL 497
           F INLIDSPGHVDF+SEV+ A+R+ DGA+           QT + L
Sbjct: 86  FAINLIDSPGHVDFASEVSTAVRLCDGAIIVIDVVEGVCPQTRSAL 131



 Score = 33.9 bits (74), Expect = 4.6
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%)
 Frame = +2

Query: 473 VCTN*NSTAS-GYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVII 634
           VC    S  S  Y E +KPIL +NK+DR            Y    +++E VN ++
Sbjct: 123 VCPQTRSALSISYTEGLKPILVLNKIDRLITEMKLSALDAYVHLTQVLEQVNAVM 177


>UniRef50_UPI0000DA1A06 Cluster: PREDICTED: similar to elongation
           factor Tu GTP binding domain containing 1; n=1; Rattus
           norvegicus|Rep: PREDICTED: similar to elongation factor
           Tu GTP binding domain containing 1 - Rattus norvegicus
          Length = 1126

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 32/66 (48%), Positives = 45/66 (68%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV   +D++  +     NIRN+ V+AHVDHGK+TL D L+S  GII+   AG+ R+ D+R
Sbjct: 1   MVLSGLDKMIQLQKNTANIRNICVLAHVDHGKTTLADCLISSNGIISSRLAGKLRYMDSR 60

Query: 238 KDEQDR 255
           +DEQ R
Sbjct: 61  EDEQVR 66



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 30/55 (54%), Positives = 37/55 (67%)
 Frame = +3

Query: 342 EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           E SE+ +LINLIDSPGHVDFSSEV+ A+R+ DG +           QT+ VL QA
Sbjct: 81  EGSEE-YLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAVEGVCPQTQAVLXQA 134


>UniRef50_A7S2I1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 1144

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 32/79 (40%), Positives = 52/79 (65%)
 Frame = +1

Query: 70  TVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQ 249
           TV+ +  +  K +NIRN+ ++AHVDHGK+TL D+LV+  GII+   AG+ R+ D+ ++EQ
Sbjct: 5   TVEHLSELQKKPQNIRNICILAHVDHGKTTLADALVASNGIISSRLAGKLRYMDSLEEEQ 64

Query: 250 DRASPLNLRPSLCSSSLKR 306
            R   + ++ S  S   K+
Sbjct: 65  VRG--ITMKSSAISLHFKQ 81



 Score = 62.9 bits (146), Expect = 9e-09
 Identities = 39/83 (46%), Positives = 49/83 (59%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+KS+AIS+ F+ +E +                +LINLIDSPGHVDFSSEV+ A+R+ D
Sbjct: 68  ITMKSSAISLHFKQDEDE----------------YLINLIDSPGHVDFSSEVSTAVRLCD 111

Query: 438 GALXXXXXXXXXXXQTETVLRQA 506
           GAL           QT  VLRQA
Sbjct: 112 GALVVVDVVEGVSPQTHVVLRQA 134


>UniRef50_A2R3P3 Cluster: Contig An14c0170, complete genome; n=7;
           Pezizomycotina|Rep: Contig An14c0170, complete genome -
           Aspergillus niger
          Length = 1040

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 39/82 (47%), Positives = 51/82 (62%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT++S+AIS+FF +  +       PD    + K +LINLIDSPGH+DFSSEV+ A R+ D
Sbjct: 56  ITMESSAISLFFSMMRRPA-----PDAAPVA-KEYLINLIDSPGHIDFSSEVSTASRLCD 109

Query: 438 GALXXXXXXXXXXXQTETVLRQ 503
           GA+           QT TVLRQ
Sbjct: 110 GAVVLVDAVEGVCSQTVTVLRQ 131



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 24/43 (55%), Positives = 34/43 (79%)
 Frame = +1

Query: 127 VIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           ++AHVDHGK++LTDSL++  GII+   AG+ R+ D+R DEQ R
Sbjct: 12  ILAHVDHGKTSLTDSLIATNGIISPKLAGKIRYLDSRPDEQLR 54



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 24/109 (22%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY-------------- 643
           + E++KPIL +NK+DR            Y    +++E VN +I ++              
Sbjct: 133 WVEQLKPILVINKIDRLITELKMSPSEAYSHMSKLLEQVNAVIGSFYQGERMEEDLQWRE 192

Query: 644 ----NDDGGPMGEVRVD------PSKGSVGFGSGLHGWAFTLKQFSEMY 760
               +D+     E R D      P K +V F S + GWAFT++QF+ +Y
Sbjct: 193 RMEEHDEPTAEYEERDDEDLYFAPEKNNVIFCSAVDGWAFTIRQFAAIY 241


>UniRef50_Q17ME5 Cluster: Translation elongation factor; n=2;
           Culicidae|Rep: Translation elongation factor - Aedes
           aegypti (Yellowfever mosquito)
          Length = 978

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 29/66 (43%), Positives = 44/66 (66%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV     ++  +  +   IRN+ ++AHVDHGK+TL DSL++  GII+   AG+ R+ D+R
Sbjct: 1   MVRVDFSQLVELQSQPERIRNICILAHVDHGKTTLADSLIASNGIISQRLAGKLRYMDSR 60

Query: 238 KDEQDR 255
            DEQ+R
Sbjct: 61  PDEQER 66



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 27/51 (52%), Positives = 34/51 (66%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +G L+NLIDSPGHVDFSSEV+ A+R+ DGA+           QT   L+QA
Sbjct: 80  EGHLVNLIDSPGHVDFSSEVSTAVRLCDGAIVVVDVVEGVCPQTRICLKQA 130



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 29/103 (28%), Positives = 49/103 (47%), Gaps = 18/103 (17%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIAT-YNDDGGPMGEVRVD 682
           Y+E ++ +L +NK+DR            Y+  ++++E VN ++   +  D     E+  D
Sbjct: 131 YSENLRTVLLLNKVDRLVLEKKMDPVEAYKHLRQVLEQVNAVVGNIFASDVLAKEELSSD 190

Query: 683 -----------------PSKGSVGFGSGLHGWAFTLKQFSEMY 760
                            P+ G+V FGS L GW FTLK F+++Y
Sbjct: 191 HQLSALEDTDDSRIYYTPANGNVLFGSALDGWGFTLKAFAKLY 233


>UniRef50_UPI0000D55A65 Cluster: PREDICTED: similar to CG33158-PB;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG33158-PB - Tribolium castaneum
          Length = 958

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 38/83 (45%), Positives = 50/83 (60%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+KS+A+S+   +E++D           K EK  L+NLID+PGH+DFSSEV AALRV D
Sbjct: 67  ITMKSSAVSLINLVEDEDT----------KEEKPLLLNLIDTPGHIDFSSEVGAALRVCD 116

Query: 438 GALXXXXXXXXXXXQTETVLRQA 506
           GAL           QT   ++QA
Sbjct: 117 GALVVVDLVEGVCVQTREAIKQA 139



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 23/48 (47%), Positives = 35/48 (72%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AHVDHGK+T+ DSL++   +++   AG  R+ D R DEQ+R
Sbjct: 18  IRNVCILAHVDHGKTTIADSLLATNRLVSKRMAGLVRYLDDRLDEQER 65



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 7/104 (6%)
 Frame = +2

Query: 470 CVCTN*NSTASGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYND 649
           CV T   +    + ER K IL +NK+D+            +Q+    +E+ N I+A    
Sbjct: 129 CVQTR-EAIKQAFTERCKMILILNKIDKLIVELHKEVNDIFQSILHAIEDCNAIVAELYQ 187

Query: 650 DGGPMGEVRVD-------PSKGSVGFGSGLHGWAFTLKQFSEMY 760
                 +V ++       P  G+V F S + GW FTLKQ + M+
Sbjct: 188 YEYCNPDVDIEDTGLLFSPDAGNVIFASAIDGWGFTLKQIASMF 231


>UniRef50_Q9VV61 Cluster: CG33158-PB; n=4; Sophophora|Rep:
           CG33158-PB - Drosophila melanogaster (Fruit fly)
          Length = 1033

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 27/52 (51%), Positives = 40/52 (76%)
 Frame = +1

Query: 100 KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +++ +RN+ ++AHVDHGK+TL DSLV+  GII+   AG+ R+ D R DEQ+R
Sbjct: 15  RRQQVRNICILAHVDHGKTTLADSLVASNGIISQRMAGKLRYLDNRSDEQER 66



 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 37/82 (45%), Positives = 50/82 (60%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+KS++IS++++  E+      NPD        +LINLIDSPGHVDFSSEV+ A+R+ D
Sbjct: 68  ITMKSSSISLYYQEAEE---MAGNPD--------YLINLIDSPGHVDFSSEVSTAVRLCD 116

Query: 438 GALXXXXXXXXXXXQTETVLRQ 503
           GA+           QT   LRQ
Sbjct: 117 GAIVVVDVVEGVGPQTRACLRQ 138



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 19/105 (18%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA-------------TYN 646
           Y E++KP+L +NK+DR            Y    +++E VN ++              T  
Sbjct: 140 YEEQLKPVLVLNKLDRLILEKQMDPLDAYFHLCQVLEQVNAVLGSIFASDILAKEDITKK 199

Query: 647 DDGGPM------GEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
           D+           E+   PS G+V F S   GWAF+++ F+ MYA
Sbjct: 200 DNYESALEEVDDSELYFSPSSGNVIFCSAYDGWAFSVRDFAAMYA 244


>UniRef50_A0E802 Cluster: Chromosome undetermined scaffold_82, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_82,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1097

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 30/49 (61%), Positives = 38/49 (77%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           NIRN+S+IAHVDHGK+TLTD L+S   II+   AG  R+ D+R+DEQ R
Sbjct: 18  NIRNLSIIAHVDHGKTTLTDQLISANNIISKRLAGNLRYMDSREDEQLR 66



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 30/47 (63%), Positives = 33/47 (70%)
 Frame = +3

Query: 363 LINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           LINLIDSPGHV+FSSEV AALR+TDGAL           QT  VL+Q
Sbjct: 83  LINLIDSPGHVEFSSEVQAALRLTDGALVLVDVLEGFSSQTFNVLKQ 129



 Score = 33.1 bits (72), Expect = 8.0
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 18/104 (17%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDG----GPMGEV 673
           + E IK IL +NK+DR            +    +I+E VN  ++++ ++         E 
Sbjct: 131 FEEGIKGILVLNKVDRLILEKQMDPDQAFIHMSQIIEQVNAALSSFLNEQIHQVEEQKEF 190

Query: 674 RVD--------------PSKGSVGFGSGLHGWAFTLKQFSEMYA 763
            +D              P+K +V F S +  WAFT+  FS ++A
Sbjct: 191 SLDDDYITNLESNLYFCPTKNNVVFCSSIDAWAFTVGTFSAIFA 234


>UniRef50_Q4UIT0 Cluster: Elongation factor 2, putative; n=2;
           Theileria|Rep: Elongation factor 2, putative - Theileria
           annulata
          Length = 1226

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 29/61 (47%), Positives = 42/61 (68%)
 Frame = +1

Query: 73  VDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQD 252
           +  I  +++   NIRN+  +AHVDHGK+TL+DSL+S  GII+   +G+ R+ D R DEQ 
Sbjct: 1   MQNISDVLELTENIRNVCFLAHVDHGKTTLSDSLISSVGIISEKLSGKLRYLDNRDDEQM 60

Query: 253 R 255
           R
Sbjct: 61  R 61



 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 40/83 (48%), Positives = 51/83 (61%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITIKS++IS+ +  +   L   +N +   K++K  LINLIDSPGHVDFS EV+ A R+ D
Sbjct: 63  ITIKSSSISLLYT-KYGHLNHNSNSNS-PKNDK-VLINLIDSPGHVDFSIEVSTAARLCD 119

Query: 438 GALXXXXXXXXXXXQTETVLRQA 506
           GAL           QT  VLRQA
Sbjct: 120 GALLVVDVVEGICPQTRAVLRQA 142


>UniRef50_P53893 Cluster: Uncharacterized GTP-binding protein
           YNL163C; n=6; Saccharomycetales|Rep: Uncharacterized
           GTP-binding protein YNL163C - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 1110

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 39/82 (47%), Positives = 51/82 (62%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT++S+AIS++F +  K        D+   SE   L+NLIDSPGH+DFSSEV+AA R+ D
Sbjct: 68  ITMESSAISLYFRVLRKQ----EGSDEPLVSEH--LVNLIDSPGHIDFSSEVSAASRLCD 121

Query: 438 GALXXXXXXXXXXXQTETVLRQ 503
           GA+           QT TVLRQ
Sbjct: 122 GAVVLVDVVEGVCSQTVTVLRQ 143



 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 27/48 (56%), Positives = 37/48 (77%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AHVDHGK++L+DSL++  GII+   AG+ RF D R DEQ R
Sbjct: 19  IRNICIVAHVDHGKTSLSDSLLASNGIISQRLAGKIRFLDARPDEQLR 66



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY 643
           + E++KPIL +NK+DR            Y    +++E VN +I ++
Sbjct: 145 WTEKLKPILVLNKIDRLITELQLTPQEAYIHLSKVIEQVNSVIGSF 190


>UniRef50_UPI0001509D7A Cluster: Elongation factor Tu GTP binding
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu GTP binding domain
           containing protein - Tetrahymena thermophila SB210
          Length = 1162

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 27/50 (54%), Positives = 38/50 (76%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +NIRN+S++AHVDHGK+TL+DSL+S   I +    GE  + D+R+DEQ R
Sbjct: 20  KNIRNISIVAHVDHGKTTLSDSLISSNNIFSKQLVGELHYLDSREDEQQR 69



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 39/82 (47%), Positives = 51/82 (62%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+KS+AIS+ +  +++D                FLINLIDSPGHV+FSSEV++ALR+TD
Sbjct: 71  ITMKSSAISLIYRQQQED----------------FLINLIDSPGHVEFSSEVSSALRLTD 114

Query: 438 GALXXXXXXXXXXXQTETVLRQ 503
           GAL           QT TVL+Q
Sbjct: 115 GALVVVDALEGVSAQTYTVLKQ 136



 Score = 37.5 bits (83), Expect = 0.37
 Identities = 15/46 (32%), Positives = 26/46 (56%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY 643
           Y E++K +L +NK+D+            YQ  Q I+E VN +I+++
Sbjct: 138 YDEKVKSVLVLNKIDKLKYELYQTPEETYQHLQMIIEQVNAVISSF 183


>UniRef50_A0RW30 Cluster: Translation elongation factor; n=4;
           Crenarchaeota|Rep: Translation elongation factor -
           Cenarchaeum symbiosum
          Length = 730

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query: 58  MVNF-TVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDT 234
           MV F + +++  ++  K  IRN  VIAHVDHGK+T++DSL++ +GIIA + AG+    D 
Sbjct: 1   MVKFKSTEQVLKIIKNKDQIRNFGVIAHVDHGKTTMSDSLLAHSGIIAPSAAGQALAMDF 60

Query: 235 RKDEQDR 255
            K+EQ+R
Sbjct: 61  DKEEQER 67



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 4/82 (4%)
 Frame = +3

Query: 276 AISMFFELEEKD---LVFITNPDQR-EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGA 443
           A++M F+ EE++    ++  N      + E  ++IN+ID+PGHVDFS  V  +LR  DGA
Sbjct: 55  ALAMDFDKEEQERGITIYQANVTLHYTQKEDEYVINMIDTPGHVDFSGRVIRSLRAIDGA 114

Query: 444 LXXXXXXXXXXXQTETVLRQAM 509
           +           QTETV R A+
Sbjct: 115 VVVCDAVEGIMTQTETVTRMAL 136



 Score = 39.9 bits (89), Expect = 0.070
 Identities = 24/87 (27%), Positives = 36/87 (41%)
 Frame = +2

Query: 494 TASGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEV 673
           T     E ++P+LF+NK+DR             +T   +V N N ++ TY +        
Sbjct: 132 TRMALEELVRPVLFINKVDRLIKELRLTPEKMQETLASVVSNFNQLLDTYAEP-EYRDAW 190

Query: 674 RVDPSKGSVGFGSGLHGWAFTLKQFSE 754
           +V     SV FGS    WA  +    E
Sbjct: 191 KVSIQDASVTFGSAKDKWAINVDVMKE 217


>UniRef50_UPI000049A247 Cluster: Elongation factor 2; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: Elongation factor 2 -
           Entamoeba histolytica HM-1:IMSS
          Length = 880

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 33/77 (42%), Positives = 43/77 (55%)
 Frame = +3

Query: 363 LINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSASSLFCS*T 542
           L+NL+DSPGHVDFS EV++A+R+TDGAL           QT+TVLRQA      +     
Sbjct: 87  LLNLVDSPGHVDFSGEVSSAVRLTDGALLVVDCIEGVCVQTQTVLRQAASEGLQMILIIN 146

Query: 543 KWTVLFLSSNLKLKNYT 593
           K   L    N  ++  T
Sbjct: 147 KIDRLVFEKNFSIEEAT 163



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 24/49 (48%), Positives = 37/49 (75%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           N+RN+ V+AHVDHGK+++ D+L++  GII+   +G+ R+ D R DEQ R
Sbjct: 18  NVRNICVLAHVDHGKTSICDALIASNGIISKKLSGKVRYLDYRDDEQVR 66



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 34/103 (33%), Positives = 49/103 (47%), Gaps = 2/103 (1%)
 Frame = +2

Query: 461 CVWCVCTN*NSTASGYA-ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           C+  VC    +     A E ++ IL +NK+DR                +++V +VN   A
Sbjct: 119 CIEGVCVQTQTVLRQAASEGLQMILIINKIDRLVFEKNFSIEEATDHLEQLVNSVNNATA 178

Query: 638 TYNDDGGPM-GEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
              DD G + G+   DP KG+V F S + GW F L   SE+YA
Sbjct: 179 VITDDNGTVFGDDYFDPIKGNVVFASAIDGWGFDLVAISEIYA 221


>UniRef50_A3FPW4 Cluster: Elongation factor-like protein; n=3;
           Cryptosporidium|Rep: Elongation factor-like protein -
           Cryptosporidium parvum Iowa II
          Length = 1100

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 40/109 (36%), Positives = 58/109 (53%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+KS+A+S+ F+ EE+  + + + D        +LINLIDSPGHVDF+ EV ++LR++D
Sbjct: 54  ITMKSSAVSLKFKYEEEIKLEVEDGD--------YLINLIDSPGHVDFTYEVISSLRISD 105

Query: 438 GALXXXXXXXXXXXQTETVLRQAMPSASSLFCS*TKWTVLFLSSNLKLK 584
           GAL           QT  VL+ A      +     K   L L     +K
Sbjct: 106 GALLLVDVAEGIGDQTRKVLQHAFKERLKIILVLNKMDRLILELGFDVK 154



 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 26/50 (52%), Positives = 37/50 (74%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +NIRN+ +IAHVDHGK+TL D L++   I++   AG  R+ D+R+DEQ R
Sbjct: 3   KNIRNVCIIAHVDHGKTTLADYLLASNNILSNKSAGTIRYLDSREDEQYR 52



 Score = 33.5 bits (73), Expect = 6.1
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVII 634
           + ER+K IL +NKMDR            Y    +++E +NVI+
Sbjct: 129 FKERLKIILVLNKMDRLILELGFDVKEAYIHITKLIEQINVIV 171


>UniRef50_Q754P1 Cluster: AFR031Cp; n=1; Eremothecium gossypii|Rep:
           AFR031Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 1099

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 38/82 (46%), Positives = 48/82 (58%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT++S+AIS++F +  K           E      LINLIDSPGH+DFSSEV+AA R+ D
Sbjct: 68  ITMESSAISLYFRVLHKQ------EGSSEPLVNEHLINLIDSPGHIDFSSEVSAASRLCD 121

Query: 438 GALXXXXXXXXXXXQTETVLRQ 503
           GA+           QT TVLRQ
Sbjct: 122 GAIVLVDVVEGVCSQTITVLRQ 143



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 29/66 (43%), Positives = 44/66 (66%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV  + D  + +      +RN+ ++AHVDHGK++L+DSL++  GII+   AG+ RF D+R
Sbjct: 1   MVRISSDVPKRLQRDGACVRNICILAHVDHGKTSLSDSLLASNGIISQRLAGKVRFLDSR 60

Query: 238 KDEQDR 255
            DEQ R
Sbjct: 61  PDEQLR 66



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 25/107 (23%), Positives = 44/107 (41%), Gaps = 22/107 (20%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY------NDD----- 652
           + E+++PIL +NK+DR            Y    + +E VN ++ ++       DD     
Sbjct: 145 WTEKLRPILVLNKIDRLITELQLTPQEAYVHLSKTIEQVNSVLGSFFAGERLLDDLSWRE 204

Query: 653 -----------GGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
                           ++  DPS+ +V F S   GW F +  F++ Y
Sbjct: 205 KLEQDAQAEYVERDDADIYFDPSRNNVIFASAADGWGFNVSLFAKFY 251


>UniRef50_Q5KQ62 Cluster: Translation elongation factor 2, putative;
           n=2; Dikarya|Rep: Translation elongation factor 2,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 1115

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 26/50 (52%), Positives = 39/50 (78%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +N RN++++AHVDHGK++  DSL+S   II+   AG+ RF D+R+DEQ+R
Sbjct: 10  QNTRNVTIVAHVDHGKTSFADSLLSSNNIISSRMAGKLRFLDSREDEQER 59



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 33/83 (39%), Positives = 49/83 (59%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT++S+A+S+ F++         +PD     ++  + N+ID+PGHVDF+SEV+ A R+ D
Sbjct: 61  ITMESSAVSLRFDMTR------LSPDGTSSIQQ-CICNVIDTPGHVDFASEVSTASRLCD 113

Query: 438 GALXXXXXXXXXXXQTETVLRQA 506
           GAL           QT  VLRQA
Sbjct: 114 GALVLVDVWEGVATQTIAVLRQA 136



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +2

Query: 683 PSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
           P +G+V F S + GWAF L +F+ +YA   ++
Sbjct: 231 PDRGNVLFASAIDGWAFRLGKFARLYAEKLKI 262



 Score = 33.9 bits (74), Expect = 4.6
 Identities = 12/46 (26%), Positives = 25/46 (54%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY 643
           + +++KP+L +NKMDR            Y    +++E VN ++ ++
Sbjct: 137 WMDKLKPLLVINKMDRLITELKLSPSEAYHHISQLIEQVNAVMGSF 182


>UniRef50_Q6BJX4 Cluster: Debaryomyces hansenii chromosome F of
           strain CBS767 of Debaryomyces hansenii; n=6;
           Saccharomycetales|Rep: Debaryomyces hansenii chromosome
           F of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 1051

 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 31/68 (45%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRP-SL 285
           NIRN+ ++AHVDHGK++L+DSL++  GII+   AG+ R+ D+R+DEQ R   +     SL
Sbjct: 17  NIRNICILAHVDHGKTSLSDSLLATNGIISQRMAGKVRYLDSREDEQLRGITMEASAISL 76

Query: 286 CSSSLKRK 309
               ++RK
Sbjct: 77  YFKVMRRK 84



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 35/82 (42%), Positives = 49/82 (59%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT++++AIS++F++  +         + E   K  LINLIDSPGH+DFSSEV+ A R+ D
Sbjct: 67  ITMEASAISLYFKVMRRK-ESKEGQAEPETEIKEHLINLIDSPGHIDFSSEVSTASRLCD 125

Query: 438 GALXXXXXXXXXXXQTETVLRQ 503
           GA+           QT  VLRQ
Sbjct: 126 GAVVLVDVVEGVCSQTINVLRQ 147



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 19/104 (18%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY------NDD----- 652
           + + +KPIL +NK+DR            YQ   R++E VN +I ++       DD     
Sbjct: 149 WIDSLKPILVLNKIDRLVTEWKLTPLEAYQHLSRVIEQVNSVIGSFYAGERMEDDMIWRE 208

Query: 653 GGPMGE--------VRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
            G +GE        +   P K +V F S + GWAF++  F+++Y
Sbjct: 209 KGEIGEFIEKDDEDIYFSPEKNNVIFSSAVDGWAFSINTFAKIY 252


>UniRef50_Q6IRN1 Cluster: MGC83880 protein; n=7; Coelomata|Rep:
           MGC83880 protein - Xenopus laevis (African clawed frog)
          Length = 310

 Score = 62.9 bits (146), Expect = 9e-09
 Identities = 27/62 (43%), Positives = 43/62 (69%)
 Frame = +1

Query: 70  TVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQ 249
           ++++I  +  +   IRN+ ++AHVDHGK+TL D L+S  GII+    G+ R+ D+R+DEQ
Sbjct: 5   SLEKIIALQKRAAYIRNICILAHVDHGKTTLADCLISNNGIISNRLVGKLRYLDSREDEQ 64

Query: 250 DR 255
            R
Sbjct: 65  IR 66



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 29/52 (55%), Positives = 36/52 (69%)
 Frame = +3

Query: 351 EKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           E+ +LINLIDSPGHVDFSSEV+ A+R+ DG +           QT+ VLRQA
Sbjct: 83  EEEYLINLIDSPGHVDFSSEVSTAVRLCDGCIIVVDSVEGVCPQTQAVLRQA 134



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +2

Query: 683 PSKGSVGFGSGLHGWAFTLKQFSEMYA 763
           P +G+V F S + GW FT+  F+++Y+
Sbjct: 227 PDQGNVVFASAIDGWGFTIDHFAQLYS 253


>UniRef50_Q7RLB9 Cluster: Elongation factor Tu family, putative;
           n=5; Plasmodium (Vinckeia)|Rep: Elongation factor Tu
           family, putative - Plasmodium yoelii yoelii
          Length = 1308

 Score = 62.9 bits (146), Expect = 9e-09
 Identities = 26/54 (48%), Positives = 38/54 (70%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +DK   IRN+ ++AHVDHGK+TL D+L+S   II+    G+ ++ D R+DEQ R
Sbjct: 7   LDKNEQIRNICILAHVDHGKTTLVDNLISSNKIISEKNIGKVKYMDNREDEQKR 60



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 37/77 (48%), Positives = 45/77 (58%)
 Frame = +3

Query: 273 TAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXX 452
           T+IS     EEKD   ITN       E  +LIN+ID+PGHVDFSSEV+  +R+ DGAL  
Sbjct: 123 TSISQKENNEEKDK--ITN---NSMDENMYLINIIDTPGHVDFSSEVSTCVRICDGALIL 177

Query: 453 XXXXXXXXXQTETVLRQ 503
                    QT+ VLRQ
Sbjct: 178 IDCIEGLCSQTKIVLRQ 194


>UniRef50_A2Y5K4 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 1266

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 28/88 (31%), Positives = 51/88 (57%)
 Frame = +2

Query: 515 RIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKG 694
           +I+P+  +NK+DR            YQT   ++++VN  ++++ D        +V P+KG
Sbjct: 574 KIQPVFTLNKIDRFFLEQNVDGEKAYQTLSSLIDSVNATMSSHKD-------AQVYPTKG 626

Query: 695 SVGFGSGLHGWAFTLKQFSEMYATNSRL 778
           +V F SGLHGWA  +  F++MY++  ++
Sbjct: 627 TVVFSSGLHGWAVAISNFAKMYSSKFKV 654



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 42/142 (29%), Positives = 67/142 (47%), Gaps = 1/142 (0%)
 Frame = +3

Query: 240 GRTRPCITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTA 419
           G T   +T  ++ IS+++E+ E  L   +  D+R  +  G LINLIDSP   + S++V  
Sbjct: 486 GITSQEVTESNSLISLYYEMPEDSLR--SYKDKRAGT--GHLINLIDSPVCCNLSNDVQP 541

Query: 420 ALRVTDGALXXXXXXXXXXXQTETVLRQAMPSASSLFCS*TKWTVLFLSSNLK-LKNYTR 596
           AL + DGAL            T+T +R+A+        +  K    FL  N+   K Y  
Sbjct: 542 ALCIMDGALVVVDSFEGVTLWTKTSIREALNMKIQPVFTLNKIDRFFLEQNVDGEKAYQT 601

Query: 597 RSSVL*KMLTSL*PHITMMVVP 662
            SS++  +  ++  H    V P
Sbjct: 602 LSSLIDSVNATMSSHKDAQVYP 623



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/39 (51%), Positives = 27/39 (69%)
 Frame = +1

Query: 76  DEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGI 192
           +E+  +M  K NIRN+ VIA   HGK+ + DSLV+ AGI
Sbjct: 449 EELHSIMCNKNNIRNVLVIADAGHGKTAILDSLVATAGI 487


>UniRef50_Q8TXJ4 Cluster: Elongation factor 2 (EF-2) [Contains: Mka
           fusA intein]; n=192; Archaea|Rep: Elongation factor 2
           (EF-2) [Contains: Mka fusA intein] - Methanopyrus
           kandleri
          Length = 1257

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 29/50 (58%), Positives = 35/50 (70%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +LINLID+PGHVDFS +VT A+R  DGA+           QTETVLRQA+
Sbjct: 610 YLINLIDTPGHVDFSGDVTRAMRAVDGAIVVVCAVEGVMPQTETVLRQAL 659



 Score = 43.6 bits (98), Expect = 0.006
 Identities = 23/75 (30%), Positives = 35/75 (46%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER++P+L++NK+DR               F  I+  VN +I     +     E +V    
Sbjct: 661 ERVRPVLYINKVDRLINELKLSPEEMQNRFLEIISEVNKMIEQMAPEEF-KDEWKVSVED 719

Query: 692 GSVGFGSGLHGWAFT 736
           GSV FGS  +GW  +
Sbjct: 720 GSVAFGSAYYGWGIS 734



 Score = 33.9 bits (74), Expect = 4.6
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +1

Query: 76  DEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKA 186
           ++ R +M +   IRN+ +IAH+DHGK    ++ +  A
Sbjct: 9   EKCRKLMTEPGKIRNIGIIAHIDHGKCVAPETKICLA 45


>UniRef50_A7AVU9 Cluster: Elongation factor Tu-like protein; n=1;
           Babesia bovis|Rep: Elongation factor Tu-like protein -
           Babesia bovis
          Length = 1222

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 27/55 (49%), Positives = 38/55 (69%)
 Frame = +1

Query: 91  MMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           ++    +IRN+  +AHVDHGK+TL+DSL+S  GII+   +G  R+ D R DEQ R
Sbjct: 7   LLKSTEHIRNVCFLAHVDHGKTTLSDSLISSIGIISERMSGRLRYLDNRDDEQRR 61



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 36/86 (41%), Positives = 48/86 (55%)
 Frame = +3

Query: 249 RPCITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALR 428
           R  ITIKS++IS+ +   +       N   R  +++  +INL+D PGHVDFS EV  A R
Sbjct: 60  RRMITIKSSSISLLYSASDTSNRTGCN---RLFNDQPCIINLVDCPGHVDFSVEVATAAR 116

Query: 429 VTDGALXXXXXXXXXXXQTETVLRQA 506
           + DGAL           QT+ VLRQA
Sbjct: 117 LCDGALLIVDVVEGICPQTKAVLRQA 142


>UniRef50_Q00RU6 Cluster: Elongation factor Tu family protein; n=2;
           Ostreococcus|Rep: Elongation factor Tu family protein -
           Ostreococcus tauri
          Length = 1020

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 27/61 (44%), Positives = 39/61 (63%)
 Frame = +1

Query: 73  VDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQD 252
           V  +  +     N+RN+ V+AHVDHGK+TL+D L++  G I+  +AG  RF D  +DEQ 
Sbjct: 5   VRRLHALQRSTTNVRNVCVLAHVDHGKTTLSDGLIAHNGFISRRQAGRMRFMDFLEDEQK 64

Query: 253 R 255
           R
Sbjct: 65  R 65



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 33/83 (39%), Positives = 44/83 (53%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+KS  IS+ +    +      + +  E +    LI L+DSPGHVDF SEV+ A R++D
Sbjct: 67  ITMKSAGISLLYTPRRRG---DADAEDAEDARAPILITLVDSPGHVDFCSEVSTAARLSD 123

Query: 438 GALXXXXXXXXXXXQTETVLRQA 506
           G L           QT  VLRQA
Sbjct: 124 GCLVVVDVVEGVCVQTHAVLRQA 146



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = +2

Query: 686 SKGSVGFGSGLHGWAFTLKQFSEMYA 763
           ++G+V FGS + GWAF   +F E+YA
Sbjct: 248 ARGNVAFGSAIDGWAFRPDEFVELYA 273


>UniRef50_Q96VE6 Cluster: Putative translation elongation factor 2;
           n=2; Ustilago maydis|Rep: Putative translation
           elongation factor 2 - Ustilago maydis (Smut fungus)
          Length = 1069

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 30/49 (61%), Positives = 34/49 (69%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           F+INLID+PGHVDFSSEV+ A R+ DGAL           QT TVLRQA
Sbjct: 11  FMINLIDTPGHVDFSSEVSTASRLCDGALLIVDVVEGVCAQTVTVLRQA 59



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 15/32 (46%), Positives = 23/32 (71%)
 Frame = +2

Query: 668 EVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
           ++  DPSKG+V F S +  WAF L++F+ +YA
Sbjct: 161 DIYFDPSKGNVIFASAMDNWAFRLERFAMLYA 192


>UniRef50_Q8IDL6 Cluster: Elongation factor Tu, putative; n=2;
           Plasmodium|Rep: Elongation factor Tu, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 1394

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 27/61 (44%), Positives = 43/61 (70%)
 Frame = +1

Query: 73  VDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQD 252
           +D I+ + D  + IRN+ ++AHVDHGK+TL D+L+S   II+    G+ ++ D+R+DEQ 
Sbjct: 1   MDFIKHLSDNDK-IRNICILAHVDHGKTTLVDNLISSNKIISEKNIGKIKYLDSREDEQK 59

Query: 253 R 255
           R
Sbjct: 60  R 60



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 27/59 (45%), Positives = 37/59 (62%)
 Frame = +3

Query: 330 PDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           P + + +   F IN+ID+PGHVDFSSEV+  +R+ DGAL           QT+ VLRQ+
Sbjct: 195 PKEEKNNMDTFSINIIDTPGHVDFSSEVSTCIRICDGALILVDCIEGLCSQTKIVLRQS 253


>UniRef50_O17944 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 894

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 25/49 (51%), Positives = 37/49 (75%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +IRN+ ++AHVDHGK++  DSLVS   +I+   AG+ R+ D+R+DEQ R
Sbjct: 19  HIRNVCLVAHVDHGKTSFADSLVSANAVISSRMAGKLRYMDSREDEQTR 67



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = +3

Query: 363 LINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSASSL 527
           LINLIDSPGHVDFS EVT+AL ++D AL           QTE ++RQ + +  ++
Sbjct: 84  LINLIDSPGHVDFSGEVTSALILSDIALLLIDVIEGICSQTEALIRQVIRNGQAM 138



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 11/95 (11%)
 Frame = +2

Query: 527 ILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY-------NDDGGPMGE----V 673
           IL +NK+DR            YQ   R++E VN  I+         +D  G + E    +
Sbjct: 139 ILVINKIDRLRVELKMSSSEAYQHMSRLIEGVNSCISQVLGGIVLEDDTWGNIEESEAKL 198

Query: 674 RVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
             DP+KG+V F S LH +AF  + F+++ A   ++
Sbjct: 199 HFDPAKGNVIFSSALHSYAFGCEDFAQIAAEKMKV 233


>UniRef50_Q8SQV5 Cluster: TRANSLATION ELONGATION FACTOR 2; n=1;
           Encephalitozoon cuniculi|Rep: TRANSLATION ELONGATION
           FACTOR 2 - Encephalitozoon cuniculi
          Length = 678

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 28/50 (56%), Positives = 35/50 (70%)
 Frame = +1

Query: 124 SVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNL 273
           SV+AH+DHGK++L DSLV+  G I+   AG  RF DTR+DEQ R   L L
Sbjct: 10  SVVAHIDHGKTSLIDSLVASQGRISRTLAGSIRFLDTREDEQARGITLKL 59


>UniRef50_A5K8C0 Cluster: Translation elongation factor, putative;
           n=2; Plasmodium|Rep: Translation elongation factor,
           putative - Plasmodium vivax
          Length = 1389

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 23/54 (42%), Positives = 39/54 (72%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +++   +RN+ ++AHVDHGK+TL D+L+S   II+    G+ ++ D+R+DEQ R
Sbjct: 7   LNENERLRNICILAHVDHGKTTLVDNLISSNKIISDKNIGKVKYLDSREDEQKR 60



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 25/47 (53%), Positives = 31/47 (65%)
 Frame = +3

Query: 363 LINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           LIN+ID+PGHVDFSSEV+  +R+ DGAL           QT+ V RQ
Sbjct: 175 LINIIDTPGHVDFSSEVSTCIRICDGALILVDCIEGVCSQTKIVFRQ 221



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 25/94 (26%), Positives = 37/94 (39%), Gaps = 9/94 (9%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVII---------ATYNDDGG 658
           + E IK IL +NK+D+            Y+    I+E VN  I            N +  
Sbjct: 223 WKEMIKSILVINKIDKLITNQNMDSISAYEHINNIIEQVNAYIYQLYVEENMNNENVETS 282

Query: 659 PMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
            M +    P KG+V   S  H W   +  FS ++
Sbjct: 283 EMEKYTYSPLKGNVLLCSSTHCWCIDMNIFSTLF 316


>UniRef50_Q8ZZC1 Cluster: Elongation factor 2; n=17;
           Thermoprotei|Rep: Elongation factor 2 - Pyrobaculum
           aerophilum
          Length = 740

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/56 (50%), Positives = 35/56 (62%)
 Frame = +3

Query: 342 EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           E   K +LIN +D+PGHVDF+  VT +LRV DG L           QTETV+RQA+
Sbjct: 86  EYGGKPYLINFVDTPGHVDFTGHVTRSLRVMDGGLVVVDAVEGVMTQTETVVRQAL 141



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/67 (38%), Positives = 38/67 (56%)
 Frame = +1

Query: 55  KMVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDT 234
           ++V   +DEI  +      IRN   +AHVDHGK+T +DSL+  AG+++   AG+    D 
Sbjct: 6   RIVEKQLDEILAIAKNPAQIRNAGTLAHVDHGKTTTSDSLLMGAGLLSPKVAGKALAMDY 65

Query: 235 RKDEQDR 255
              EQ R
Sbjct: 66  VPIEQLR 72



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 23/76 (30%), Positives = 37/76 (48%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           E ++P+LF+NK+DR             Q    IV++ N +I  +        + ++DP K
Sbjct: 143 EYVRPVLFINKIDRLIKELRLSPQEIQQRILTIVKDFNALIDMFAPPEFK-DKWKIDPGK 201

Query: 692 GSVGFGSGLHGWAFTL 739
           G +  GS LH W  T+
Sbjct: 202 GQMALGSALHKWGITI 217


>UniRef50_Q9LS91 Cluster: Elongation factor EF-2; n=1; Arabidopsis
           thaliana|Rep: Elongation factor EF-2 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 963

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 27/51 (52%), Positives = 33/51 (64%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K + +NLIDSPGH+DF SEV+ A R++DGAL           QT  VLRQA
Sbjct: 72  KDYSLNLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEGVHIQTHAVLRQA 122



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLV--SKAGIIAGARAGETRFTDTRKDEQDRASPLNLRP 279
           R +RN+ ++AHVDHGK+TL D L+  S  G++    AG+ RF D   +EQ RA  + ++ 
Sbjct: 7   RKVRNICILAHVDHGKTTLADHLIASSGGGVLHPRLAGKLRFMDYLDEEQRRA--ITMKS 64

Query: 280 SLCSSSLKRK 309
           S  S SLK K
Sbjct: 65  S--SISLKYK 72


>UniRef50_A2EAD8 Cluster: Elongation factor Tu GTP binding domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Elongation factor Tu GTP binding domain containing
           protein - Trichomonas vaginalis G3
          Length = 835

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 25/66 (37%), Positives = 40/66 (60%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           M NF+ + +  ++ +  +  N  ++AHVDHGK+TL D L+S   II    AGE R+ D  
Sbjct: 1   MFNFSHETVEKVISRPEHTLNFCILAHVDHGKTTLCDHLLSSNSIITKELAGEVRYMDCL 60

Query: 238 KDEQDR 255
           + E++R
Sbjct: 61  QAERER 66



 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 24/54 (44%), Positives = 33/54 (61%)
 Frame = +3

Query: 345 KSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K  + F + ++DSPGHVDF +EV+ A+R++DG L           QTE VLR A
Sbjct: 81  KENELFYLTVVDSPGHVDFEAEVSNAVRLSDGCLILVDAVEGVCVQTELVLRCA 134



 Score = 34.7 bits (76), Expect = 2.6
 Identities = 25/92 (27%), Positives = 41/92 (44%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDP 685
           +   +KPIL +NK+DR                +++++ +N   AT  +D  P      DP
Sbjct: 135 FNNNLKPILVINKVDRLFTELDLSPEDAELHLEQLLQEINA--ATLQEDP-PF-----DP 186

Query: 686 SKGSVGFGSGLHGWAFTLKQFSEMYATNSRLT 781
           S G+V F S +  W F +   S  +A    +T
Sbjct: 187 SIGNVVFVSCIGKWGFAVPDISSQFADKLGVT 218


>UniRef50_Q73R08 Cluster: Elongation factor G 1; n=2; Treponema|Rep:
           Elongation factor G 1 - Treponema denticola
          Length = 683

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 27/51 (52%), Positives = 33/51 (64%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K F IN+ID+PGHVDF++EV  +LRV DGA+           QTETV  QA
Sbjct: 68  KNFQINIIDTPGHVDFTAEVERSLRVLDGAVAVLCAVGGVQPQTETVWHQA 118


>UniRef50_Q8KCJ5 Cluster: GTP-binding elongation factor family
           protein, typA subfamily; n=3; Bacteria|Rep: GTP-binding
           elongation factor family protein, typA subfamily -
           Chlorobium tepidum
          Length = 609

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/54 (42%), Positives = 36/54 (66%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           M +K+NIRN+++IAHVDHGK+TL DS+  + G     +  + R  D+   E++R
Sbjct: 1   MSRKQNIRNIAIIAHVDHGKTTLVDSIFKQTGAFRENQHVDVRVMDSNPQERER 54



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 22/52 (42%), Positives = 30/52 (57%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           KG  IN++D+PGH DF  EV   L++ DG L           QT+ VLR+A+
Sbjct: 68  KGCKINIVDTPGHADFGGEVERILKMVDGVLLLVDAFEGPMPQTKFVLRKAL 119


>UniRef50_A7QSS1 Cluster: Chromosome chr4 scaffold_162, whole genome
           shotgun sequence; n=3; Vitis vinifera|Rep: Chromosome
           chr4 scaffold_162, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 813

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 2/52 (3%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKA--GIIAGARAGETRFTDTRKDEQDRA 258
           NIRN+ ++AHVDHGK+TL D L++ A  G++   +AG  RF D   +EQ RA
Sbjct: 8   NIRNICILAHVDHGKTTLADHLIAAAADGLVHPKQAGRLRFMDYLDEEQRRA 59



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/47 (57%), Positives = 31/47 (65%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           INLIDSPGH+DF SEV+ A R++DGAL           QT  VLRQA
Sbjct: 77  INLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEGVHIQTHAVLRQA 123



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/78 (30%), Positives = 35/78 (44%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDP 685
           + ER+ P L +NK+DR            Y    RIV  VN I++ +      + +    P
Sbjct: 124 WTERLSPCLVLNKIDRLISELKLSPLEAYSKLVRIVHEVNGIMSAFKSQ-KYLSDDTFQP 182

Query: 686 SKGSVGFGSGLHGWAFTL 739
            KG+V F   L GW F +
Sbjct: 183 QKGNVAFVCALDGWGFRI 200


>UniRef50_Q9VAX8 Cluster: CG4849-PA; n=6; Eukaryota|Rep: CG4849-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 975

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 31/84 (36%), Positives = 45/84 (53%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER    + +NK+DR            Y   + IVE VN +++TY   G P   + V P  
Sbjct: 251 ERQAITVCINKIDRLILELKLPPQDAYFKLKHIVEEVNGLLSTY---GAPDDNLLVSPIL 307

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S L+G+ FTLK F+++YA
Sbjct: 308 GNVCFASSLYGFCFTLKSFAKLYA 331



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 21/63 (33%), Positives = 38/63 (60%)
 Frame = +3

Query: 339 REKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSA 518
           ++  +K +L+N+ D+PGHV+FS E TAA+R++DG +            TE +L+ A+   
Sbjct: 193 QDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQER 252

Query: 519 SSL 527
            ++
Sbjct: 253 QAI 255



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKA-GIIAGARAGETRFTDTRKD 243
           + ++ +  +MD    IRN++++ H+ HGK+T  D L+ +           + R+TDT   
Sbjct: 116 YDMEFMADLMDTPPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFT 175

Query: 244 EQDRASPLNLRP-SLCSSSLKRK 309
           EQ+R   +   P +L    +K+K
Sbjct: 176 EQERGCSIKATPVTLVLQDVKQK 198


>UniRef50_Q0AXN1 Cluster: Elongation factor G 1; n=1; Syntrophomonas
           wolfei subsp. wolfei str. Goettingen|Rep: Elongation
           factor G 1 - Syntrophomonas wolfei subsp. wolfei (strain
           Goettingen)
          Length = 673

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/51 (50%), Positives = 34/51 (66%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG  IN+ID+PGHVDF++EV  +LR+ DGA+           Q+ETV RQA
Sbjct: 68  KGNTINIIDTPGHVDFTAEVERSLRILDGAVVIFCGKGGVEPQSETVWRQA 118



 Score = 34.7 bits (76), Expect = 2.6
 Identities = 16/46 (34%), Positives = 28/46 (60%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKD 243
           + +RN+ +IAH+D GK+T T+ ++   G+    + GET   D+  D
Sbjct: 3   KELRNIGIIAHIDAGKTTTTERILYYTGLT--HKMGETHDGDSIMD 46


>UniRef50_Q969S9-2 Cluster: Isoform 2 of Q969S9 ; n=8;
           Tetrapoda|Rep: Isoform 2 of Q969S9 - Homo sapiens
           (Human)
          Length = 732

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 27/51 (52%), Positives = 32/51 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG+ +NLID+PGHVDF+ EV   LRV DGA+           QT TV RQA
Sbjct: 133 KGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQA 183


>UniRef50_Q7QS70 Cluster: GLP_449_30827_27231; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_449_30827_27231 - Giardia lamblia
           ATCC 50803
          Length = 1198

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 4/86 (4%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGF----LINLIDSPGHVDFSSEVTAA 422
           CIT+K++A+S+   L +  ++     DQ   S K      L+N+ID+PGH DFS EV AA
Sbjct: 65  CITMKASAVSLL-HLSDNQMIVDLFKDQSTDSAKAMRVPLLMNVIDTPGHCDFSHEVLAA 123

Query: 423 LRVTDGALXXXXXXXXXXXQTETVLR 500
           + + DGA            QT  VL+
Sbjct: 124 VSICDGAFLLVDAIEGVASQTLGVLK 149



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 22/55 (40%), Positives = 37/55 (67%)
 Frame = +1

Query: 91  MMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +  K +++RN+ V AH+DHGK+TL D+L++   +IA   +G+ R+ D    EQ+R
Sbjct: 10  IQSKPQHVRNICVCAHIDHGKTTLVDTLLASNNLIAKEHSGQLRYMDYLYTEQER 64



 Score = 36.3 bits (80), Expect = 0.86
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 6/89 (6%)
 Frame = +2

Query: 515 RIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYND-----DGGPMGEV-R 676
           +I  +L +NK+DR            Y    ++++  N   A YN      +G P  +   
Sbjct: 155 QIDIVLVINKLDRLYNELNMEPLEAYFHLLKLIDESN---AAYNSVWTEVEGKPAAQQDH 211

Query: 677 VDPSKGSVGFGSGLHGWAFTLKQFSEMYA 763
             P K +V F S + GW FT+  F+++ A
Sbjct: 212 FSPIKDNVVFASAIGGWGFTISSFAQILA 240


>UniRef50_Q969S9 Cluster: Elongation factor G 2, mitochondrial
           precursor; n=40; Deuterostomia|Rep: Elongation factor G
           2, mitochondrial precursor - Homo sapiens (Human)
          Length = 779

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 27/51 (52%), Positives = 32/51 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG+ +NLID+PGHVDF+ EV   LRV DGA+           QT TV RQA
Sbjct: 133 KGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQA 183


>UniRef50_A6GCI1 Cluster: Elongation factor G; n=2;
           Proteobacteria|Rep: Elongation factor G - Plesiocystis
           pacifica SIR-1
          Length = 724

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 27/60 (45%), Positives = 35/60 (58%)
 Frame = +3

Query: 327 NPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +P+     +    INLID+PGHVDF+ EV  +LRV DGA+           Q+ETV RQA
Sbjct: 78  DPEAHTAEDGAHRINLIDTPGHVDFTVEVERSLRVLDGAIAVFDAVAGVEAQSETVWRQA 137


>UniRef50_Q4QA83 Cluster: Elongation factor, putative; n=5;
           Trypanosomatidae|Rep: Elongation factor, putative -
           Leishmania major
          Length = 634

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 24/54 (44%), Positives = 39/54 (72%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           M  + ++RN++VIAHVDHGK+TL DS++S++G +A A     R  D++  E++R
Sbjct: 19  MHTRDDVRNIAVIAHVDHGKTTLVDSMLSQSGTVANA---HNRVMDSKDQERER 69



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           IN++D+PGH+DFS EV  AL++ +G +            T  VLR+A+
Sbjct: 89  INIVDTPGHLDFSGEVERALQMVEGIILLVDAKEGVRPGTRYVLRKAL 136


>UniRef50_UPI0000519D80 Cluster: PREDICTED: similar to mitochondrial
           elongation factor G2 isoform 1; n=1; Apis mellifera|Rep:
           PREDICTED: similar to mitochondrial elongation factor G2
           isoform 1 - Apis mellifera
          Length = 740

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 26/51 (50%), Positives = 31/51 (60%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K + INLID+PGH+DF+ EV   LRV DGA+           QT TV RQA
Sbjct: 101 KNYCINLIDTPGHIDFTMEVEQTLRVLDGAVVILDGSAGVEAQTLTVCRQA 151



 Score = 37.9 bits (84), Expect = 0.28
 Identities = 17/48 (35%), Positives = 30/48 (62%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  +G+I     GE  + +T  D  D+
Sbjct: 38  IRNIGILAHIDAGKTTTTERMLYYSGLI--KHMGEVHYGNTVTDYMDQ 83


>UniRef50_Q38BU9 Cluster: GTP-binding protein, putative; n=3;
           Trypanosoma|Rep: GTP-binding protein, putative -
           Trypanosoma brucei
          Length = 768

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 26/65 (40%), Positives = 42/65 (64%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLC 288
           NIRN++V+AHVDHGK+TL+D L+ + G++ G+      +TD    E++R   + ++   C
Sbjct: 111 NIRNVAVVAHVDHGKTTLSDVLLRRTGVLKGS-VNAGAYTDRLLVERERG--ITVKSQTC 167

Query: 289 SSSLK 303
           S  LK
Sbjct: 168 SMFLK 172



 Score = 40.3 bits (90), Expect = 0.053
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSASSLFCS* 539
           FL+NLID+PGHVDF  EV+ ++R     L           QT +    A+    ++    
Sbjct: 178 FLLNLIDTPGHVDFQYEVSRSVRAAQAVLLLVDVAQGIEAQTMSHFHMALDQGLAIIPVF 237

Query: 540 TK 545
           TK
Sbjct: 238 TK 239


>UniRef50_A0DDX3 Cluster: Chromosome undetermined scaffold_47, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_47,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 165

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 22/45 (48%), Positives = 33/45 (73%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGI 192
           MVN T+++I   M+ + NIRN+ VI H+DHG+ T+ D L+SK+ I
Sbjct: 1   MVNLTINQIIQSMNNQDNIRNICVIGHIDHGRQTIIDQLLSKSNI 45



 Score = 39.5 bits (88), Expect = 0.092
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +3

Query: 348 SEKGFLINLIDSPGHVDFSSE-VTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +++ FL NLID P  ++F SE + ++LRV+DG L            TE++LR A+
Sbjct: 76  TKQQFLFNLIDYPRLLNFGSEAILSSLRVSDGILIVVDYLEGVAYSTESILRMAL 130


>UniRef50_Q2JUX5 Cluster: Elongation factor G; n=58; Bacteria|Rep:
           Elongation factor G - Synechococcus sp. (strain
           JA-3-3Ab) (Cyanobacteria bacteriumYellowstone A-Prime)
          Length = 710

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 26/60 (43%), Positives = 34/60 (56%)
 Frame = +3

Query: 327 NPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           NP Q       + IN+ID+PGHVDF+ EV  ++RV DG +           Q+ETV RQA
Sbjct: 79  NPSQPLAGAPEYTINIIDTPGHVDFTIEVERSMRVLDGVIAVFDSVGGVQPQSETVWRQA 138



 Score = 33.9 bits (74), Expect = 4.6
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGII--AGARAGETRFTDTRKDEQDR 255
           +RN+ + AH+D GK+T T+ ++  +G++   G     T  TD    E++R
Sbjct: 10  VRNIGIAAHIDAGKTTTTERILFYSGLVHKLGEVHEGTTVTDWMAQERER 59


>UniRef50_P34811 Cluster: Elongation factor G, chloroplast
           precursor; n=600; cellular organisms|Rep: Elongation
           factor G, chloroplast precursor - Glycine max (Soybean)
          Length = 788

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 33/80 (41%), Positives = 44/80 (55%)
 Frame = +3

Query: 267 KSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + TA   + E E++  + IT+        K   IN+ID+PGHVDF+ EV  ALRV DGA+
Sbjct: 136 EGTATMDWMEQEQERGITITSAATTTFWNK-HRINIIDTPGHVDFTLEVERALRVLDGAI 194

Query: 447 XXXXXXXXXXXQTETVLRQA 506
                      Q+ETV RQA
Sbjct: 195 CLFDSVAGVEPQSETVWRQA 214



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 9/83 (10%)
 Frame = +1

Query: 34  NKNHKPSKMVNFTVDEIRGMMDKKRNI-----RNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           ++ H P +  NF+V  +    D KR++     RN+ ++AH+D GK+T T+ ++   G   
Sbjct: 72  SRQHAPRR--NFSVFAMSADGDAKRSVPLKDYRNIGIMAHIDAGKTTTTERILYYTG--R 127

Query: 199 GARAGE----TRFTDTRKDEQDR 255
             + GE    T   D  + EQ+R
Sbjct: 128 NYKIGEVHEGTATMDWMEQEQER 150


>UniRef50_A2XK54 Cluster: Putative uncharacterized protein; n=3;
           Magnoliophyta|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 1029

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 25/50 (50%), Positives = 31/50 (62%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           G  +NLIDSPGH+DF SEV++A R++D AL           QT   LRQA
Sbjct: 74  GHRVNLIDSPGHIDFCSEVSSAARLSDSALILVDAVEGVHIQTHAALRQA 123



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 2/53 (3%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKA--GIIAGARAGETRFTDTRKDEQDRA 258
           R +RN  ++AHVDHGK+TL D LV+    G++    AG  RF D   +EQ RA
Sbjct: 8   RRVRNTCILAHVDHGKTTLADHLVASCGDGLVHPRLAGRLRFMDYLDEEQRRA 60



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = +2

Query: 683 PSKGSVGFGSGLHGWAFTLKQFSEMYA 763
           P KG+V F   L GW F + QF+E YA
Sbjct: 210 PQKGNVVFACALDGWGFRIHQFAEFYA 236


>UniRef50_Q4XZI7 Cluster: Elongation factor G, putative; n=6;
           Plasmodium|Rep: Elongation factor G, putative -
           Plasmodium chabaudi
          Length = 938

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +3

Query: 342 EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           EK+   + IN+ID+PGHVDF++EV  +LRV DG +           Q+ETV +QA
Sbjct: 173 EKNLGDYRINIIDTPGHVDFTAEVEKSLRVLDGGIVVFDSSEGVESQSETVWKQA 227


>UniRef50_O87844 Cluster: Elongation factor G 2; n=2;
           Streptomyces|Rep: Elongation factor G 2 - Streptomyces
           coelicolor
          Length = 686

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 26/50 (52%), Positives = 32/50 (64%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           G  INLID+PGHVDF+ EV  +LRV DGA+           Q+E+V RQA
Sbjct: 73  GHRINLIDTPGHVDFADEVERSLRVLDGAVAVFDAVAGVEPQSESVWRQA 122



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGII--AGARAGETRFTDTRKDEQDR 255
           +RN+ ++AHVD GK+T+T+ ++   G     G     T  TD    E+DR
Sbjct: 9   VRNLGILAHVDAGKTTVTERILYLTGTTHKRGEVHDGTTVTDFDPQERDR 58


>UniRef50_A7HB64 Cluster: Translation elongation factor G; n=2;
           Anaeromyxobacter|Rep: Translation elongation factor G -
           Anaeromyxobacter sp. Fw109-5
          Length = 689

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 31/77 (40%), Positives = 44/77 (57%)
 Frame = +3

Query: 276 AISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXX 455
           A+  + ELE +  + IT+        +G  ++LID+PGHVDF+ EV  +LRV DGA+   
Sbjct: 56  AVMDWMELERERGITITSA-VTSFEWRGHELHLIDTPGHVDFTIEVERSLRVLDGAVAVF 114

Query: 456 XXXXXXXXQTETVLRQA 506
                   Q+ETV RQA
Sbjct: 115 DAAHGVEPQSETVWRQA 131



 Score = 36.3 bits (80), Expect = 0.86
 Identities = 15/28 (53%), Positives = 22/28 (78%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           R IRN+ ++AH+D GK+TLT+ L+  AG
Sbjct: 16  RAIRNIGIMAHIDAGKTTLTERLLFVAG 43


>UniRef50_Q4P257 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 842

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +3

Query: 327 NPDQREKSEK--GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           N + +E  EK   F IN+ID+PGHVDF+ EV  ALRV DGA+           QT TV R
Sbjct: 177 NVESKELMEKKQDFHINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVSGVQSQTITVDR 236

Query: 501 Q 503
           Q
Sbjct: 237 Q 237


>UniRef50_Q15029 Cluster: 116 kDa U5 small nuclear ribonucleoprotein
           component; n=58; Eukaryota|Rep: 116 kDa U5 small nuclear
           ribonucleoprotein component - Homo sapiens (Human)
          Length = 972

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 25/65 (38%), Positives = 39/65 (60%)
 Frame = +3

Query: 315 VFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETV 494
           V +  PD + KS   +L N++D+PGHV+FS EVTA LR++DG +            TE +
Sbjct: 186 VTVVLPDTKGKS---YLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERL 242

Query: 495 LRQAM 509
           ++ A+
Sbjct: 243 IKHAV 247



 Score = 41.1 bits (92), Expect = 0.030
 Identities = 25/84 (29%), Positives = 41/84 (48%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   + +NK+DR            Y   + IV+ VN +I+ Y+ D      + + P  
Sbjct: 249 ERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTD----ENLILSPLL 304

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S  +   FTL  F+++YA
Sbjct: 305 GNVCFSSSQYSICFTLGSFAKIYA 328



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR-FTDTRKD 243
           + +D +  +MD    IRN+++  H+ HGK+   D L+ +       R  +   +TD    
Sbjct: 114 YEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFT 173

Query: 244 EQDRASPLNLRP 279
           EQ+R   +   P
Sbjct: 174 EQERGVGIKSTP 185


>UniRef50_Q7MA53 Cluster: Elongation factor G; n=36; Bacteria|Rep:
           Elongation factor G - Wolinella succinogenes
          Length = 693

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 24/51 (47%), Positives = 33/51 (64%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K + +N+ID+PGHVDF+ EV  ++RV DGA+           Q+ETV RQA
Sbjct: 73  KDYQVNIIDTPGHVDFTIEVERSMRVLDGAVAVFCSVGGVQPQSETVWRQA 123


>UniRef50_Q7UN30 Cluster: Elongation factor G; n=2;
           Planctomycetaceae|Rep: Elongation factor G -
           Rhodopirellula baltica
          Length = 724

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/47 (51%), Positives = 31/47 (65%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +NL+D+PGHVDF++EV   LRV DGA+           Q+ETV RQA
Sbjct: 102 VNLLDTPGHVDFTAEVERCLRVLDGAVVVFSAREGVEAQSETVWRQA 148



 Score = 36.3 bits (80), Expect = 0.86
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 4/52 (7%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGE----TRFTDTRKDEQDR 255
           IRN+ +IAH+D GK+T+T+ ++  +G  A  R G     T  TD   +EQ+R
Sbjct: 35  IRNIGIIAHIDAGKTTVTERMLYLSG--AKHRVGRVDHGTTDTDDDPEEQER 84


>UniRef50_A7CUV7 Cluster: Translation elongation factor G; n=1;
           Opitutaceae bacterium TAV2|Rep: Translation elongation
           factor G - Opitutaceae bacterium TAV2
          Length = 731

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/47 (51%), Positives = 32/47 (68%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           IN+ID+PGHVDF++EV  ++RV DGA+           Q+ETV RQA
Sbjct: 111 INIIDTPGHVDFTAEVERSMRVLDGAVAVFCAVAGVQPQSETVWRQA 157


>UniRef50_Q6ESY0 Cluster: Putative elongation factor 2; n=2; Oryza
           sativa|Rep: Putative elongation factor 2 - Oryza sativa
           subsp. japonica (Rice)
          Length = 1005

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/50 (50%), Positives = 30/50 (60%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           G  ++LIDSPGH+DF SEV+AA R+ D AL           QT   LRQA
Sbjct: 86  GHRVHLIDSPGHIDFCSEVSAAARLADSALVLVDAAEGVRVQTHAALRQA 135



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 3/54 (5%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGI---IAGARAGETRFTDTRKDEQDRA 258
           R +RN  ++AHVDHGK++L D L++  G    ++   AG  R  D  ++EQ RA
Sbjct: 14  RRVRNTCILAHVDHGKTSLADHLIAAYGSERRVSERMAGSARVMDHLEEEQRRA 67


>UniRef50_A1CA46 Cluster: Translation elongation factor G2,
           putative; n=11; Pezizomycotina|Rep: Translation
           elongation factor G2, putative - Aspergillus clavatus
          Length = 924

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 31/84 (36%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPD-QREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           ITI+S AI+  +     D    +  + Q  +S     +NLID+PGH DF+ EV  +LR+ 
Sbjct: 118 ITIQSAAITFHWPPTAGDEQAASQQEVQSPRSAASHTMNLIDTPGHADFTFEVLRSLRIL 177

Query: 435 DGALXXXXXXXXXXXQTETVLRQA 506
           DGA+           QTE V  QA
Sbjct: 178 DGAVCILDGVAGVEAQTEQVWHQA 201


>UniRef50_Q803Q6 Cluster: Eftud2 protein; n=9; Eumetazoa|Rep: Eftud2
           protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 686

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 24/60 (40%), Positives = 38/60 (63%)
 Frame = +3

Query: 330 PDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           PD R KS   +L N++D+PGHV+FS EVT+A+R++DG +            TE +++ A+
Sbjct: 192 PDSRGKS---YLFNIMDTPGHVNFSDEVTSAVRLSDGIVLFIDAAEGVMLNTERLIKHAV 248



 Score = 41.5 bits (93), Expect = 0.023
 Identities = 25/84 (29%), Positives = 42/84 (50%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   + +NK+DR            Y   + IV+ VN +++TY+ D      + V P  
Sbjct: 250 ERLAITICINKIDRLIVELKLPPTDAYYKLRHIVDEVNGLLSTYSTD----ESLIVSPLL 305

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S  +   FTL  F+++Y+
Sbjct: 306 GNVCFASSQYCICFTLGSFAKIYS 329



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGE-TRFTDTRKD 243
           + ++ +  +MD    IRN+++  H+ HGK+   D L+ +       R  E  R+ D    
Sbjct: 115 YDMEFLADLMDSSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRDDEDLRYADILFT 174

Query: 244 EQDRASPLNLRP 279
           EQ+R   +   P
Sbjct: 175 EQERGVGIKSTP 186


>UniRef50_Q7SXL2 Cluster: Eftud2 protein; n=2; Eukaryota|Rep: Eftud2
           protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 398

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 24/60 (40%), Positives = 38/60 (63%)
 Frame = +3

Query: 330 PDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           PD R KS   +L N++D+PGHV+FS EVT+A+R++DG +            TE +++ A+
Sbjct: 192 PDSRGKS---YLFNIMDTPGHVNFSDEVTSAVRLSDGIVLFIDAAEGVMLNTERLIKHAV 248



 Score = 41.5 bits (93), Expect = 0.023
 Identities = 25/84 (29%), Positives = 42/84 (50%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   + +NK+DR            Y   + IV+ VN +++TY+ D      + V P  
Sbjct: 250 ERLAITICINKIDRLIVELKLPPTDAYYKLRHIVDEVNGLLSTYSTD----ESLIVSPLL 305

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S  +   FTL  F+++Y+
Sbjct: 306 GNVCFASSQYCICFTLGSFAKIYS 329



 Score = 37.5 bits (83), Expect = 0.37
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGE-TRFTDTRKD 243
           + ++ +  +MD    IRN+++  H+ HGK+   D L+ +       R  E  R+TD    
Sbjct: 115 YDMEFLADLMDSSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRDDEDLRYTDILFT 174

Query: 244 EQDRASPLNLRP 279
           EQ+R   +   P
Sbjct: 175 EQERGVGIKSTP 186


>UniRef50_Q3AK84 Cluster: GTP-binding protein TypA; n=15;
           Bacteria|Rep: GTP-binding protein TypA - Synechococcus
           sp. (strain CC9605)
          Length = 602

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 24/55 (43%), Positives = 36/55 (65%)
 Frame = +1

Query: 91  MMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           M    + IRN+++IAHVDHGK+TL DSL++++GI     A  T   D+   E++R
Sbjct: 1   MSANSKAIRNIAIIAHVDHGKTTLVDSLLAQSGIFRDNEAVPTCVMDSNDLERER 55



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           IN++D+PGH DF  EV   L + DG L           QT  VL++A+
Sbjct: 73  INIVDTPGHADFGGEVERVLGMVDGCLLIVDANEGPMPQTRFVLKKAL 120


>UniRef50_A1ZR77 Cluster: Translation elongation factor G; n=2;
           Bacteroidetes/Chlorobi group|Rep: Translation elongation
           factor G - Microscilla marina ATCC 23134
          Length = 697

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 25/49 (51%), Positives = 31/49 (63%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +  NLID+PGHVDF+ EV  +LRV DGA+           Q+ETV RQA
Sbjct: 76  YQFNLIDTPGHVDFTVEVERSLRVLDGAVMLFCAASGVEPQSETVWRQA 124



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKD 243
           M K  N+RN+ ++AHVD GK+T T+ ++   G+I   + GE    +T  D
Sbjct: 1   MKKLSNLRNLGIMAHVDAGKTTTTERILYYTGMI--HKMGEVHHGNTTMD 48


>UniRef50_Q384D0 Cluster: Elongation factor G2-like protein; n=5;
           Trypanosoma|Rep: Elongation factor G2-like protein -
           Trypanosoma brucei
          Length = 824

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 30/81 (37%), Positives = 40/81 (49%)
 Frame = +3

Query: 264 IKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGA 443
           + S   +M F  EE D              +G  I+LID+PGHVDF+ EV  A+RV DG 
Sbjct: 98  VDSGTTTMDFMKEEMDRGITIQSAAVSFQWRGHSIHLIDTPGHVDFTVEVERAMRVVDGV 157

Query: 444 LXXXXXXXXXXXQTETVLRQA 506
           +           Q+ TVLRQ+
Sbjct: 158 VALFDASAGVQAQSYTVLRQS 178



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGII--AGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  AG +   G     T   D  K+E DR
Sbjct: 65  IRNIGIVAHIDAGKTTTTERMLFYAGAVKRVGDVDSGTTTMDFMKEEMDR 114


>UniRef50_A7AM19 Cluster: Translation elongation factor G, putative;
           n=1; Babesia bovis|Rep: Translation elongation factor G,
           putative - Babesia bovis
          Length = 741

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 345 KSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           ++ K ++IN+ID+PGHVDF+ EV  ALRV DGA+           QT TV  Q
Sbjct: 117 EAPKDYMINIIDTPGHVDFTIEVERALRVLDGAILLCCSVSGVQSQTLTVNMQ 169


>UniRef50_Q9HWD2 Cluster: Elongation factor G 1; n=46; Bacteria|Rep:
           Elongation factor G 1 - Pseudomonas aeruginosa
          Length = 706

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 24/49 (48%), Positives = 32/49 (65%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           + +N+ID+PGHVDF+ EV  +LRV DGA+           Q+ETV RQA
Sbjct: 82  YRVNVIDTPGHVDFTIEVERSLRVLDGAVVVFCGTSGVEPQSETVWRQA 130


>UniRef50_Q4SZZ9 Cluster: Chromosome 3 SCAF11420, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 3 SCAF11420, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 721

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 22/60 (36%), Positives = 38/60 (63%)
 Frame = +3

Query: 330 PDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           PD R KS   +L N++D+PGH++FS EVT+++R++DG +            TE +++ A+
Sbjct: 27  PDSRGKS---YLFNIMDTPGHINFSDEVTSSIRISDGIVLFIDAAEGVMLNTERLIKHAV 83



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 27/84 (32%), Positives = 41/84 (48%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   + +NK+DR            Y   + IV+ VN ++ TY+ D      + V P  
Sbjct: 85  ERMAITICINKVDRLILELKLPPTDAYYKLRHIVDEVNGLLNTYSTD----ETMVVSPLL 140

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S  +   FTL  FS++YA
Sbjct: 141 GNVCFASPQYSICFTLGSFSKIYA 164


>UniRef50_Q9AIG7 Cluster: Elongation factor G; n=2; Candidatus
           Carsonella ruddii|Rep: Elongation factor G - Carsonella
           ruddii
          Length = 681

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 25/47 (53%), Positives = 30/47 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           INLID+PGHVDF+ EV  +LRV DGA+           QTETV  Q+
Sbjct: 78  INLIDTPGHVDFTIEVERSLRVLDGAVILICASSGIQPQTETVWNQS 124



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 3/57 (5%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGI---IAGARAGETRFTDTRKDEQDR 255
           M+  +NIRN+ +IAHVD GK+T T+ ++  +G    I     G T  TD  K EQ+R
Sbjct: 1   MNDIKNIRNIGIIAHVDAGKTTTTERILFFSGFSHKIGEVHTGNT-ITDWMKQEQER 56


>UniRef50_Q9AA65 Cluster: Elongation factor Tu family protein; n=39;
           cellular organisms|Rep: Elongation factor Tu family
           protein - Caulobacter crescentus (Caulobacter
           vibrioides)
          Length = 610

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 20/49 (40%), Positives = 34/49 (69%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           ++RN+++IAHVDHGK+TL D L++++G+     A   R  D+   E++R
Sbjct: 2   SMRNIAIIAHVDHGKTTLVDQLLAQSGVFRANEATTERAMDSNDQERER 50



 Score = 40.3 bits (90), Expect = 0.053
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           IN+ID+PGH DF  EV   L + DG +           QT+ VL +A+
Sbjct: 72  INIIDTPGHADFGGEVERILGMVDGCVLLVDAEEGVMPQTKFVLTKAL 119


>UniRef50_Q7PZ10 Cluster: ENSANGP00000017855; n=7; Eukaryota|Rep:
           ENSANGP00000017855 - Anopheles gambiae str. PEST
          Length = 974

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 22/52 (42%), Positives = 32/52 (61%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           K FL+N  D+PGHV+FS EVTA++R+ DG +            TE +L+ A+
Sbjct: 198 KSFLLNTFDTPGHVNFSDEVTASMRLCDGVVLFVDAAEGVMLNTERLLKHAI 249



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 28/84 (33%), Positives = 40/84 (47%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+   L +NK+DR            Y   Q IV+ +N ++  + D         V P  
Sbjct: 251 ERLSFTLCINKIDRLILELKLPPQDAYFKLQHIVDEINGLLTLHGDSTVKP----VSPVL 306

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V F S L+G  FTLK F+ +YA
Sbjct: 307 GNVCFASSLYGVCFTLKSFARLYA 330



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKA-GIIAGARAGETRFTDTRKD 243
           + ++ +  +MD    IRN++++ H+ HGK+T  D LV +    +        R+TDT   
Sbjct: 116 YKMEFLSDLMDTPTLIRNVALVGHLHHGKTTFVDCLVRQTHPQLRNMEERNLRYTDTLFT 175

Query: 244 EQDRASPLNLRP 279
           EQ+R   +   P
Sbjct: 176 EQERGVSIKATP 187


>UniRef50_Q4UGL7 Cluster: Translation elongation factor G (EF-G),
           putative; n=2; Piroplasmida|Rep: Translation elongation
           factor G (EF-G), putative - Theileria annulata
          Length = 827

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           IN+ID+PGHVDF+ EV  +LRV DG +           Q+ETV RQA
Sbjct: 173 INIIDTPGHVDFTLEVERSLRVLDGGIVVFDGVAGVETQSETVWRQA 219


>UniRef50_Q4Q3F0 Cluster: GTP-binding protein, putative; n=3;
           Leishmania|Rep: GTP-binding protein, putative -
           Leishmania major
          Length = 834

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 30/81 (37%), Positives = 49/81 (60%)
 Frame = +1

Query: 49  PSKMVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFT 228
           P++ V F  + IR     +  IRN+SV+AHVDHGK+TL+D+++  + ++    A  T FT
Sbjct: 112 PAEEVAFKKNLIRSF--PQACIRNVSVVAHVDHGKTTLSDAMLRFSNLLPADGATGT-FT 168

Query: 229 DTRKDEQDRASPLNLRPSLCS 291
           D  K E++R   + ++   CS
Sbjct: 169 DRLKVEKERG--ITIKAQTCS 187



 Score = 40.3 bits (90), Expect = 0.053
 Identities = 16/28 (57%), Positives = 23/28 (82%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGA 443
           +L+NLID+PGHVDF  EV+ +L  ++GA
Sbjct: 199 YLVNLIDTPGHVDFQYEVSRSLCASEGA 226


>UniRef50_Q4N936 Cluster: Translation elongation factor G 2,
           putative; n=1; Theileria parva|Rep: Translation
           elongation factor G 2, putative - Theileria parva
          Length = 803

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           IN+ID+PGHVDF+ EV  +LRV DG +           Q+ETV RQA
Sbjct: 176 INIIDTPGHVDFTLEVERSLRVLDGGIVVFDGVAGVETQSETVWRQA 222


>UniRef50_A3LWR2 Cluster: Mitochondrial elongation factor G-like
           protein; n=2; Pichia|Rep: Mitochondrial elongation
           factor G-like protein - Pichia stipitis (Yeast)
          Length = 845

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           IN+ID+PGH DF+ EVT +LRV DGA+           QTE V +QA
Sbjct: 107 INIIDTPGHADFTFEVTRSLRVLDGAVTILDGVAGVEAQTEKVWKQA 153


>UniRef50_Q660H9 Cluster: Elongation factor G 2; n=3; Borrelia
           burgdorferi group|Rep: Elongation factor G 2 - Borrelia
           garinii
          Length = 669

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           IN+ID+PGHVDF++EV  +LRV DG +           QTETV +Q+
Sbjct: 70  INIIDTPGHVDFTAEVERSLRVLDGGVVIFSAVDGIQAQTETVWKQS 116



 Score = 36.7 bits (81), Expect = 0.65
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 3/63 (4%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLV---SKAGIIAGARAGETRFTDTRKDEQDRASPLNLRP 279
           +IRN+ ++AH+D GK+T T+ ++    K+  I    +G T  TD    EQ+R   ++   
Sbjct: 2   SIRNIGIMAHIDAGKTTTTERIIYYTGKSHKIGDVDSGNT-ITDWMPQEQERGITISSAA 60

Query: 280 SLC 288
             C
Sbjct: 61  ITC 63


>UniRef50_Q7VCA7 Cluster: Predicted membrane GTPase; n=3;
           Bacteria|Rep: Predicted membrane GTPase -
           Prochlorococcus marinus
          Length = 600

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 21/55 (38%), Positives = 37/55 (67%)
 Frame = +1

Query: 91  MMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           M+  ++ +RN++++AHVDHGK+TL D+L+ ++GI     A  T   D+   E++R
Sbjct: 1   MISNQQALRNIAIVAHVDHGKTTLVDALLGQSGIFRDNEAVPTCVMDSNDLERER 55



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           IN++D+PGH DF  EV   L + DG L           QT  VL++A+
Sbjct: 73  INIVDTPGHADFGGEVERVLGMVDGCLLIVDANEGPMPQTRFVLKKAL 120


>UniRef50_Q72B39 Cluster: Translation elongation factor G; n=3;
           Desulfovibrio|Rep: Translation elongation factor G -
           Desulfovibrio vulgaris (strain Hildenborough / ATCC
           29579 / NCIMB8303)
          Length = 682

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +N+ID+PGHVDF+ EV  +LRV DGA+           Q+ETV RQ+
Sbjct: 81  VNIIDTPGHVDFTIEVERSLRVLDGAVGVFCAVGGVEPQSETVWRQS 127


>UniRef50_Q0E3S2 Cluster: Os02g0157700 protein; n=4; cellular
           organisms|Rep: Os02g0157700 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 628

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 24/56 (42%), Positives = 34/56 (60%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLR 276
           NIRN S+IAH+DHGKSTL D L+   G +   R  + +F D    E++R   + L+
Sbjct: 76  NIRNFSIIAHIDHGKSTLADKLLELTGTVQ-KREMKQQFLDNMDLERERGITIKLQ 130



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +3

Query: 348 SEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +++ + +NLID+PGHVDFS EV+ +L   +GAL
Sbjct: 139 NDEPYCLNLIDTPGHVDFSYEVSRSLAACEGAL 171


>UniRef50_A2XIM0 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 311

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 24/49 (48%), Positives = 31/49 (63%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           G+ +N+ID+PGHVDF+ EV  ALRV DGA+           Q+ TV RQ
Sbjct: 135 GYQVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDRQ 183


>UniRef50_Q4Q219 Cluster: Mitochondrial elongation factor G,
           putative; n=8; Trypanosomatidae|Rep: Mitochondrial
           elongation factor G, putative - Leishmania major
          Length = 746

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 26/50 (52%), Positives = 30/50 (60%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           K   IN+ID+PGHVDF+ EV  ALRV DGA+           QT TV RQ
Sbjct: 95  KNSTINIIDTPGHVDFTIEVERALRVLDGAILLMCAVGGVQSQTLTVDRQ 144


>UniRef50_A0Q2C8 Cluster: Translation elongation factor G; n=1;
           Clostridium novyi NT|Rep: Translation elongation factor
           G - Clostridium novyi (strain NT)
          Length = 666

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 28/76 (36%), Positives = 42/76 (55%)
 Frame = +3

Query: 267 KSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K +A   +  +E+K  + I + DQ   + K   INLID+PGH+DFSSE+  +L+  DGA+
Sbjct: 39  KGSAKMDYNSIEKKRGITIFS-DQTSFTWKDACINLIDTPGHIDFSSELERSLKALDGAV 97

Query: 447 XXXXXXXXXXXQTETV 494
                       TET+
Sbjct: 98  LIVSAVEGVQAHTETI 113



 Score = 34.7 bits (76), Expect = 2.6
 Identities = 13/30 (43%), Positives = 23/30 (76%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           +NI+N+ ++AHVD GK+T T+ ++  +G I
Sbjct: 2   KNIKNIGLVAHVDGGKTTTTEQMLYISGAI 31


>UniRef50_Q23FM4 Cluster: Elongation factor G, domain IV family
           protein; n=5; Eukaryota|Rep: Elongation factor G, domain
           IV family protein - Tetrahymena thermophila SB210
          Length = 972

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +1

Query: 64  NFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGI-IAGARAGETRFTDTRK 240
           N T+  ++ +M K   +RN+ ++ H+ HGK+ L D  V +  +        E RFTD RK
Sbjct: 112 NSTIQFMQQIMKKTELVRNVGIVGHLHHGKTGLMDMFVKQTHVHREWDLEKEYRFTDARK 171

Query: 241 DEQDRASPLNLRP 279
           DEQ+R   +   P
Sbjct: 172 DEQERLLSIKSSP 184



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 25/84 (29%), Positives = 44/84 (52%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           E+I   + +NK+DR            Y   +  ++ +N IIA+   D      ++V P  
Sbjct: 248 EKIAITILINKIDRLIIETKLPPVDAYLKIRHTIDEINDIIASLGRDD--FDSLKVSPLL 305

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYA 763
           G+V FGS  +G+ F+++ F+EMY+
Sbjct: 306 GNVCFGSTAYGFVFSIQSFAEMYS 329



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 23/57 (40%), Positives = 33/57 (57%)
 Frame = +3

Query: 330 PDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           PD R+KS   +L+N+ D+PGH +FS EV  ALR+ DG +            TE ++R
Sbjct: 190 PDFRDKS---YLLNIFDTPGHPNFSDEVCCALRMCDGVVLVVDALDGVMLNTERIIR 243


>UniRef50_Q6FDS6 Cluster: Elongation factor G; n=157; cellular
           organisms|Rep: Elongation factor G - Acinetobacter sp.
           (strain ADP1)
          Length = 712

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           IN+ID+PGHVDF+ EV  ++RV DGA            Q+ETV RQA
Sbjct: 84  INVIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQPQSETVWRQA 130


>UniRef50_Q96RP9 Cluster: Elongation factor G 1, mitochondrial
           precursor; n=52; cellular organisms|Rep: Elongation
           factor G 1, mitochondrial precursor - Homo sapiens
           (Human)
          Length = 751

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/46 (54%), Positives = 29/46 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           IN+ID+PGHVDF+ EV  ALRV DGA+           QT TV RQ
Sbjct: 116 INIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNRQ 161



 Score = 33.5 bits (73), Expect = 6.1
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           IRN+ + AH+D GK+TLT+ ++   G IA
Sbjct: 46  IRNIGISAHIDSGKTTLTERVLYYTGRIA 74


>UniRef50_UPI0000D56919 Cluster: PREDICTED: similar to CG31159-PA;
           n=2; Endopterygota|Rep: PREDICTED: similar to CG31159-PA
           - Tribolium castaneum
          Length = 714

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 24/51 (47%), Positives = 29/51 (56%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K +  NLID+PGH+DF+ EV   L V DGA+           QT TV RQA
Sbjct: 98  KNYQFNLIDTPGHIDFTMEVEQTLNVLDGAVVVLDGSAGVEAQTLTVWRQA 148



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 17/48 (35%), Positives = 30/48 (62%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  +G+I   + GE    +T  D  D+
Sbjct: 35  IRNIGILAHIDAGKTTTTERMLYYSGLI--NQMGEVHHGNTVTDFMDQ 80


>UniRef50_A4YUJ6 Cluster: Protein chain elongation factor EF-G,
           GTP-binding; n=2; cellular organisms|Rep: Protein chain
           elongation factor EF-G, GTP-binding - Bradyrhizobium sp.
           (strain ORS278)
          Length = 673

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 24/47 (51%), Positives = 29/47 (61%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           I +ID+PGHVDF  EV  +LRV DGA+           Q+ETV RQA
Sbjct: 62  ITIIDTPGHVDFQIEVERSLRVLDGAIAVFSAVSGVEPQSETVWRQA 108


>UniRef50_A2Y968 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 601

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 26/63 (41%), Positives = 35/63 (55%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+K+   +MF+      L     PD        +L+NLID+PGHVDFS EV+ +L    
Sbjct: 105 ITVKAQTATMFYRHANNQLPASDQPDA-----PSYLLNLIDTPGHVDFSYEVSRSLAACQ 159

Query: 438 GAL 446
           GAL
Sbjct: 160 GAL 162



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/48 (45%), Positives = 31/48 (64%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +RN S+IAHVDHGKSTL D L+   G I     G+ ++ D  + E++R
Sbjct: 57  VRNFSIIAHVDHGKSTLADRLLELTGTIKKGH-GQPQYLDKLQVERER 103


>UniRef50_Q7Q1K8 Cluster: ENSANGP00000010217; n=2; Coelomata|Rep:
           ENSANGP00000010217 - Anopheles gambiae str. PEST
          Length = 668

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 25/46 (54%), Positives = 29/46 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           IN+ID+PGHVDF+ EV  ALRV DGA+           QT TV RQ
Sbjct: 75  INIIDTPGHVDFTVEVERALRVLDGAVLVLCSVGGVQSQTLTVNRQ 120


>UniRef50_A0D5J3 Cluster: Chromosome undetermined scaffold_39, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_39,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 784

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 23/46 (50%), Positives = 30/46 (65%)
 Frame = +3

Query: 369 NLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           NLID+PGH+DF++EV  +LRV DGA+           Q+ETV  QA
Sbjct: 107 NLIDTPGHIDFTAEVERSLRVLDGAIAIFDGVSGVQTQSETVWLQA 152



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%)
 Frame = +1

Query: 103 KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKD--EQDRASPLNLR 276
           +  IRN  +IAH+D GK+T T+ ++  +G I     GE     T  D   Q+R   + +R
Sbjct: 36  EEKIRNFGIIAHIDAGKTTTTERMLFYSGAI--TFPGEVHDGTTTMDFMPQERQRGITIR 93

Query: 277 PSLCS 291
            +  S
Sbjct: 94  SAAIS 98


>UniRef50_A0C617 Cluster: Chromosome undetermined scaffold_151,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_151,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 806

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 25/83 (30%), Positives = 39/83 (46%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           E+ + + F+NK+D+            Y    RI+E +N II  Y  D        ++P+ 
Sbjct: 129 EQNRMVFFINKIDKAFLKLNLNGEQIYLNLNRIIEKINQIIYLYEPDSV------INPAF 182

Query: 692 GSVGFGSGLHGWAFTLKQFSEMY 760
           G + FGS    W FT  QF++ Y
Sbjct: 183 GQITFGSAKQQWGFTCLQFAQQY 205


>UniRef50_P34617 Cluster: Uncharacterized GTP-binding protein
           ZK1236.1; n=2; Caenorhabditis|Rep: Uncharacterized
           GTP-binding protein ZK1236.1 - Caenorhabditis elegans
          Length = 645

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 20/31 (64%), Positives = 27/31 (87%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +G+L+NLID+PGHVDFS+EV+ +L V DG L
Sbjct: 100 RGYLLNLIDTPGHVDFSAEVSRSLAVCDGIL 130



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN  ++AHVDHGKSTL D L+   G +     G+ +  D  + E++R
Sbjct: 42  IRNFGIVAHVDHGKSTLADRLLEMCGAVP---PGQKQMLDKLQVERER 86


>UniRef50_Q74A61 Cluster: Elongation factor G 1; n=6;
           Desulfuromonadales|Rep: Elongation factor G 1 -
           Geobacter sulfurreducens
          Length = 689

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +NL+D+PGH+DF+ EV  +LRV DGA+           Q+E+V RQA
Sbjct: 76  LNLVDTPGHIDFTIEVERSLRVLDGAVTIFSAVEGVQPQSESVWRQA 122


>UniRef50_UPI0000E46328 Cluster: PREDICTED: similar to G elongation
           factor, mitochondrial 2; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to G elongation
           factor, mitochondrial 2 - Strongylocentrotus purpuratus
          Length = 699

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/51 (50%), Positives = 29/51 (56%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K   INLID+PGHVDF+ EV   LRV DGA+           QT TV  QA
Sbjct: 76  KNHRINLIDTPGHVDFTMEVERCLRVLDGAVTVLDASAGVEAQTLTVWDQA 126



 Score = 33.9 bits (74), Expect = 4.6
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGI---IAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  +G    +     G+T  TD    E+DR
Sbjct: 13  IRNIGILAHIDAGKTTTTERMLYYSGTTRHLGDVDDGDT-VTDYMPQERDR 62


>UniRef50_A1FR56 Cluster: Translation elongation factor G; n=1;
           Stenotrophomonas maltophilia R551-3|Rep: Translation
           elongation factor G - Stenotrophomonas maltophilia
           R551-3
          Length = 678

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/47 (48%), Positives = 30/47 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           + LID+PGH+DF+ EV  +LRV DGA+           Q+ETV RQA
Sbjct: 81  LTLIDTPGHIDFAIEVERSLRVLDGAVAVFSAVDGVQPQSETVWRQA 127



 Score = 37.1 bits (82), Expect = 0.49
 Identities = 18/34 (52%), Positives = 25/34 (73%)
 Frame = +1

Query: 115 RNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGE 216
           RN+ +IAH+D GK+TLT+ L+ K+G I   R GE
Sbjct: 10  RNLGIIAHIDAGKTTLTERLLWKSGEI--HRVGE 41


>UniRef50_Q4N321 Cluster: U5 small nuclear ribonucleoprotein,
           putative; n=1; Theileria parva|Rep: U5 small nuclear
           ribonucleoprotein, putative - Theileria parva
          Length = 1028

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 40/84 (47%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ++IKST IS+ F+     L    N        K +L N+ D+PGHV+F  E   AL + D
Sbjct: 193 LSIKSTPISLIFQ---NTLYENINDVSEFPKSKSYLFNIFDTPGHVNFMDEFVHALAICD 249

Query: 438 GALXXXXXXXXXXXQTETVLRQAM 509
           G +            TE ++RQ +
Sbjct: 250 GCVLVIDVLMGLTSVTEQIIRQCV 273


>UniRef50_A6QTV7 Cluster: 116 kDa U5 small nuclear ribonucleoprotein
           component; n=2; Pezizomycotina|Rep: 116 kDa U5 small
           nuclear ribonucleoprotein component - Ajellomyces
           capsulatus NAm1
          Length = 899

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/78 (34%), Positives = 37/78 (47%)
 Frame = +2

Query: 530 LFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGFG 709
           L +NKMDR            Y   + +VE VN +I       G   + R+ P KG+V F 
Sbjct: 271 LVVNKMDRLILELKLPPSDAYFKLKHVVEEVNTVIERTLPGQGE--KRRLSPEKGNVAFA 328

Query: 710 SGLHGWAFTLKQFSEMYA 763
                W FTL+ F++MYA
Sbjct: 329 CTSMNWCFTLQSFAKMYA 346



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           K  L N+ID+PGHV+F  EV AA R+ DG +            TE +++ A+
Sbjct: 212 KSHLFNIIDTPGHVNFVDEVAAAFRLVDGVVLIVDVVEGVQINTEQIIKYAV 263


>UniRef50_Q9UXB6 Cluster: Putative uncharacterized protein
           ORF-c10_003; n=1; Sulfolobus solfataricus|Rep: Putative
           uncharacterized protein ORF-c10_003 - Sulfolobus
           solfataricus
          Length = 207

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 25/44 (56%), Positives = 28/44 (63%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLI 365
           +TVSVC   P T STTT  PS T    VT   KSTCPG SI+L+
Sbjct: 163 NTVSVCVIIPSTASTTTIEPSKTLRLLVTLPLKSTCPGVSIRLM 206


>UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog;
           n=93; Bacteria|Rep: GTP-binding protein TypA/BipA
           homolog - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 611

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 2/56 (3%)
 Frame = +1

Query: 94  MDKK--RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           M KK  +N+RN+++IAHVDHGK+TL D L+ ++G          R  D+   E++R
Sbjct: 1   MQKKTNKNLRNIAIIAHVDHGKTTLVDKLLQQSGTFKKHEEFSERIMDSNDLEKER 56



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K + IN+ID+PGH DF  EV   L + D  L           QT  V ++A
Sbjct: 70  KKYRINIIDTPGHADFGGEVERILSMVDSVLLVVDALEGPMPQTRFVTQKA 120


>UniRef50_Q39SN2 Cluster: Elongation factor G 2; n=4; Bacteria|Rep:
           Elongation factor G 2 - Geobacter metallireducens
           (strain GS-15 / ATCC 53774 / DSM 7210)
          Length = 688

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/47 (48%), Positives = 30/47 (63%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           INLID+PGH+DF+ EV  +LR  DGA+           Q+E+V RQA
Sbjct: 76  INLIDTPGHIDFTIEVERSLRALDGAVAIFSAVEGVQPQSESVWRQA 122


>UniRef50_Q9VRH6 Cluster: CG1410-PA, isoform A; n=3; Drosophila
           melanogaster|Rep: CG1410-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 696

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 24/48 (50%), Positives = 31/48 (64%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN S+IAHVDHGKSTL D L+   G IA    G+ +  D  + E++R
Sbjct: 99  IRNFSIIAHVDHGKSTLADRLLELTGAIA-RNGGQHQVLDNLQVERER 145



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +L+NLID+PGHVDFS+EV+ +L   DG +
Sbjct: 165 YLLNLIDTPGHVDFSNEVSRSLAACDGVV 193


>UniRef50_Q95Y73 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 689

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 25/51 (49%), Positives = 29/51 (56%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG  INLID+PGHVDF  EV   +RV DG +           QT TV RQ+
Sbjct: 88  KGHRINLIDTPGHVDFRVEVERCVRVLDGIVVVIDGSAGVQPQTLTVWRQS 138



 Score = 36.3 bits (80), Expect = 0.86
 Identities = 16/28 (57%), Positives = 22/28 (78%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           +RN+ VIAHVD GK+T+T+ L+  AG I
Sbjct: 25  LRNIGVIAHVDAGKTTVTERLLYLAGAI 52


>UniRef50_Q8I592 Cluster: Elongation factor g, putative; n=1;
           Plasmodium falciparum 3D7|Rep: Elongation factor g,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 803

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 25/54 (46%), Positives = 32/54 (59%)
 Frame = +3

Query: 342 EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           E + K + IN+ID+PGHVDF+ EV  +LRV D A+           QT TV RQ
Sbjct: 110 EINNKKYNINIIDTPGHVDFTIEVERSLRVLDSAILVICGVSGVQSQTLTVNRQ 163



 Score = 33.5 bits (73), Expect = 6.1
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           N+RN+ + AH+D GK+TLT+ ++   G I
Sbjct: 43  NLRNIGISAHIDAGKTTLTERILYYTGKI 71


>UniRef50_Q59LI8 Cluster: Potential spliceosomal translocase-like
           protein Snu114p; n=2; Candida albicans|Rep: Potential
           spliceosomal translocase-like protein Snu114p - Candida
           albicans (Yeast)
          Length = 1022

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 31/115 (26%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +3

Query: 252 PCITIKSTAISMFFELEEKDLVFITNPDQ---REKSEKGFLINLIDSPGHVDFSSEVTAA 422
           P I IK    +   E+E ++L   ++P      +   +  ++NLID+PGHV+F  E  AA
Sbjct: 175 PKINIKKYLDNHKLEIE-RELTIKSSPITLLLSDSKSRSQILNLIDTPGHVNFEDETLAA 233

Query: 423 LRVTDGALXXXXXXXXXXXQTETVLRQAMPSASSLFCS*TKWTVLFLSSNLKLKN 587
           L +TDG +           Q + ++ + +    S+     K+  L L   L +K+
Sbjct: 234 LNITDGVVLIIDAVLGMTIQDQYLIDEVIKQRLSMIIIINKFDKLILELKLPIKD 288


>UniRef50_Q5K8D2 Cluster: GTP-Binding protein lepA, putative; n=5;
           cellular organisms|Rep: GTP-Binding protein lepA,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 693

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/48 (45%), Positives = 31/48 (64%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN+S+IAH+DHGKSTL D L+   G +    +   +F D  K E++R
Sbjct: 91  IRNLSIIAHIDHGKSTLADRLLQMTGTVPA--SSSPQFLDKLKVERER 136



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 24/57 (42%), Positives = 32/57 (56%)
 Frame = +3

Query: 339 REKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           + K    +LINLID+PGHVDFS EV+ +L   +GAL           QT +V   A+
Sbjct: 150 QHKDGHKYLINLIDTPGHVDFSYEVSRSLGACEGALLLVDCSQGIQAQTLSVFHHAL 206


>UniRef50_Q4PDC2 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 728

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 30/84 (35%), Positives = 42/84 (50%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKG-FLINLIDSPGHVDFSSEVTAALRVT 434
           IT+KS A++M ++ +     FI+          G +L+NLID PGHVDFS EV+ +L   
Sbjct: 143 ITVKSQAVTMVYDYDGPREGFISAFQDGFVPRPGRYLLNLIDCPGHVDFSYEVSRSLSAC 202

Query: 435 DGALXXXXXXXXXXXQTETVLRQA 506
             AL           Q+ TV   A
Sbjct: 203 QSALLVVDATQGVQAQSITVFELA 226



 Score = 39.5 bits (88), Expect = 0.092
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +1

Query: 115 RNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           R  S+I+HVDHGKSTL D L+   G I    + + +  D  K E++R
Sbjct: 96  RTFSIISHVDHGKSTLADRLLELTGTIPSDGSNQ-QVLDKLKVERER 141


>UniRef50_A5DTX8 Cluster: Putative uncharacterized protein; n=3;
           Saccharomycetales|Rep: Putative uncharacterized protein
           - Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 826

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/47 (48%), Positives = 29/47 (61%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           IN+ID+PGH DF+ EV  +LRV DGA+           QTE V +QA
Sbjct: 122 INIIDTPGHADFTFEVIRSLRVLDGAVTILDAVAGVEAQTEKVWKQA 168



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +1

Query: 115 RNMSVIAHVDHGKSTLTDSLV---SKAGIIAGARAGETRFTDTRKDEQDRASPLNL 273
           RN+ +IAH+D GK+T T+ ++    K+  I     G+T  TD  + E++R   + L
Sbjct: 56  RNIGIIAHIDAGKTTTTERMIYYSGKSKRIGNVDEGDT-VTDYLQAERERGITIQL 110


>UniRef50_P44910 Cluster: GTP-binding protein typA/bipA homolog;
           n=301; Bacteria|Rep: GTP-binding protein typA/bipA
           homolog - Haemophilus influenzae
          Length = 616

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 1/51 (1%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAG-ETRFTDTRKDEQDR 255
           + +RN+++IAHVDHGK+TL D L+ ++G    AR   + R  D+   E++R
Sbjct: 8   KKLRNIAIIAHVDHGKTTLVDKLLQQSGTFESARGDVDERVMDSNDLEKER 58



 Score = 37.5 bits (83), Expect = 0.37
 Identities = 17/49 (34%), Positives = 24/49 (48%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           + IN++D+PGH DF  EV   L + D  L           QT  V ++A
Sbjct: 74  YRINIVDTPGHADFGGEVERVLSMVDSVLLVVDAFDGPMPQTRFVTQKA 122


>UniRef50_Q4MYM5 Cluster: Elongation factor G, putative; n=2;
           Theileria|Rep: Elongation factor G, putative - Theileria
           parva
          Length = 805

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 23/48 (47%), Positives = 29/48 (60%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           + IN+ID+PGHVDF+ EV  +LRV D A+           QT TV RQ
Sbjct: 176 YSINIIDTPGHVDFTIEVERSLRVLDSAVLLVCSVSGVQSQTVTVFRQ 223



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 23/64 (35%), Positives = 35/64 (54%)
 Frame = +1

Query: 40  NHKPSKMVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGET 219
           N+  S   + TV     + + +R IRN+ + AH+D GK+TLT+ ++  AG I      E 
Sbjct: 52  NYVKSFSTSSTVTRDSNVYNIER-IRNIGISAHIDSGKTTLTERILFYAGKIDSIH--EV 108

Query: 220 RFTD 231
           R TD
Sbjct: 109 RGTD 112


>UniRef50_Q6CBI0 Cluster: Yarrowia lipolytica chromosome C of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome C of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 802

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +NLID+PGH DF+ EV  ++RV DGA+           QTE V +QA
Sbjct: 82  VNLIDTPGHADFTFEVIRSIRVLDGAVCILDGVAGVEAQTEKVWKQA 128



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 13/30 (43%), Positives = 22/30 (73%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           + IRN+ +IAH+D GK+T T+ ++  +G I
Sbjct: 13  KKIRNIGIIAHIDAGKTTTTERILYLSGTI 42


>UniRef50_Q4PDX0 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 1900

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 23/47 (48%), Positives = 27/47 (57%)
 Frame = +3

Query: 366  INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
            I L+D+PGH+DF  EV  ALRV DGA+           QTE V  QA
Sbjct: 1088 ITLVDTPGHIDFGIEVERALRVVDGAVVVLDGVEGVESQTENVWSQA 1134



 Score = 37.9 bits (84), Expect = 0.28
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = +1

Query: 112  IRNMSVIAHVDHGKSTLTDSLVSKAGIIAG 201
            +RN+S+IAH+D GK+TLT+ L+     +AG
Sbjct: 1001 LRNISIIAHIDAGKTTLTERLLHLTNALAG 1030


>UniRef50_Q7XQQ7 Cluster: OSJNBa0091D06.15 protein; n=66; cellular
           organisms|Rep: OSJNBa0091D06.15 protein - Oryza sativa
           (Rice)
          Length = 749

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 26/60 (43%), Positives = 36/60 (60%)
 Frame = +3

Query: 267 KSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + T    + E E++  + IT+P       K   IN+ID+PGHVDF+ EV  ALRV DGA+
Sbjct: 139 EGTVTMDWMEQEQERGITITSPPTTAFWNK-HRINIIDTPGHVDFTLEVERALRVLDGAI 197


>UniRef50_Q22AK9 Cluster: Translation elongation factor G; n=3;
           Oligohymenophorea|Rep: Translation elongation factor G -
           Tetrahymena thermophila SB210
          Length = 755

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 23/46 (50%), Positives = 28/46 (60%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           IN+ID+PGHVDF+ EV  ALRV DG +           QT TV +Q
Sbjct: 125 INVIDTPGHVDFTIEVERALRVLDGGVLLLCGVAGVQPQTLTVFKQ 170


>UniRef50_A2R994 Cluster: Contig An17c0030, complete genome; n=1;
           Aspergillus niger|Rep: Contig An17c0030, complete genome
           - Aspergillus niger
          Length = 861

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/47 (46%), Positives = 28/47 (59%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +NLID+PGH DF+ EV  +LR+ DGA+           QTE V  QA
Sbjct: 133 VNLIDTPGHADFTFEVMRSLRILDGAVCILDGVAGVEAQTERVWHQA 179


>UniRef50_O07631 Cluster: GTP-binding protein typA/bipA homolog;
           n=74; Bacteria|Rep: GTP-binding protein typA/bipA
           homolog - Bacillus subtilis
          Length = 612

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           M  + ++RN+++IAHVDHGK+TL D L+ +AG          R  D+   E++R
Sbjct: 1   MKLRNDLRNIAIIAHVDHGKTTLVDQLLHQAGTFRANEQVAERAMDSNDLERER 54



 Score = 41.1 bits (92), Expect = 0.030
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           IN++D+PGH DF  EV   +++ DG +           QT  VL++A+
Sbjct: 72  INILDTPGHADFGGEVERIMKMVDGVVLVVDAYEGCMPQTRFVLKKAL 119


>UniRef50_Q92IQ1 Cluster: GTP-binding protein lepA; n=187;
           Bacteria|Rep: GTP-binding protein lepA - Rickettsia
           conorii
          Length = 600

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 23/54 (42%), Positives = 34/54 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           M+ ++ IRN S+IAH+DHGKSTL D L+   G +  AR    +  D+   E++R
Sbjct: 1   MNHQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQ-AREMSQQVLDSMDIEKER 53



 Score = 39.9 bits (89), Expect = 0.070
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +3

Query: 339 REKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           + K    + +NL+D+PGHVDF+ EV+ +L   +G+L           QT   + QA+
Sbjct: 67  KAKDGNNYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAI 123


>UniRef50_P0A557 Cluster: Elongation factor G; n=248; Bacteria|Rep:
           Elongation factor G - Mycobacterium bovis
          Length = 701

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 23/47 (48%), Positives = 29/47 (61%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +N+ID+PGHVDF+ EV   LRV DGA+           Q+E V RQA
Sbjct: 80  LNIIDTPGHVDFTVEVERNLRVLDGAVAVFDGKEGVEPQSEQVWRQA 126


>UniRef50_A6C5F4 Cluster: Elongation factor G; n=1; Planctomyces
           maris DSM 8797|Rep: Elongation factor G - Planctomyces
           maris DSM 8797
          Length = 714

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           K   IN+ID+PGHVDF+ EV  +LRV DGA+           Q+ TV RQ
Sbjct: 72  KDTTINIIDTPGHVDFTVEVERSLRVLDGAILVLCSVGGVQSQSLTVDRQ 121


>UniRef50_P39677 Cluster: Elongation factor G 2, mitochondrial
           precursor; n=6; Saccharomycetales|Rep: Elongation factor
           G 2, mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 819

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 22/49 (44%), Positives = 29/49 (59%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           F INLID+PGH+DF+ EV  AL+V D  +           QTE V +Q+
Sbjct: 107 FAINLIDTPGHIDFTFEVIRALKVIDSCVVILDAVAGVEAQTEKVWKQS 155



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 20/60 (33%), Positives = 35/60 (58%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCS 291
           +RN+ +IAH+D GK+T T+ ++  AGI       +T  T T   EQ+R+  + ++ +  S
Sbjct: 41  VRNIGIIAHIDAGKTTTTERMLYYAGISKHIGDVDTGDTITDFLEQERSRGITIQSAAIS 100


>UniRef50_Q4Q870 Cluster: Elongation factor G2-like protein; n=3;
           Leishmania|Rep: Elongation factor G2-like protein -
           Leishmania major
          Length = 763

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/47 (44%), Positives = 29/47 (61%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           INLID+PGHVDF+ EV   +R+ DG +           Q+ TVL+Q+
Sbjct: 48  INLIDTPGHVDFTVEVERTMRIVDGVVALFDASAGVQAQSYTVLQQS 94


>UniRef50_A5DX67 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 1026

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/38 (52%), Positives = 28/38 (73%)
 Frame = +3

Query: 333 DQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           DQR++S   F I L+D+PGH+DF  EV A L++ DGA+
Sbjct: 227 DQRDRS---FAITLVDTPGHIDFQDEVVAGLQLCDGAI 261


>UniRef50_Q7MWJ5 Cluster: GTP-binding protein TypA; n=31;
           Bacteria|Rep: GTP-binding protein TypA - Porphyromonas
           gingivalis (Bacteroides gingivalis)
          Length = 599

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/52 (42%), Positives = 28/52 (53%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           KG  IN+ID+PGH DF  EV   L + DG L           QT  VL++A+
Sbjct: 66  KGCKINIIDTPGHADFGGEVERVLNMADGCLLLVDAFEGPMPQTRFVLQKAI 117



 Score = 43.6 bits (98), Expect = 0.006
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGET-RFTDTRKDEQDR 255
           ++IRN+++IAHVDHGK+TL D ++    +    +A E   F D+   E++R
Sbjct: 2   QDIRNIAIIAHVDHGKTTLVDKMLLAGKLFRDDKAAEVDTFLDSNDLERER 52


>UniRef50_Q5CU80 Cluster: Snu114p GTpase, U5 snRNP-specific protein,
           116 kDa; n=2; Cryptosporidium|Rep: Snu114p GTpase, U5
           snRNP-specific protein, 116 kDa - Cryptosporidium parvum
           Iowa II
          Length = 1035

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 3/84 (3%)
 Frame = +1

Query: 37  KNHKPSKMVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAG- 213
           KN K  +   F+ + +R +MD    +RN+  I  +  GK+T  D L+       G +   
Sbjct: 151 KNLKEME-TTFSYEFLRDLMDNLEFVRNICFIGEIHSGKTTFLDMLIKNTHSYKGDKKNI 209

Query: 214 --ETRFTDTRKDEQDRASPLNLRP 279
               R+ D+RKDEQDR   +   P
Sbjct: 210 PLPERYCDSRKDEQDRGISIKASP 233



 Score = 40.7 bits (91), Expect = 0.040
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = +3

Query: 351 EKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +K FL N++D+PGHV+F  E   ++R+++G +           Q E +L   +
Sbjct: 243 DKSFLFNILDTPGHVNFVDEACISVRISEGVILFLDCVIGLTKQLERLLHYCL 295



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
 Frame = +2

Query: 509 AERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYND-DGGPMGEVR--- 676
           +E  K +L +N++DR            Y   + ++  VN  I  +    G    E R   
Sbjct: 296 SEGKKVVLVINQIDRLVLECRLPPYDAYFKLKHLISAVNNSILEFASIHGFNTDETRNLL 355

Query: 677 VDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRLT 781
             P +G+VGF SG + + FTL  F+  Y  ++ +T
Sbjct: 356 FGPERGNVGFASGRYNFFFTLNSFARKYLKHNGIT 390


>UniRef50_Q4N072 Cluster: GTP-binding elongation factor, putative;
           n=2; Theileria|Rep: GTP-binding elongation factor,
           putative - Theileria parva
          Length = 626

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           NIRN++V+AHVDHGK+TL D  +       G +   TR  D+ + E++R
Sbjct: 29  NIRNVAVVAHVDHGKTTLVDQFLK----YTGGKLSHTRIMDSHELERER 73



 Score = 39.9 bits (89), Expect = 0.070
 Identities = 19/54 (35%), Positives = 27/54 (50%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSAS 521
           + +N+ID+PGH DF  EV   L + D              QT  VLR+A+ + S
Sbjct: 89  YTLNIIDTPGHSDFGGEVERILNIVDCVCLLVDVVEGPKAQTSFVLRKALENQS 142


>UniRef50_P0A3B4 Cluster: GTP-binding protein typA/bipA; n=97;
           Bacteria|Rep: GTP-binding protein typA/bipA - Shigella
           flexneri
          Length = 607

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/48 (39%), Positives = 31/48 (64%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +RN+++IAHVDHGK+TL D L+ ++G        + R  D+   E++R
Sbjct: 5   LRNIAIIAHVDHGKTTLVDKLLQQSGTFDSRAETQERVMDSNDLEKER 52



 Score = 37.1 bits (82), Expect = 0.49
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           + IN++D+PGH DF  EV   + + D  L           QT  V ++A
Sbjct: 68  YRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTRFVTKKA 116


>UniRef50_Q2S6X1 Cluster: Elongation factor G 2; n=1; Hahella
           chejuensis KCTC 2396|Rep: Elongation factor G 2 -
           Hahella chejuensis (strain KCTC 2396)
          Length = 678

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           IN+ID+PGH+DF+ EV  +LRV DGA+           Q+ET  R A
Sbjct: 73  INIIDTPGHIDFNIEVNRSLRVLDGAVVVFDSVAGVEPQSETNWRLA 119



 Score = 36.3 bits (80), Expect = 0.86
 Identities = 15/32 (46%), Positives = 23/32 (71%)
 Frame = +1

Query: 100 KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           K + +RN+ +IAHVD GK+TLT+ L+   G +
Sbjct: 2   KLQKLRNIGIIAHVDAGKTTLTERLLHFTGAL 33


>UniRef50_Q64MT7 Cluster: GTP-binding elongation factor family
           protein TypA/BipA; n=5; Bacteroides|Rep: GTP-binding
           elongation factor family protein TypA/BipA - Bacteroides
           fragilis
          Length = 599

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +NIRN+++IAHVDHGK+TL D ++    +  G +       D    E++R
Sbjct: 2   QNIRNIAIIAHVDHGKTTLVDKMLLAGNLFRGNQTSGELILDNNDLERER 51



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           G  IN+ID+PGH DF  EV   L + DG +           QT  VL++A+
Sbjct: 66  GTKINIIDTPGHSDFGGEVERVLNMADGCILLVDAFEGPMPQTRFVLQKAL 116


>UniRef50_Q1ZVV6 Cluster: GTP-binding regulator BipA/TypA; n=4;
           Vibrionales|Rep: GTP-binding regulator BipA/TypA -
           Vibrio angustum S14
          Length = 598

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/50 (36%), Positives = 32/50 (64%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           ++IRN++++AHVDHGK++L D L+ +A  +    + +    D    EQ+R
Sbjct: 5   KDIRNIAIVAHVDHGKTSLVDQLLRQADALTRRESTQRLVMDCNAQEQER 54



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 20/64 (31%), Positives = 29/64 (45%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSASSLFC 533
           KG  IN+ID+PGH DF  EV   + + +  L           QT  V ++A+     L  
Sbjct: 68  KGVRINIIDTPGHADFGGEVERVIDMANAVLVIVDAVEGPMPQTRFVAQKAINKGLKLLV 127

Query: 534 S*TK 545
           +  K
Sbjct: 128 AVNK 131


>UniRef50_A2U1S4 Cluster: GTP-binding elongation factor family
           protein TypA/BipA; n=6; Flavobacteriales|Rep:
           GTP-binding elongation factor family protein TypA/BipA -
           Polaribacter dokdonensis MED152
          Length = 590

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/52 (42%), Positives = 28/52 (53%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           KG  IN+ID+PGH DF  EV   L++ DG L           QT  VL +A+
Sbjct: 65  KGVKINVIDTPGHADFGGEVERVLKMADGVLLLVDAFEGPMPQTRFVLGKAI 116



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/50 (38%), Positives = 32/50 (64%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           ++IRN+++IAHVDHGK+TL D ++ +A I+   +       D    E++R
Sbjct: 2   QSIRNIAIIAHVDHGKTTLVDKIIDQAKILDDRKERTDLLLDNNDLERER 51


>UniRef50_Q4Y6S3 Cluster: Elongation factor g, putative; n=4;
           Plasmodium|Rep: Elongation factor g, putative -
           Plasmodium chabaudi
          Length = 776

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/46 (50%), Positives = 28/46 (60%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           IN+ID+PGHVDF+ EV  +LRV D A+           QT TV RQ
Sbjct: 116 INIIDTPGHVDFTIEVERSLRVLDAAVLVICGVSGVQSQTLTVNRQ 161



 Score = 34.7 bits (76), Expect = 2.6
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTD 231
           N+RN+ + AH+D GK+TLT+ ++   G I      E R TD
Sbjct: 41  NLRNIGISAHIDAGKTTLTERILYYTGKIKSIH--EVRGTD 79


>UniRef50_P46943 Cluster: GTP-binding protein GUF1; n=37; root|Rep:
           GTP-binding protein GUF1 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 645

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/67 (37%), Positives = 37/67 (55%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLC 288
           N RN S++AHVDHGKSTL+D L+    +I    A   +  D  + E++R   + ++   C
Sbjct: 45  NYRNFSIVAHVDHGKSTLSDRLLEITHVI-DPNARNKQVLDKLEVERERG--ITIKAQTC 101

Query: 289 SSSLKRK 309
           S   K K
Sbjct: 102 SMFYKDK 108



 Score = 37.9 bits (84), Expect = 0.28
 Identities = 15/35 (42%), Positives = 25/35 (71%)
 Frame = +3

Query: 342 EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +++ K +L++LID+PGHVDF  EV+ +     GA+
Sbjct: 108 KRTGKNYLLHLIDTPGHVDFRGEVSRSYASCGGAI 142


>UniRef50_Q8N442 Cluster: GTP-binding protein GUF1 homolog; n=108;
           cellular organisms|Rep: GTP-binding protein GUF1 homolog
           - Homo sapiens (Human)
          Length = 669

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/29 (65%), Positives = 22/29 (75%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           NIRN S++AHVDHGKSTL D L+   G I
Sbjct: 67  NIRNFSIVAHVDHGKSTLADRLLELTGTI 95



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K +L+NLID+PGHVDFS EV+ +L    G L
Sbjct: 132 KQYLLNLIDTPGHVDFSYEVSRSLSACQGVL 162


>UniRef50_Q1II96 Cluster: GTP-binding protein TypA; n=2;
           Bacteria|Rep: GTP-binding protein TypA - Acidobacteria
           bacterium (strain Ellin345)
          Length = 605

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/48 (37%), Positives = 32/48 (66%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +RN+++IAHVDHGK+TL D+++ ++G          R  D+ + E++R
Sbjct: 5   LRNIAIIAHVDHGKTTLVDAMLKQSGTFRANEQVADRVMDSNELERER 52



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 19/48 (39%), Positives = 27/48 (56%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           IN++D+PGH DF  EV  AL++ DG +           QT  VL +A+
Sbjct: 70  INIVDTPGHSDFGGEVERALKMVDGVMLLVDASEGPLPQTRYVLGKAL 117


>UniRef50_Q24BY4 Cluster: Elongation factor Tu GTP binding domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu GTP binding domain
           containing protein - Tetrahymena thermophila SB210
          Length = 874

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/49 (42%), Positives = 29/49 (59%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           +  NLID+PGH+DF+ EV  +LRV DGA+           Q+E V  Q+
Sbjct: 130 YQFNLIDTPGHIDFTGEVERSLRVLDGAVAIFDGVSGVQTQSEMVWLQS 178



 Score = 37.5 bits (83), Expect = 0.37
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = +1

Query: 88  GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKD--EQDRAS 261
           G  +    IRN+ +IAH+D GK+T T+ ++  AG +     GE    +T  D  +Q+R  
Sbjct: 57  GTSNDLEKIRNIGIIAHIDAGKTTTTERMLYYAGAL--VEPGEVHDGNTVMDYLQQERDR 114

Query: 262 PLNLRPSLCS 291
            + +R +  S
Sbjct: 115 GITIRAAAIS 124


>UniRef50_A7ATU9 Cluster: U5 small nuclear ribonuclear protein,
           putative; n=1; Babesia bovis|Rep: U5 small nuclear
           ribonuclear protein, putative - Babesia bovis
          Length = 999

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 28/92 (30%), Positives = 46/92 (50%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ++IKST IS+ F+ E   L    + D  +   K +++NL D+PGH++F  E   A  ++D
Sbjct: 187 MSIKSTPISLVFQTETGGL----SGDVLK--HKSYILNLFDTPGHINFIDEFIQAQSISD 240

Query: 438 GALXXXXXXXXXXXQTETVLRQAMPSASSLFC 533
           G +             E +L+  + S  S FC
Sbjct: 241 GCVVVVDVLMGRTTTVELILKHCLKSKVS-FC 271



 Score = 40.7 bits (91), Expect = 0.040
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 5/76 (6%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIA-----GARAGETRFTD 231
           FT   +  +M + + IRN+ +     HGK+TL D  ++ +   A     G     TR+TD
Sbjct: 118 FTFHFMTSLMRQPQFIRNVCICGDFHHGKTTLIDRFINYSRYPAPDCAEGFDTSFTRYTD 177

Query: 232 TRKDEQDRASPLNLRP 279
           TR DEQ R   +   P
Sbjct: 178 TRLDEQARQMSIKSTP 193



 Score = 33.9 bits (74), Expect = 4.6
 Identities = 21/80 (26%), Positives = 39/80 (48%)
 Frame = +2

Query: 530 LFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGFG 709
           L +N +DR            Y   +  + ++N  I+      G   +V ++P +G+V F 
Sbjct: 272 LLLNCLDRLILEMKIPPADAYMKIRHTIADLNDYISNICSVIG-RDKVVLNPLRGNVLFA 330

Query: 710 SGLHGWAFTLKQFSEMYATN 769
           S  +G  FTL+ F+ +YA++
Sbjct: 331 SAKYGIFFTLESFAMLYASS 350


>UniRef50_A0DDX4 Cluster: Chromosome undetermined scaffold_47, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_47,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 816

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 662 MGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYAT 766
           MG+  + P +G+V FGSG  GW+ T  +F+E+YAT
Sbjct: 1   MGDFLLKPEQGTVAFGSGKEGWSLTCTRFAELYAT 35


>UniRef50_A6SDI5 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 965

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/52 (34%), Positives = 31/52 (59%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           K  L+N++D+PGHV+F  EV ++LR+ DG +            TE +++ A+
Sbjct: 207 KSHLLNILDTPGHVNFVDEVASSLRLVDGVVLVVDVVEGVQVNTERIIKHAV 258



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 27/77 (35%), Positives = 37/77 (48%), Gaps = 1/77 (1%)
 Frame = +2

Query: 530 LFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVII-ATYNDDGGPMGEVRVDPSKGSVGF 706
           L +NKMDR            Y   + ++E VN +I AT    G      R+ P KG+V F
Sbjct: 266 LVVNKMDRLILELKLPPTDAYFKLKHVIEEVNTVIEATLPGQGESR---RLSPEKGNVLF 322

Query: 707 GSGLHGWAFTLKQFSEM 757
                GW FTL+ F++M
Sbjct: 323 ACPGMGWCFTLQSFAKM 339



 Score = 33.9 bits (74), Expect = 4.6
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 9/92 (9%)
 Frame = +1

Query: 61  VNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIA-------GARAGE- 216
           V+F    +  +M+    IRN++   H+ HGK+   D LV +   IA       G +  E 
Sbjct: 116 VHFDRSFMSDLMNYPEQIRNIAFAGHLHHGKTAFMDMLVLETHDIAERLEKKTGRKKDEQ 175

Query: 217 TRFTDTRKDEQDRASPLNLRP-SLCSSSLKRK 309
            R+TD    E++R   +   P SL   S K K
Sbjct: 176 LRYTDIHVVERERGLSIKSAPMSLVLQSTKGK 207


>UniRef50_Q9A9F4 Cluster: GTP-binding protein lepA; n=519; cellular
           organisms|Rep: GTP-binding protein lepA - Caulobacter
           crescentus (Caulobacter vibrioides)
          Length = 606

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/48 (43%), Positives = 30/48 (62%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN S++AH+DHGKSTL+D L+   G +  AR    +  D    E++R
Sbjct: 13  IRNFSIVAHIDHGKSTLSDRLIQTTGGLT-AREMSAQVLDNMDIEKER 59



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 17/50 (34%), Positives = 30/50 (60%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +++NL+D+PGHVDF+ EV+ +L   +G++           QT   + QA+
Sbjct: 80  YILNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQAI 129


>UniRef50_Q8F983 Cluster: Elongation factor G; n=98; cellular
           organisms|Rep: Elongation factor G - Leptospira
           interrogans
          Length = 706

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/50 (46%), Positives = 29/50 (58%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           K   IN+ID+PGHVDF+ EV  +LRV D A+           Q+ TV RQ
Sbjct: 83  KNHTINIIDTPGHVDFTVEVERSLRVLDSAILVLCGVAGVQSQSITVDRQ 132


>UniRef50_UPI00006CB620 Cluster: hypothetical protein
           TTHERM_00444420; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00444420 - Tetrahymena
           thermophila SB210
          Length = 572

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 1/85 (1%)
 Frame = +2

Query: 527 ILFMNKMDRXXXXXXXXXXXX-YQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVG 703
           + + NK+D+             YQ     +E  N +I   N+D     E  ++P++ +V 
Sbjct: 116 VWYFNKLDKAIFDMQKSNPEEVYQLLIEKIEQANQLIEQVNEDQSDYIE-EIEPTRSNVL 174

Query: 704 FGSGLHGWAFTLKQFSEMYATNSRL 778
            GS + GWAF+L  F+E Y++  ++
Sbjct: 175 IGSAVDGWAFSLHNFAEEYSSKLKI 199


>UniRef50_Q8C3X4-2 Cluster: Isoform 2 of Q8C3X4 ; n=3; Murinae|Rep:
           Isoform 2 of Q8C3X4 - Mus musculus (Mouse)
          Length = 563

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/47 (48%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = +1

Query: 67  FTVDEIRGMMDKKR----NIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           F+  E++   D  R    +IRN S+IAHVDHGKSTL D L+   G I
Sbjct: 31  FSAAELKEKPDMSRFPVEDIRNFSIIAHVDHGKSTLADRLLELTGTI 77



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K +L+NLID+PGHVDFS EV+ +L    G L
Sbjct: 114 KQYLLNLIDTPGHVDFSYEVSRSLSACQGVL 144


>UniRef50_A3LLY2 Cluster: GTP-binding protein LepA; n=4;
           Bacteria|Rep: GTP-binding protein LepA - Pseudomonas
           aeruginosa 2192
          Length = 617

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/54 (40%), Positives = 32/54 (59%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           M    +IRN S+IAH+DHGKSTL D  +   G ++  R  E +  D+   E++R
Sbjct: 1   MSDLSHIRNFSIIAHIDHGKSTLADRFIQMCGGLSD-REMEAQVLDSMDLERER 53



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K + +N ID+PGHVDF+ EV+ +L   +GAL
Sbjct: 72  KTYQLNFIDTPGHVDFTYEVSRSLAACEGAL 102


>UniRef50_Q4UAD2 Cluster: U5 snRNP subunit, putative; n=1; Theileria
           annulata|Rep: U5 snRNP subunit, putative - Theileria
           annulata
          Length = 1269

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/84 (28%), Positives = 40/84 (47%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ++IKST IS+  E    + +   N +      K +L N+ D+PGHV+F  E   +L + D
Sbjct: 247 LSIKSTPISIILENRLYEKI---NEESNYPKYKSYLFNIFDTPGHVNFMDEFVYSLAICD 303

Query: 438 GALXXXXXXXXXXXQTETVLRQAM 509
           G +            TE ++ Q +
Sbjct: 304 GCVLIVDVLIGLTKVTEQIIIQCL 327



 Score = 36.7 bits (81), Expect = 0.65
 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 4/47 (8%)
 Frame = +2

Query: 653 GGPMGEVRV----DPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRLT 781
           GG +G   V    DP   +VGFGS   G  FTLK F+ +Y TN  +T
Sbjct: 406 GGTLGPSTVTELFDPKNNNVGFGSSKFGIFFTLKSFATLY-TNDNVT 451


>UniRef50_Q2JDK2 Cluster: GTP-binding protein lepA; n=24;
           Actinomycetales|Rep: GTP-binding protein lepA - Frankia
           sp. (strain CcI3)
          Length = 639

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/48 (41%), Positives = 30/48 (62%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN  +IAH+DHGKSTL D ++   G++  AR    ++ D    E++R
Sbjct: 41  IRNFCIIAHIDHGKSTLADRMLGVTGVVE-ARNMRAQYLDRMDIERER 87



 Score = 39.9 bits (89), Expect = 0.070
 Identities = 16/36 (44%), Positives = 26/36 (72%)
 Frame = +3

Query: 339 REKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           R    + ++++LID+PGHVDFS EV+ +L   +GA+
Sbjct: 101 RADDGRDYILHLIDTPGHVDFSYEVSRSLAACEGAV 136


>UniRef50_UPI00003933D9 Cluster: COG1217: Predicted membrane GTPase
           involved in stress response; n=1; Bifidobacterium longum
           DJO10A|Rep: COG1217: Predicted membrane GTPase involved
           in stress response - Bifidobacterium longum DJO10A
          Length = 574

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/52 (36%), Positives = 28/52 (53%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +G  +N+ID+PGH DF  EV   + + DG +           QT  VLR+A+
Sbjct: 70  EGITLNIIDTPGHADFGGEVERGISMVDGVVLLVDASEGPLPQTRFVLRKAL 121



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 13/45 (28%), Positives = 29/45 (64%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           M+++AHVDHGK+TL ++++ ++ + +       R  D+   E+++
Sbjct: 1   MAIVAHVDHGKTTLVNAMLQQSHVFSEREEVPDRVMDSNDLEREK 45


>UniRef50_Q00ZZ1 Cluster: GTP-binding membrane protein LepA homolog;
           n=2; Ostreococcus|Rep: GTP-binding membrane protein LepA
           homolog - Ostreococcus tauri
          Length = 667

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = +1

Query: 115 RNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAG 213
           RN S+IAHVDHGKSTL D L+   G I  A  G
Sbjct: 66  RNFSIIAHVDHGKSTLADRLLELTGAIRRASGG 98



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +3

Query: 315 VFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           V I + D+ +  E  +L+NLID+PGH DFS EV  +L   DGA+
Sbjct: 123 VSILHRDESDGEE--YLLNLIDTPGHADFSFEVARSLSACDGAV 164


>UniRef50_Q6FJ88 Cluster: Similar to sp|P36048 Saccharomyces
           cerevisiae YKL173w U5 snRNP- specific protein; n=1;
           Candida glabrata|Rep: Similar to sp|P36048 Saccharomyces
           cerevisiae YKL173w U5 snRNP- specific protein - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 989

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = +3

Query: 342 EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSAS 521
           +  +K  +INL+D+PGHVDF  EV  A+ V+D AL            T  ++++      
Sbjct: 204 DMQDKSHVINLLDTPGHVDFIDEVAVAMSVSDTALVCIDIIEGISSTTRYIIKECQKRGL 263

Query: 522 SL 527
           S+
Sbjct: 264 SM 265


>UniRef50_Q98QW3 Cluster: GTP-binding protein lepA; n=52; cellular
           organisms|Rep: GTP-binding protein lepA - Mycoplasma
           pulmonis
          Length = 597

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/57 (38%), Positives = 33/57 (57%)
 Frame = +1

Query: 103 KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNL 273
           K  IRN S+IAH+DHGKSTL D ++     ++  R  + +  D+   EQ+R   + L
Sbjct: 3   KSKIRNFSIIAHIDHGKSTLADRILEITQTVS-TRELKAQHLDSMDLEQERGITIKL 58



 Score = 40.7 bits (91), Expect = 0.040
 Identities = 16/31 (51%), Positives = 25/31 (80%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K ++ +LID+PGHVDF+ EV+ +L  ++GAL
Sbjct: 66  KDYIFHLIDTPGHVDFTYEVSRSLAASEGAL 96


>UniRef50_Q88T65 Cluster: GTP-binding protein lepA 2; n=2;
           Lactobacillales|Rep: GTP-binding protein lepA 2 -
           Lactobacillus plantarum
          Length = 595

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/50 (42%), Positives = 31/50 (62%)
 Frame = +1

Query: 100 KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQ 249
           K+ +IRN ++IAH+DHGKSTL D ++S    ++ AR    +  D    EQ
Sbjct: 2   KQSHIRNFAIIAHIDHGKSTLADQIMSLTQTVS-AREQHAQLLDDMTVEQ 50



 Score = 39.5 bits (88), Expect = 0.092
 Identities = 16/26 (61%), Positives = 21/26 (80%)
 Frame = +3

Query: 369 NLIDSPGHVDFSSEVTAALRVTDGAL 446
           NLID+PGHVDF+ EV  +L  T+GA+
Sbjct: 76  NLIDTPGHVDFNYEVAKSLAATEGAI 101


>UniRef50_Q2IJP9 Cluster: Peptide chain release factor 3; n=2;
           Bacteria|Rep: Peptide chain release factor 3 -
           Anaeromyxobacter dehalogenans (strain 2CP-C)
          Length = 541

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 24/88 (27%), Positives = 41/88 (46%)
 Frame = +3

Query: 267 KSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           ++ A+S + E+E +  + IT     +   +G  +NL+D+PGH DFS +    L   DGA+
Sbjct: 48  RANAVSDWMEMERERGISITT-SVLQFPYRGLQMNLLDTPGHADFSEDTYRTLHAVDGAV 106

Query: 447 XXXXXXXXXXXQTETVLRQAMPSASSLF 530
                      QT  + R     +  +F
Sbjct: 107 MLLDCAKGVESQTRKLFRVCRQRSIPIF 134


>UniRef50_Q1VQ31 Cluster: Tetracycline resistance protein; n=1;
           Psychroflexus torquis ATCC 700755|Rep: Tetracycline
           resistance protein - Psychroflexus torquis ATCC 700755
          Length = 660

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 20/31 (64%), Positives = 23/31 (74%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           KG  INLID+PGHVDFSSEV   L + D A+
Sbjct: 68  KGVKINLIDTPGHVDFSSEVERVLCIVDTAV 98



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 3/54 (5%)
 Frame = +1

Query: 103 KRNIRNMSVIAHVDHGKSTLTDSLVSKAG---IIAGARAGETRFTDTRKDEQDR 255
           K+   N+ ++AHVD GK+TLT+  +  +G   I+     G TR TD+   E++R
Sbjct: 2   KKPTINIGILAHVDAGKTTLTEQFLYNSGAIKILGSVDKGSTR-TDSLDIEKER 54


>UniRef50_Q8KCH0 Cluster: GTP-binding protein lepA; n=31; cellular
           organisms|Rep: GTP-binding protein lepA - Chlorobium
           tepidum
          Length = 605

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +3

Query: 345 KSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K  + +++NLID+PGHVDFS EV+ +L   +GAL
Sbjct: 74  KDGQDYILNLIDTPGHVDFSYEVSRSLAACEGAL 107



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 18/48 (37%), Positives = 26/48 (54%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN  +IAH+DHGKSTL D L+     +   +    +  D    E++R
Sbjct: 11  IRNFCIIAHIDHGKSTLADRLLEVTHTLERNQMSTAQVLDDMDLERER 58


>UniRef50_O94429 Cluster: Elongation factor G 2, mitochondrial
           precursor; n=1; Schizosaccharomyces pombe|Rep:
           Elongation factor G 2, mitochondrial precursor -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 813

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 21/47 (44%), Positives = 28/47 (59%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           INLID+PGH DF+ EV  ++ V DGA+           QT+ V +QA
Sbjct: 95  INLIDTPGHADFTFEVERSVAVLDGAVAIIDGSAGVEAQTKVVWKQA 141



 Score = 34.7 bits (76), Expect = 2.6
 Identities = 13/27 (48%), Positives = 21/27 (77%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           +IRN+ +IAH+D GK+TLT+ ++   G
Sbjct: 27  SIRNVGIIAHIDAGKTTLTEKMLYYGG 53


>UniRef50_Q6F0Z6 Cluster: GTP-binding membrane protein, elongation
           factor; n=7; Bacteria|Rep: GTP-binding membrane protein,
           elongation factor - Mesoplasma florum (Acholeplasma
           florum)
          Length = 612

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/52 (38%), Positives = 28/52 (53%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           KG  IN++D+PGH DFSSEV   ++  D  +           QT  VL +A+
Sbjct: 67  KGTKINIVDTPGHADFSSEVERIMKTVDTVILLVDSSEGPMPQTRFVLSKAL 118



 Score = 39.9 bits (89), Expect = 0.070
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           + I N++VIAHVD GKSTL D+L+ + G     +    +  D+   E++R
Sbjct: 4   QKIINIAVIAHVDAGKSTLVDALLKQGGAFRDNQEVVEQIMDSNDQERER 53


>UniRef50_Q5FDV4 Cluster: GTP-binding protein TypA/BipA homolog;
           n=8; cellular organisms|Rep: GTP-binding protein
           TypA/BipA homolog - Ehrlichia ruminantium (strain
           Welgevonden)
          Length = 633

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 21/52 (40%), Positives = 28/52 (53%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +G  IN+ID+PGH DF  EV   L + DG L           QT+ VL +A+
Sbjct: 92  QGKKINIIDTPGHADFGGEVERVLSMADGVLLLVDASEGPMPQTKFVLSKAL 143



 Score = 41.1 bits (92), Expect = 0.030
 Identities = 18/50 (36%), Positives = 32/50 (64%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           ++I N+++IAHVDHGK+TL D+++ ++G     +    R  D    E++R
Sbjct: 29  QSICNLAIIAHVDHGKTTLLDAMLKQSGTFRENQDVAERVMDNNDLERER 78


>UniRef50_A0JYS6 Cluster: GTP-binding protein TypA; n=101;
           Bacteria|Rep: GTP-binding protein TypA - Arthrobacter
           sp. (strain FB24)
          Length = 642

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/56 (41%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = +3

Query: 348 SEKG--FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           S KG    IN+ID+PGH DF  EV   L + DG +           QT  VLR+A+
Sbjct: 82  SSKGETITINVIDTPGHADFGGEVERGLSMVDGVVLLVDASEGPLPQTRFVLRKAL 137



 Score = 41.9 bits (94), Expect = 0.017
 Identities = 17/51 (33%), Positives = 33/51 (64%)
 Frame = +1

Query: 103 KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           + ++RN++++AHVDHGK+TL D+++ +    A     E R  D+   E+++
Sbjct: 15  RSDLRNVAIVAHVDHGKTTLVDAMLKQTNSFAEHNHLEDRVMDSGDLEREK 65


>UniRef50_Q7Q3I6 Cluster: ENSANGP00000010178; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000010178 - Anopheles gambiae
           str. PEST
          Length = 682

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 21/51 (41%), Positives = 28/51 (54%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K + INL+D+PGH+DF+ EV  +L   DG +           QT TV  QA
Sbjct: 66  KEYRINLLDTPGHIDFTMEVEQSLGAVDGTVIILDGSAGVEAQTVTVWGQA 116



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 3/53 (5%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAG---IIAGARAGETRFTDTRKDEQDR 255
           + IRN+ ++AH+D GK+T T+ ++  +G   ++   + G T  TD  + E++R
Sbjct: 1   KRIRNIGILAHIDAGKTTTTERMLYYSGRTDMLGEVKLGNT-VTDFLQQERER 52


>UniRef50_Q55G92 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 765

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           IN++D+PGHVDF+ EV  ++RV DG +           Q+ TV  QA
Sbjct: 106 INIVDTPGHVDFTVEVERSVRVIDGGVAIFDGVAGVQAQSITVWNQA 152



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 19/57 (33%), Positives = 34/57 (59%)
 Frame = +1

Query: 73  VDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKD 243
           +++ + + ++  N RN+ +IAHVD GK+T  + ++  +G+I   R GE    DT  D
Sbjct: 26  LNQTKNVSNQINNYRNIGIIAHVDAGKTTTCERMLYYSGLI--KRIGEVHKGDTIMD 80


>UniRef50_Q55002 Cluster: Oxytetracycline resistance protein; n=2;
           Streptomyces|Rep: Oxytetracycline resistance protein -
           Streptomyces rimosus
          Length = 663

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 21/45 (46%), Positives = 26/45 (57%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           +NLID+PGH DF SEV  AL V DGA+           QT  ++R
Sbjct: 70  VNLIDTPGHSDFISEVERALGVLDGAVLVVSAVEGVQPQTRILMR 114



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 18/61 (29%), Positives = 35/61 (57%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLC 288
           N  N+ ++AHVD GK++LT+ L+ + G+I    + +   T T   E +R   + +R ++ 
Sbjct: 2   NKLNLGILAHVDAGKTSLTERLLHRTGVIDEVGSVDAGTTTTDSMELERQRGITIRSAVA 61

Query: 289 S 291
           +
Sbjct: 62  T 62


>UniRef50_O51115 Cluster: GTP-binding protein lepA; n=9;
           Bacteria|Rep: GTP-binding protein lepA - Borrelia
           burgdorferi (Lyme disease spirochete)
          Length = 606

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +1

Query: 115 RNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +N  +IAH+DHGKSTL D  + KA II+  R  +++  D+   E++R
Sbjct: 13  KNFCIIAHIDHGKSTLADRFIQKAKIISD-RDFKSQMLDSMDIERER 58



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (5%)
 Frame = +3

Query: 345 KSEKG--FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           KS  G  + +N +D+PGHVDFS EV+ A+   +GAL
Sbjct: 72  KSNDGDFYELNFVDTPGHVDFSYEVSRAISSCEGAL 107


>UniRef50_A7PLZ9 Cluster: Chromosome chr14 scaffold_21, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr14 scaffold_21, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 157

 Score = 42.3 bits (95), Expect = 0.013
 Identities = 23/78 (29%), Positives = 37/78 (47%)
 Frame = +1

Query: 49  PSKMVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFT 228
           P +  + TV   RG  ++K+   N+  I HVDHGK+TLT +L      +  +   +    
Sbjct: 69  PFRRRSLTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASMGNSAPKKYDEI 128

Query: 229 DTRKDEQDRASPLNLRPS 282
           D   +E+ R   +N   S
Sbjct: 129 DAAPEERARGITINTATS 146


>UniRef50_Q4T508 Cluster: Chromosome 1 SCAF9472, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 1 SCAF9472, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 329

 Score = 41.9 bits (94), Expect = 0.017
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           IRN  +IAH+DHGKSTL D L+   G IA
Sbjct: 15  IRNFCIIAHIDHGKSTLADRLLEITGAIA 43



 Score = 39.9 bits (89), Expect = 0.070
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +L+NLID+PGHVDFS EV+ ++    G L
Sbjct: 81  YLLNLIDTPGHVDFSYEVSRSISACQGVL 109


>UniRef50_A7MKJ4 Cluster: Putative uncharacterized protein; n=1;
           Enterobacter sakazakii ATCC BAA-894|Rep: Putative
           uncharacterized protein - Enterobacter sakazakii ATCC
           BAA-894
          Length = 661

 Score = 41.9 bits (94), Expect = 0.017
 Identities = 22/54 (40%), Positives = 30/54 (55%)
 Frame = -3

Query: 506 SLTQYCFSLYTHTRHTVNNHKGSISDTECSCYFRREINVSR*VNQVDQETFLTL 345
           SLT Y F L  +T +   NH  ++ DT  + YF  E+NV R V+ VD   F+ L
Sbjct: 526 SLTPYGFRLRLNTTNCAVNHYRTVKDTHGTFYFDGEVNVPRGVDDVDTVRFILL 579


>UniRef50_Q9VCX4 Cluster: CG31159-PA; n=4; Diptera|Rep: CG31159-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 692

 Score = 41.9 bits (94), Expect = 0.017
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           INL+D+PGH+DF+ EV  +L   DG +           QT TV  QA
Sbjct: 100 INLLDTPGHIDFTMEVEQSLYAVDGVVVVLDGTAGVEAQTVTVWSQA 146



 Score = 33.1 bits (72), Expect = 8.0
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAG---IIAGARAGETRFTDTRKDEQDR 255
           IRN+ ++AH+D GK+T T+ ++  AG    +     G T  TD    E++R
Sbjct: 33  IRNIGILAHIDAGKTTTTERMLFYAGKTRALGEVHRGNT-VTDYLTQERER 82


>UniRef50_Q22A26 Cluster: Elongation factor Tu GTP binding domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu GTP binding domain
           containing protein - Tetrahymena thermophila SB210
          Length = 728

 Score = 41.9 bits (94), Expect = 0.017
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           K + IN++D+PGH DF  EV   + + DG +           QT+ VL++A+
Sbjct: 161 KDYKINIVDTPGHHDFGGEVERIMSMVDGVILLVCATEGPMTQTKFVLKKAL 212



 Score = 41.1 bits (92), Expect = 0.030
 Identities = 18/40 (45%), Positives = 30/40 (75%), Gaps = 2/40 (5%)
 Frame = +1

Query: 79  EIRGMMDKKRN--IRNMSVIAHVDHGKSTLTDSLVSKAGI 192
           EI  ++++  N   RN+++IAHVDHGK+TL D+L+  +G+
Sbjct: 75  EILKVLNQSDNTKFRNVAIIAHVDHGKTTLVDTLLKTSGL 114


>UniRef50_A5JZM2 Cluster: GTP-binding protein TypA, putative; n=7;
           Plasmodium|Rep: GTP-binding protein TypA, putative -
           Plasmodium vivax
          Length = 771

 Score = 41.9 bits (94), Expect = 0.017
 Identities = 16/28 (57%), Positives = 23/28 (82%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           + IRN+++IAHVDHGK+TL D L+ + G
Sbjct: 107 QKIRNVAIIAHVDHGKTTLVDKLLKQGG 134



 Score = 39.5 bits (88), Expect = 0.092
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 294 ELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXX 473
           +LE++  + I +   R K +  F  N++D+PGH DF  EV   L + DG           
Sbjct: 147 DLEKERGITIMSKVTRIKYDDYFF-NIVDTPGHSDFGGEVERVLNLIDGVCLIVDVVEGP 205

Query: 474 XXQTETVLRQAM 509
             QT+ VL++++
Sbjct: 206 KNQTKFVLKKSL 217


>UniRef50_Q5WBK2 Cluster: Translation elongation factor G; n=1;
           Bacillus clausii KSM-K16|Rep: Translation elongation
           factor G - Bacillus clausii (strain KSM-K16)
          Length = 647

 Score = 41.5 bits (93), Expect = 0.023
 Identities = 18/45 (40%), Positives = 26/45 (57%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           +N+ID+PGH DF SEV  AL + DGA+           QT  +++
Sbjct: 70  VNIIDTPGHADFISEVEHALTILDGAILIVSAVEGVQAQTRVLMQ 114



 Score = 39.9 bits (89), Expect = 0.070
 Identities = 21/48 (43%), Positives = 32/48 (66%), Gaps = 2/48 (4%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGII--AGARAGETRFTDTRKDEQDR 255
           N+ V+AHVD GK+TLT+ ++ +AG+I  AG+       TDT   E++R
Sbjct: 5   NIGVLAHVDAGKTTLTEQMLYQAGVIKEAGSVDKGNTTTDTLAIERER 52


>UniRef50_A6G6E0 Cluster: Protein translation elongation factor G;
           n=1; Plesiocystis pacifica SIR-1|Rep: Protein
           translation elongation factor G - Plesiocystis pacifica
           SIR-1
          Length = 678

 Score = 41.5 bits (93), Expect = 0.023
 Identities = 21/46 (45%), Positives = 27/46 (58%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           I +ID+PGH DF+ EV  +LRV DGA+           Q+ TV RQ
Sbjct: 62  ITIIDTPGHADFTVEVERSLRVLDGAVFVFSAVEGVQAQSITVDRQ 107


>UniRef50_A4FHF5 Cluster: Tetracycline resistance protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: Tetracycline
           resistance protein - Saccharopolyspora erythraea (strain
           NRRL 23338)
          Length = 594

 Score = 41.5 bits (93), Expect = 0.023
 Identities = 20/45 (44%), Positives = 26/45 (57%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           +NLID+PGH DF +EV  AL V DGA+           QT  ++R
Sbjct: 70  VNLIDTPGHPDFIAEVERALGVLDGAVLVISAVEGVQAQTRLLMR 114



 Score = 36.3 bits (80), Expect = 0.86
 Identities = 17/58 (29%), Positives = 32/58 (55%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCS 291
           N+ ++AHVD GK++LT+ L+  AG++      +   T T     +R   + +R ++ S
Sbjct: 5   NLGILAHVDAGKTSLTERLLHSAGVVDEVGNVDDGSTRTDSTALERQRGITIRSAVVS 62


>UniRef50_A0ED84 Cluster: Chromosome undetermined scaffold_9, whole
           genome shotgun sequence; n=2; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_9, whole genome shotgun
           sequence - Paramecium tetraurelia
          Length = 606

 Score = 41.5 bits (93), Expect = 0.023
 Identities = 16/29 (55%), Positives = 24/29 (82%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +L NLID+PGHVDF+ EV+ ++R  +GA+
Sbjct: 92  YLYNLIDTPGHVDFTYEVSRSMRACEGAI 120



 Score = 40.3 bits (90), Expect = 0.053
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           IRN  +IAH+DHGKSTL D  +   G I  ++    ++ D  + E++R
Sbjct: 26  IRNFCIIAHIDHGKSTLADRFLEITGTI--SKGKHEQYLDKLEVEKER 71


>UniRef50_Q8GDR1 Cluster: GTP-binding protein LepA; n=1;
           Heliobacillus mobilis|Rep: GTP-binding protein LepA -
           Heliobacillus mobilis
          Length = 426

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 17/36 (47%), Positives = 26/36 (72%)
 Frame = +3

Query: 339 REKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + K  + + +NLID+PGHVDF+ EV+ +L   +GAL
Sbjct: 90  KAKDGQTYTLNLIDTPGHVDFTYEVSRSLAACEGAL 125


>UniRef50_Q5GBH8 Cluster: TetT; n=2; Lactobacillales|Rep: TetT -
           Enterococcus faecalis (Streptococcus faecalis)
          Length = 651

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 17/43 (39%), Positives = 26/43 (60%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETV 494
           +N+ID+PGH+DF +EV   L+V DGA+           QT+ +
Sbjct: 70  VNIIDTPGHMDFIAEVERTLKVLDGAILVISAKEGIQVQTKVI 112



 Score = 39.9 bits (89), Expect = 0.070
 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 2/62 (3%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGII--AGARAGETRFTDTRKDEQDRASPLNLRPSL 285
           I N+ ++AHVD GK+T+T+ L+ K+G I   G     T  TD+ + E+DR   + +R S 
Sbjct: 3   IINIGILAHVDAGKTTVTEGLLYKSGAINKIGRVDNATTTTDSMELERDRG--ITIRAST 60

Query: 286 CS 291
            S
Sbjct: 61  VS 62


>UniRef50_A6ET18 Cluster: GTP-binding elongation factor family
           protein TypA/BipA; n=1; unidentified eubacterium
           SCB49|Rep: GTP-binding elongation factor family protein
           TypA/BipA - unidentified eubacterium SCB49
          Length = 598

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 19/48 (39%), Positives = 25/48 (52%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           IN+ID+PGH DF  EV   L + DG             QT  VL++A+
Sbjct: 68  INIIDTPGHADFGGEVERVLNMADGVCLLVDAFEGPMPQTRFVLQKAL 115



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 12/20 (60%), Positives = 18/20 (90%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLV 177
           N+++IAHVDHGK+TL D ++
Sbjct: 5   NIAIIAHVDHGKTTLVDKIM 24


>UniRef50_Q7RJ38 Cluster: Elongation factor Tu family, putative;
           n=4; Plasmodium (Vinckeia)|Rep: Elongation factor Tu
           family, putative - Plasmodium yoelii yoelii
          Length = 944

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = +1

Query: 100 KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLR 276
           +++N+RN  ++AH+D GKSTL D  +     I   R  + +F D    E++R   + L+
Sbjct: 199 EQKNVRNFCILAHIDSGKSTLADRFLELTNTIKKKRM-QDQFLDMMALERERGITIKLK 256



 Score = 39.9 bits (89), Expect = 0.070
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K ++ NLID+PGH DF  EV  +L V +GA+
Sbjct: 263 KNYIFNLIDTPGHFDFYHEVKRSLNVCEGAI 293


>UniRef50_A7AQT2 Cluster: Elongation factor G 2, mitochondrial,
           putative; n=1; Babesia bovis|Rep: Elongation factor G 2,
           mitochondrial, putative - Babesia bovis
          Length = 537

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 22/52 (42%), Positives = 28/52 (53%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMP 512
           G  IN+ID+PGH DFS EV +A+ V DG +           QT   L  A+P
Sbjct: 69  GCHINVIDTPGHTDFSGEVISAMDVIDGCIIVIDGTKGVQAQTRH-LNAALP 119



 Score = 34.7 bits (76), Expect = 2.6
 Identities = 13/26 (50%), Positives = 21/26 (80%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKA 186
           +IRN+ +IAH+D GK+TL ++L+  A
Sbjct: 5   DIRNIGIIAHIDAGKTTLAEALIDLA 30


>UniRef50_A0CDU0 Cluster: Chromosome undetermined scaffold_17, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_17,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 646

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 18/39 (46%), Positives = 30/39 (76%), Gaps = 1/39 (2%)
 Frame = +1

Query: 76  DEIRGMMDKKRNI-RNMSVIAHVDHGKSTLTDSLVSKAG 189
           D ++ +  + R+I RN+++IAHVDHGK+TL D+L+  +G
Sbjct: 31  DVLKILHSESRDIFRNVAIIAHVDHGKTTLVDALLRASG 69



 Score = 39.9 bits (89), Expect = 0.070
 Identities = 19/53 (35%), Positives = 27/53 (50%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPS 515
           G  IN++D+PGH DF  EV   + + DG             QT  VL++A+ S
Sbjct: 101 GNKINIVDTPGHQDFGGEVERIMSMVDGVCLLVCATEGPMAQTRFVLQKALQS 153


>UniRef50_Q7S9B4 Cluster: Putative uncharacterized protein
           NCU07021.1; n=2; Sordariales|Rep: Putative
           uncharacterized protein NCU07021.1 - Neurospora crassa
          Length = 790

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 30/86 (34%), Positives = 40/86 (46%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITI+S A++  +  ++        P Q+ KS     INLID+PGH DF  EV   L + D
Sbjct: 45  ITIQSAAVTFLWPPQQS-----LAPGQQPKS-----INLIDTPGHQDFRYEVDRCLPILD 94

Query: 438 GALXXXXXXXXXXXQTETVLRQAMPS 515
           GA+            TE V   A  S
Sbjct: 95  GAVCILDAVKGVETHTERVWESAQLS 120


>UniRef50_Q6CGB0 Cluster: Yarrowia lipolytica chromosome A of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome A of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 950

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 23/78 (29%), Positives = 35/78 (44%)
 Frame = +3

Query: 342 EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSAS 521
           +   K   +  +D+PGHV+F  EV  AL +T+GAL            T+  +R A   ++
Sbjct: 212 DSKHKSHAMTFLDTPGHVNFYDEVICALSITEGALLVVDVVEGPLAGTKEAIRNAFRHSN 271

Query: 522 SLFCS*TKWTVLFLSSNL 575
           +L     K   L L   L
Sbjct: 272 TLTLCINKLDRLILDLRL 289



 Score = 37.9 bits (84), Expect = 0.28
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 6/79 (7%)
 Frame = +1

Query: 91  MMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGE-----TRFTDTRKDEQDR 255
           MM +   IRN+S++ ++ HGK+ L D L+     +    +G      +R+TDT   E +R
Sbjct: 138 MMSQTEYIRNVSIVGNLHHGKTALCDMLIEATHKLTDEHSGHINGHVSRYTDTAAVEIER 197

Query: 256 ASPLNLRP-SLCSSSLKRK 309
                  P S+  +  K K
Sbjct: 198 GVSTKTNPLSMLLADSKHK 216


>UniRef50_Q0V3J4 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 584

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 22/59 (37%), Positives = 32/59 (54%)
 Frame = +1

Query: 115 RNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCS 291
           RN  ++AHVDHGKSTL+D L+   G I     G  +  D    E++R   + ++   CS
Sbjct: 65  RNFCIVAHVDHGKSTLSDRLLELTGTI--QPGGNKQILDRLDVERERG--ITVKAQTCS 119



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 14/29 (48%), Positives = 22/29 (75%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +L++L+D+PGHVDF +EV+ +     GAL
Sbjct: 129 YLLHLVDTPGHVDFRAEVSRSYASCGGAL 157


>UniRef50_Q8TV36 Cluster: Translation initiation factor 2, GTPase;
           n=1; Methanopyrus kandleri|Rep: Translation initiation
           factor 2, GTPase - Methanopyrus kandleri
          Length = 744

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           KG  I  ID+PGH DF  EV  AL V+DG +           +TE ++ +A
Sbjct: 52  KGVEIRFIDTPGHSDFREEVGKALLVSDGLVLVVAADDGVQARTEVIIEEA 102


>UniRef50_Q02652 Cluster: Tetracycline resistance protein tetM; n=3;
           Streptomyces|Rep: Tetracycline resistance protein tetM -
           Streptomyces lividans
          Length = 639

 Score = 41.1 bits (92), Expect = 0.030
 Identities = 19/45 (42%), Positives = 26/45 (57%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           +NLID+PGH DF +EV  AL V DGA+           +T  ++R
Sbjct: 70  VNLIDTPGHSDFVAEVERALEVLDGAVLLLSAVEGVQARTRVLMR 114



 Score = 33.1 bits (72), Expect = 8.0
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGII---AGARAGETRFTD 231
           N+ ++AHVD GK++LT+ L+   G +       AG+TR  D
Sbjct: 5   NIGILAHVDAGKTSLTERLLFDHGAVDRLGSVDAGDTRTVD 45


>UniRef50_Q3ZYA7 Cluster: Translation elongation factor G; n=4;
           Bacteria|Rep: Translation elongation factor G -
           Dehalococcoides sp. (strain CBDB1)
          Length = 686

 Score = 40.7 bits (91), Expect = 0.040
 Identities = 17/31 (54%), Positives = 23/31 (74%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K F IN +D+PG+ DF+ EV AALRV + A+
Sbjct: 75  KDFKINAVDTPGYADFAGEVLAALRVCEAAI 105



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAG-ARAGE-TRFTDTRKDEQDRASPLNLRP 279
           IRN+++++H   GK++L+++++  AGI+    R  E T  +D   DE  +   +NL P
Sbjct: 12  IRNVALLSHSGAGKTSLSEAMLYSAGILGRMGRVDEGTTASDYDPDEVKKKISINLTP 69


>UniRef50_Q8I335 Cluster: GTP-binding protein, putative; n=1;
           Plasmodium falciparum 3D7|Rep: GTP-binding protein,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 1085

 Score = 40.7 bits (91), Expect = 0.040
 Identities = 21/69 (30%), Positives = 36/69 (52%)
 Frame = +1

Query: 70  TVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQ 249
           T+  ++    K++ IRN  ++AH+D GKSTL D  +     I   R  E +F D    E+
Sbjct: 220 TIGHLKSEKCKEKYIRNFCILAHIDSGKSTLADRFLELTNTIKKKRMQE-QFLDMMCLER 278

Query: 250 DRASPLNLR 276
           ++   + L+
Sbjct: 279 EKGITIKLK 287



 Score = 37.5 bits (83), Expect = 0.37
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           ++ NLID+PGH DF  EV  +L V +GA+
Sbjct: 296 YVFNLIDTPGHFDFYHEVKRSLNVCEGAI 324


>UniRef50_Q4UIN6 Cluster: GTP-binding protein, LepA subfamily,
           putative; n=2; Theileria|Rep: GTP-binding protein, LepA
           subfamily, putative - Theileria annulata
          Length = 730

 Score = 40.7 bits (91), Expect = 0.040
 Identities = 21/55 (38%), Positives = 31/55 (56%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLR 276
           IRN  +IAHVDHGKSTL D  +     +   R  E ++ D  + E++R   + L+
Sbjct: 108 IRNFCIIAHVDHGKSTLADRFLEFTKSVPPERLKE-QYLDNMELERERGITIKLQ 161



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           K + +NLID+PGH+DF+ E   ++   +GA+           QT T    A+
Sbjct: 174 KTYTLNLIDTPGHIDFNHEARRSISACEGAILVVDGTKGIEAQTVTTANIAI 225


>UniRef50_Q81NX9 Cluster: GTP-binding elongation factor protein,
           TetM/TetO family; n=9; Bacillus cereus group|Rep:
           GTP-binding elongation factor protein, TetM/TetO family
           - Bacillus anthracis
          Length = 647

 Score = 40.3 bits (90), Expect = 0.053
 Identities = 17/45 (37%), Positives = 27/45 (60%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           +N+ID+PGH DF +EV  + RV DGA+           QT+ +++
Sbjct: 70  VNVIDTPGHADFIAEVERSFRVLDGAILVISAVEGVQAQTKILMQ 114



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 16/58 (27%), Positives = 33/58 (56%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCS 291
           N+ ++AHVD GK++LT+ ++ +  +I      ++  T T   E +R   + ++ S+ S
Sbjct: 5   NIEIVAHVDAGKTSLTERILYETNVIKEVGRVDSGSTQTDSMELERQRGITIKASVVS 62


>UniRef50_A7PJC5 Cluster: Chromosome chr12 scaffold_18, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr12 scaffold_18, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 669

 Score = 40.3 bits (90), Expect = 0.053
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           +D  R +RN++VIAHVDHGK+TL D L+ + G
Sbjct: 59  LDPNR-LRNVAVIAHVDHGKTTLMDRLLRQCG 89



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +N++D+PGH DF  EV   + + +GA+           QT+ VL +A+
Sbjct: 125 LNMVDTPGHADFGGEVERVVGMVEGAVLVVDAGEGPLAQTKFVLAKAL 172


>UniRef50_A5AF37 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 618

 Score = 40.3 bits (90), Expect = 0.053
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           +D  R +RN++VIAHVDHGK+TL D L+ + G
Sbjct: 59  LDPNR-LRNVAVIAHVDHGKTTLMDRLLRQCG 89



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +N++D+PGH DF  EV   + + +GA+           QT+ VL +A+
Sbjct: 125 LNMVDTPGHADFGGEVERVVGMVEGAVLVVDAGEGPLAQTKFVLAKAL 172


>UniRef50_A3LU88 Cluster: ATP dependent RNA helicase and U5 mRNA
           splicing factor; n=4; Saccharomycetaceae|Rep: ATP
           dependent RNA helicase and U5 mRNA splicing factor -
           Pichia stipitis (Yeast)
          Length = 978

 Score = 40.3 bits (90), Expect = 0.053
 Identities = 24/90 (26%), Positives = 39/90 (43%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           E +  +L +NK+DR            YQ    IVE+VN  ++             V P +
Sbjct: 262 ENVPIVLMLNKIDRLILELKLPVRDCYQKLNYIVEDVNQRLSQNEFIANYTHSTTVSPVE 321

Query: 692 GSVGFGSGLHGWAFTLKQFSEMYATNSRLT 781
            +V F S    + F+L  F+++Y   S +T
Sbjct: 322 NNVIFASSTFEFTFSLISFADLYLRKSGIT 351



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = +3

Query: 339 REKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           ++   +  + N++D+PGH DF  E  AA+   DG +
Sbjct: 204 QDLKNRSAIFNILDTPGHADFEDETIAAIAAVDGII 239


>UniRef50_A7ARF7 Cluster: GTP binding protein, putative; n=1;
           Babesia bovis|Rep: GTP binding protein, putative -
           Babesia bovis
          Length = 627

 Score = 39.9 bits (89), Expect = 0.070
 Identities = 16/26 (61%), Positives = 22/26 (84%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAG 189
           IRN++V+AHVDHGK+TL D L+  +G
Sbjct: 30  IRNIAVVAHVDHGKTTLVDGLLRCSG 55



 Score = 39.5 bits (88), Expect = 0.092
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +3

Query: 294 ELE-EKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXX 470
           ELE E+ +   +   + E S K F  N++D+PGH DF  EV   L + D           
Sbjct: 68  ELEKERGITICSKVTRVEWSGKTF--NIVDTPGHADFGGEVERILNIVDCVCLLVDVVEG 125

Query: 471 XXXQTETVLRQAM 509
              QT  VLR+A+
Sbjct: 126 PKPQTTFVLRKAL 138


>UniRef50_Q97KR3 Cluster: Tetracycline resistance protein tetP,
           contain GTP-ase domain; n=11; Firmicutes|Rep:
           Tetracycline resistance protein tetP, contain GTP-ase
           domain - Clostridium acetobutylicum
          Length = 644

 Score = 39.5 bits (88), Expect = 0.092
 Identities = 22/68 (32%), Positives = 32/68 (47%)
 Frame = +3

Query: 297 LEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXX 476
           L EK+       +Q     KG    L+D+PGH+DFS E+  A+ + D A+          
Sbjct: 46  LVEKERGITVFSEQAIFEFKGSTYFLVDTPGHIDFSPEMERAIEIMDYAVLIISGVDGVQ 105

Query: 477 XQTETVLR 500
            QTE + R
Sbjct: 106 SQTENIWR 113


>UniRef50_Q8UFQ0 Cluster: Tetracycline resistance protein, tetM/tetO
           subfamily; n=2; Rhizobium/Agrobacterium group|Rep:
           Tetracycline resistance protein, tetM/tetO subfamily -
           Agrobacterium tumefaciens (strain C58 / ATCC 33970)
          Length = 649

 Score = 39.5 bits (88), Expect = 0.092
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSLCSSS 297
           N+ ++AHVD GK++LT+ L+   G+I    + +T  T T   E +R   + +R ++ S +
Sbjct: 5   NLGILAHVDAGKTSLTERLLFDVGVIDKLGSVDTGNTQTDSLELERQRGITIRAAVVSFT 64

Query: 298 L 300
           +
Sbjct: 65  I 65



 Score = 36.7 bits (81), Expect = 0.65
 Identities = 17/46 (36%), Positives = 25/46 (54%)
 Frame = +3

Query: 363 LINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           ++NLID+PGH DF +EV   L + D A+           QT  ++R
Sbjct: 69  VVNLIDTPGHPDFIAEVERVLGLLDAAVVVVSAVEGVQAQTRVLVR 114


>UniRef50_Q0RNV6 Cluster: Elongation factor G; n=1; Frankia alni
           ACN14a|Rep: Elongation factor G - Frankia alni (strain
           ACN14a)
          Length = 737

 Score = 39.5 bits (88), Expect = 0.092
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +3

Query: 348 SEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           S +G  +NL+D+PG+ DF  E+ A LR  D AL
Sbjct: 58  SHRGLTVNLLDTPGYPDFVGELRAGLRAADAAL 90


>UniRef50_Q46306 Cluster: Tetracycline resistance protein tetP
           (TetB(P)); n=4; Clostridium|Rep: Tetracycline resistance
           protein tetP (TetB(P)) - Clostridium perfringens
          Length = 652

 Score = 39.5 bits (88), Expect = 0.092
 Identities = 16/27 (59%), Positives = 21/27 (77%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGAL 446
           +N+ID+PGHVDF SEV  +L   DGA+
Sbjct: 71  VNIIDTPGHVDFISEVERSLNSLDGAI 97



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 19/62 (30%), Positives = 34/62 (54%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSL 285
           + I N+ ++AHVD GK+T+T++L+  +G I      +   T T   E +R   + ++ S 
Sbjct: 2   KKIINIGIVAHVDAGKTTITENLLYYSGAIKSVGRVDLGNTQTDSMELERKRGITIKSST 61

Query: 286 CS 291
            S
Sbjct: 62  IS 63


>UniRef50_Q2S3F5 Cluster: Elongation factor G; n=1; Salinibacter
           ruber DSM 13855|Rep: Elongation factor G - Salinibacter
           ruber (strain DSM 13855)
          Length = 707

 Score = 39.1 bits (87), Expect = 0.12
 Identities = 16/27 (59%), Positives = 23/27 (85%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGAL 446
           IN++D+PG+ DF+SEV A++RV D AL
Sbjct: 76  INILDTPGYPDFASEVIASMRVADTAL 102


>UniRef50_A5ZXF5 Cluster: Putative uncharacterized protein; n=2;
           Clostridiales|Rep: Putative uncharacterized protein -
           Ruminococcus obeum ATCC 29174
          Length = 926

 Score = 39.1 bits (87), Expect = 0.12
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = +3

Query: 291 FELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXX 470
           +ELE++  + I +     K+E    + L+D+PGHVDFS+E+   L+V D A+        
Sbjct: 46  YELEKERGITIFSKQALLKTEN-MEVTLLDTPGHVDFSAEMERTLQVLDYAILVINGMDG 104

Query: 471 XXXQTETVLR 500
               T T+ R
Sbjct: 105 VQSHTMTLWR 114


>UniRef50_Q5FLA9 Cluster: Peptide chain release factor 3; n=66;
           Bacteria|Rep: Peptide chain release factor 3 -
           Lactobacillus acidophilus
          Length = 523

 Score = 39.1 bits (87), Expect = 0.12
 Identities = 22/75 (29%), Positives = 37/75 (49%)
 Frame = +3

Query: 276 AISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXX 455
           A S + E+E+K  + +T+    +   KG  IN++D+PGH DFS +    L   D A+   
Sbjct: 54  ATSDWMEIEKKRGISVTS-SVMQFEYKGKRINILDTPGHQDFSEDTYRTLMAVDSAVMVI 112

Query: 456 XXXXXXXXQTETVLR 500
                   QT+ + +
Sbjct: 113 DSAKGIEPQTKKLFK 127


>UniRef50_Q8G811 Cluster: Putative uncharacterized protein; n=2;
           Bifidobacterium longum|Rep: Putative uncharacterized
           protein - Bifidobacterium longum
          Length = 751

 Score = 38.7 bits (86), Expect = 0.16
 Identities = 18/45 (40%), Positives = 25/45 (55%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           + L+D+PGHVDF++E    LRV D A+            TET+ R
Sbjct: 70  LTLLDTPGHVDFAAETERVLRVLDYAILVVSGTDGVQGHTETLWR 114


>UniRef50_Q0S473 Cluster: Elongation factor EF2; n=1; Rhodococcus
           sp. RHA1|Rep: Elongation factor EF2 - Rhodococcus sp.
           (strain RHA1)
          Length = 680

 Score = 38.7 bits (86), Expect = 0.16
 Identities = 19/56 (33%), Positives = 35/56 (62%), Gaps = 2/56 (3%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFT--DTRKDEQDRASPLNL 273
           IRN++++ H  +GK+TL ++++ +AG++      E+  T  DT+ +E DR   L L
Sbjct: 13  IRNIALMGHQGNGKTTLAEAMLFRAGVVTRPGRVESGNTVLDTQPEEHDRTQSLAL 68



 Score = 33.5 bits (73), Expect = 6.1
 Identities = 14/29 (48%), Positives = 19/29 (65%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + INL+D PG+ DF  +   ALRV D A+
Sbjct: 78  YRINLLDPPGYADFIGDAMTALRVADVAV 106


>UniRef50_A5V1W8 Cluster: Translation elongation factor G; n=4;
           Chloroflexaceae|Rep: Translation elongation factor G -
           Roseiflexus sp. RS-1
          Length = 701

 Score = 38.7 bits (86), Expect = 0.16
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           INLID PG+ D   E+ AA+RV DGA+            TE V   A
Sbjct: 76  INLIDVPGYADLVGEMAAAMRVVDGAIIVVDAAGGVEVGTELVWEMA 122


>UniRef50_UPI000023CBB6 Cluster: hypothetical protein FG05083.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG05083.1 - Gibberella zeae PH-1
          Length = 786

 Score = 38.3 bits (85), Expect = 0.21
 Identities = 28/79 (35%), Positives = 37/79 (46%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITI+S AI+  + L +        P +  K+     INLID+PGH DF  EV   L + D
Sbjct: 64  ITIQSAAITFNWPLHQS-----LAPGEHAKT-----INLIDTPGHQDFRFEVDRCLPILD 113

Query: 438 GALXXXXXXXXXXXQTETV 494
           GA+            TE V
Sbjct: 114 GAVCIIDSVKGVEAHTERV 132


>UniRef50_A4E859 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 667

 Score = 38.3 bits (85), Expect = 0.21
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           + L+D+PGHVDFS+E    LR  D A+            TET+ R
Sbjct: 71  VMLVDAPGHVDFSAEAERTLRALDYAILVVGANDGVQGHTETLWR 115


>UniRef50_A0UWB2 Cluster: Small GTP-binding protein; n=14;
           Bacteria|Rep: Small GTP-binding protein - Clostridium
           cellulolyticum H10
          Length = 918

 Score = 38.3 bits (85), Expect = 0.21
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           G  I L+D+PGH+DFS+E+   L+V D A+            T+T+ R
Sbjct: 105 GINITLLDTPGHIDFSAEMERTLQVLDYAVLVISGADGVQGHTKTLWR 152


>UniRef50_A7AQ93 Cluster: GTP-binding protein LepA family protein;
           n=1; Babesia bovis|Rep: GTP-binding protein LepA family
           protein - Babesia bovis
          Length = 705

 Score = 38.3 bits (85), Expect = 0.21
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSL 285
           +RN  +IAHVDHGKSTL D  +     +      + ++ D  + E++R   + L+ +L
Sbjct: 107 MRNFCIIAHVDHGKSTLADRFLELTKAVEPHEI-QGQYLDNMELERERGITIKLQSAL 163



 Score = 37.1 bits (82), Expect = 0.49
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +3

Query: 345 KSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAMPSASS 524
           K  + + +NLID+PGH+DF+ E   ++   +GA+           QT T    A+ +   
Sbjct: 170 KDGQVYSLNLIDTPGHIDFNHEARRSIAACEGAILVVDGTKGIQAQTVTTSMIAIEAGLK 229

Query: 525 L 527
           L
Sbjct: 230 L 230


>UniRef50_A4RKP1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 856

 Score = 38.3 bits (85), Expect = 0.21
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           INLID+PGH DF  EV   + V DGA+            TE V + A
Sbjct: 129 INLIDTPGHQDFRFEVDRCMPVIDGAVCIMDGVKGVEAHTERVWQSA 175


>UniRef50_A6BAW2 Cluster: BipA protein; n=1; Vibrio parahaemolyticus
           AQ3810|Rep: BipA protein - Vibrio parahaemolyticus
           AQ3810
          Length = 374

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 22/81 (27%), Positives = 38/81 (46%)
 Frame = +3

Query: 264 IKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGA 443
           +++T +S+F    +  L  I   D+   +   + IN++D+PGH DF  EV   + + D  
Sbjct: 118 LRATHVSLF----DGSLQGIHRTDKPAFNWNDYRINIVDTPGHADFGGEVERIMSMVDSV 173

Query: 444 LXXXXXXXXXXXQTETVLRQA 506
           L           QT  V ++A
Sbjct: 174 LLIVDAVDGPMPQTRFVTQKA 194


>UniRef50_A5K6I6 Cluster: GTP-binding protein, putative; n=2;
           cellular organisms|Rep: GTP-binding protein, putative -
           Plasmodium vivax
          Length = 910

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + ++ NLID+PGH DF  EV  +L V +GA+
Sbjct: 251 QNYIFNLIDTPGHFDFYHEVKRSLSVCEGAI 281



 Score = 37.5 bits (83), Expect = 0.37
 Identities = 17/58 (29%), Positives = 32/58 (55%)
 Frame = +1

Query: 103 KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLR 276
           ++N+RN  ++AH+D GKSTL D  +     I   +  + +F D    E+++   + L+
Sbjct: 188 QQNVRNFCILAHIDSGKSTLADRFLELTKTIKKKKM-QDQFLDMMSLEREKGITIKLK 244


>UniRef50_A0CSQ6 Cluster: Chromosome undetermined scaffold_26, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_26,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 150

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 15/29 (51%), Positives = 22/29 (75%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +L NLID+PGHVDF+ EV+  +   +GA+
Sbjct: 87  YLYNLIDTPGHVDFTYEVSRQMGACEGAI 115


>UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS
           (Tet(S)); n=345; root|Rep: Tetracycline resistance
           protein tetS (Tet(S)) - Listeria monocytogenes
          Length = 641

 Score = 37.9 bits (84), Expect = 0.28
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 2/50 (4%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGII--AGARAGETRFTDTRKDEQDR 255
           I N+ ++AHVD GK+TLT+SL+  +G I   G+    T  TDT   E+ R
Sbjct: 3   IINIGILAHVDAGKTTLTESLLYSSGAIKELGSVDSGTTKTDTMFLERQR 52



 Score = 37.1 bits (82), Expect = 0.49
 Identities = 13/27 (48%), Positives = 22/27 (81%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGAL 446
           +N++D+PGH+DF ++V  +L V DGA+
Sbjct: 70  VNIVDTPGHMDFLADVYRSLSVLDGAI 96


>UniRef50_Q9RXC2 Cluster: Elongation factor G; n=2; Deinococcus|Rep:
           Elongation factor G - Deinococcus radiodurans
          Length = 678

 Score = 37.5 bits (83), Expect = 0.37
 Identities = 28/73 (38%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 231 HA*GR-TRPCITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSS 407
           HA G  +RP      TA S F + E++    I     R  SE G  I L+D+PG+ DF  
Sbjct: 34  HASGAISRPGRVEDGTARSDFTDAEKEHGFSIQTAVLRLCSE-GVDITLLDTPGYADFVR 92

Query: 408 EVTAALRVTDGAL 446
           E+  A+R  D AL
Sbjct: 93  EIRGAVRAADAAL 105


>UniRef50_A6GK83 Cluster: Translation initiation factor IF-2; n=1;
           Plesiocystis pacifica SIR-1|Rep: Translation initiation
           factor IF-2 - Plesiocystis pacifica SIR-1
          Length = 936

 Score = 37.5 bits (83), Expect = 0.37
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 2/56 (3%)
 Frame = +1

Query: 61  VNFTVDEIRGMMDKKRNIRN--MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           V+F  DEI    D +  +R   ++++ HVDHGK+TL D  + KA +  G   G T+
Sbjct: 419 VSFQEDEILASYDDEGELRAPVVTIMGHVDHGKTTLLD-YIRKAKVADGEAGGITQ 473


>UniRef50_Q4Y0B9 Cluster: TetQ family GTPase, putative; n=5;
           Plasmodium (Vinckeia)|Rep: TetQ family GTPase, putative
           - Plasmodium chabaudi
          Length = 980

 Score = 37.5 bits (83), Expect = 0.37
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           +NLID+PGH+DFS+E   +L V+D  +           QT  + R
Sbjct: 91  VNLIDTPGHIDFSNETFLSLCVSDKCVIVIDAKEGLQIQTLNIFR 135


>UniRef50_Q8F2N6 Cluster: Peptide chain release factor 3; n=8;
           Bacteria|Rep: Peptide chain release factor 3 -
           Leptospira interrogans
          Length = 590

 Score = 37.1 bits (82), Expect = 0.49
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = +1

Query: 52  SKMVNFTVDEI--RGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           SK V+ TV++   R + ++ R  R  ++IAH D GK+TLT+ L+   G I  A A + R
Sbjct: 53  SKTVSDTVEQKSNRTIEEETRRRRTFAIIAHPDAGKTTLTEKLLLYGGAIQLAGAVKAR 111



 Score = 36.3 bits (80), Expect = 0.86
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = +3

Query: 267 KSTAISMFFELEEKDLVFITNPD-QREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGA 443
           +  A S + E+E++  + IT+   Q E S  G ++NL+D+PGH DFS +    L   D A
Sbjct: 114 RKAATSDWMEMEKEKGISITSAALQFEYS--GHVLNLLDTPGHEDFSEDTYRTLIAADTA 171

Query: 444 L 446
           +
Sbjct: 172 V 172


>UniRef50_Q4AGI8 Cluster: Elongation factor G, C-terminal:Protein
           synthesis factor, GTP- binding:Elongation factor Tu,
           domain 2:Elongation factor G, domain IV; n=1; Chlorobium
           phaeobacteroides BS1|Rep: Elongation factor G,
           C-terminal:Protein synthesis factor, GTP-
           binding:Elongation factor Tu, domain 2:Elongation factor
           G, domain IV - Chlorobium phaeobacteroides BS1
          Length = 584

 Score = 37.1 bits (82), Expect = 0.49
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = +3

Query: 369 NLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETV 494
           ++ID+PGHVDFS+EV  +LR  D A+            +ET+
Sbjct: 3   HIIDTPGHVDFSAEVERSLRALDCAILVLSAVEGVQAHSETL 44


>UniRef50_A7CTC1 Cluster: Peptide chain release factor 3; n=2;
           Bacteria|Rep: Peptide chain release factor 3 -
           Opitutaceae bacterium TAV2
          Length = 544

 Score = 37.1 bits (82), Expect = 0.49
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +G+ +NL+D+PGH DFS +    L   D AL
Sbjct: 77  QGYAVNLLDTPGHKDFSEDTYRVLTAVDAAL 107


>UniRef50_A6LU84 Cluster: Small GTP-binding protein; n=1;
           Clostridium beijerinckii NCIMB 8052|Rep: Small
           GTP-binding protein - Clostridium beijerinckii NCIMB
           8052
          Length = 678

 Score = 37.1 bits (82), Expect = 0.49
 Identities = 20/64 (31%), Positives = 30/64 (46%)
 Frame = +3

Query: 303 EKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQ 482
           EK+       DQ      G    LID+PGH+DFS+E+  ++ + D A+            
Sbjct: 48  EKERGITVFSDQGTFELNGSTYYLIDTPGHIDFSTEMERSIEIMDYAIIIISGVEGVQGH 107

Query: 483 TETV 494
           T+TV
Sbjct: 108 TKTV 111


>UniRef50_A5Z9F8 Cluster: Putative uncharacterized protein; n=1;
           Eubacterium ventriosum ATCC 27560|Rep: Putative
           uncharacterized protein - Eubacterium ventriosum ATCC
           27560
          Length = 535

 Score = 37.1 bits (82), Expect = 0.49
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +3

Query: 276 AISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           A+S +  +E++  + +T+   +   E G+ IN++D+PGH DFS +    L   D A+
Sbjct: 58  AVSDWMGIEKERGISVTSSALQFNYE-GYCINILDTPGHQDFSEDTYRTLMAADSAV 113


>UniRef50_A1SQK9 Cluster: Small GTP-binding protein; n=2;
           Actinomycetales|Rep: Small GTP-binding protein -
           Nocardioides sp. (strain BAA-499 / JS614)
          Length = 701

 Score = 37.1 bits (82), Expect = 0.49
 Identities = 16/31 (51%), Positives = 21/31 (67%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +G  +NLID+PG+ DF  E+ A LR  D AL
Sbjct: 87  EGVKVNLIDTPGYADFVGELRAGLRAADCAL 117


>UniRef50_Q8I568 Cluster: TetQ family GTPase, putative; n=1;
           Plasmodium falciparum 3D7|Rep: TetQ family GTPase,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 1161

 Score = 37.1 bits (82), Expect = 0.49
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLR 500
           +NLID+PGH+DFS+E   +L V D  +           QT  + R
Sbjct: 91  VNLIDTPGHIDFSNETFISLCVLDKCIIVIDSKEGVQIQTINIFR 135


>UniRef50_Q5DC59 Cluster: SJCHGC08038 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08038 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 155

 Score = 37.1 bits (82), Expect = 0.49
 Identities = 16/30 (53%), Positives = 22/30 (73%)
 Frame = +3

Query: 348 SEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           S +  +INL+D+PGHVDF+ EV  +L V D
Sbjct: 117 SWRSHVINLLDTPGHVDFTFEVERSLTVLD 146


>UniRef50_Q381P2 Cluster: U5 small nuclear ribonucleoprotein
           component, putative; n=3; Trypanosoma|Rep: U5 small
           nuclear ribonucleoprotein component, putative -
           Trypanosoma brucei
          Length = 974

 Score = 37.1 bits (82), Expect = 0.49
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +3

Query: 363 LINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           L+  +D+PGH DF++E  AALR+ D  L               +LRQ +
Sbjct: 220 LMTFVDTPGHPDFAAETAAALRLADAVLFCVDAAESLTSNGARLLRQVV 268


>UniRef50_Q19072 Cluster: Elongation factor Tu homologue precursor
           (Tu elongation factor (Ef- tu), mitochondrial protein
           1); n=7; Nematoda|Rep: Elongation factor Tu homologue
           precursor (Tu elongation factor (Ef- tu), mitochondrial
           protein 1) - Caenorhabditis elegans
          Length = 496

 Score = 36.7 bits (81), Expect = 0.65
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLN 270
           N+  I HVDHGK+TLT ++        GA+  +    D   +E+ R   +N
Sbjct: 52  NVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITIN 102


>UniRef50_A5K8L7 Cluster: TetQ family GTPase, putative; n=1;
           Plasmodium vivax|Rep: TetQ family GTPase, putative -
           Plasmodium vivax
          Length = 1101

 Score = 36.7 bits (81), Expect = 0.65
 Identities = 15/24 (62%), Positives = 20/24 (83%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTD 437
           +NLID+PGHVDFS+E   +L V+D
Sbjct: 92  VNLIDTPGHVDFSNETFLSLCVSD 115


>UniRef50_Q9PGX4 Cluster: Peptide chain release factor 3; n=302;
           cellular organisms|Rep: Peptide chain release factor 3 -
           Xylella fastidiosa
          Length = 534

 Score = 36.7 bits (81), Expect = 0.65
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = +3

Query: 276 AISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           A S +  LE++  + +T+   +   E G +INL+D+PGH DF  +    L   D AL
Sbjct: 53  ATSDWMTLEKERGISVTSSVMQFPYE-GKIINLLDTPGHADFGEDTYRVLTAVDSAL 108


>UniRef50_O07170 Cluster: Elongation factor G-like protein; n=24;
           Actinomycetales|Rep: Elongation factor G-like protein -
           Mycobacterium tuberculosis
          Length = 714

 Score = 36.7 bits (81), Expect = 0.65
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           G  +NL+D+PG+ DF  E+ A LR  D AL
Sbjct: 87  GIKVNLVDTPGYADFVGELRAGLRAADCAL 116


>UniRef50_Q2AH04 Cluster: Translation elongation factor G:Small
           GTP-binding protein domain; n=2; Bacteria|Rep:
           Translation elongation factor G:Small GTP-binding
           protein domain - Halothermothrix orenii H 168
          Length = 688

 Score = 36.3 bits (80), Expect = 0.86
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           G  IN +D+PG+ DF  EV++AL++ D A+
Sbjct: 73  GNQINWVDTPGYADFRGEVSSALKIVDAAV 102


>UniRef50_Q1NNQ3 Cluster: Small GTP-binding protein domain; n=4;
           Bacteria|Rep: Small GTP-binding protein domain - delta
           proteobacterium MLMS-1
          Length = 702

 Score = 36.3 bits (80), Expect = 0.86
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + F IN+ID+PG  DF  EV +ALRV D A+
Sbjct: 72  RDFKINIIDTPGLDDFVGEVISALRVADTAV 102


>UniRef50_Q18CA6 Cluster: Putative translation elongation factor;
           n=1; Clostridium difficile 630|Rep: Putative translation
           elongation factor - Clostridium difficile (strain 630)
          Length = 646

 Score = 36.3 bits (80), Expect = 0.86
 Identities = 13/29 (44%), Positives = 22/29 (75%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +  NL+D+PG+ DFS +V ++LR +D A+
Sbjct: 65  YKFNLLDTPGYFDFSGDVVSSLRASDAAI 93


>UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkaliphilus metalliredigens QYMF|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkaliphilus metalliredigens QYMF
          Length = 615

 Score = 36.3 bits (80), Expect = 0.86
 Identities = 16/58 (27%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +1

Query: 58  MVNFTVDEIR-GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFT 228
           M+N  +DE +  +++ +++  N+ ++ HVDHGKST+   L++  G +   +  + + T
Sbjct: 1   MMNNNLDENQLSVIESQQSNMNIVIVGHVDHGKSTIIGRLLADTGSLPEGKLEQVKET 58


>UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9;
           Aconoidasida|Rep: Elongation factor tu, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 505

 Score = 36.3 bits (80), Expect = 0.86
 Identities = 18/61 (29%), Positives = 29/61 (47%)
 Frame = +1

Query: 88  GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPL 267
           G+ ++K+   N+  I HVDHGK+TLT ++      +           D   +EQ R   +
Sbjct: 113 GIFERKKPHMNIGTIGHVDHGKTTLTAAITKVCSDLNRGVFKSYEEIDKTPEEQKRGITI 172

Query: 268 N 270
           N
Sbjct: 173 N 173


>UniRef50_P70882 Cluster: Tetracycline resistance protein tetQ
           (Tet(Q)) (TetA(Q)3); n=17; Bacteria|Rep: Tetracycline
           resistance protein tetQ (Tet(Q)) (TetA(Q)3) -
           Bacteroides fragilis
          Length = 641

 Score = 36.3 bits (80), Expect = 0.86
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           G   N+ID+PGH+DF +EV    ++ DGA+
Sbjct: 67  GVKCNIIDTPGHMDFIAEVERTFKMLDGAV 96



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQD 252
           NI N+ ++AH+D GK+++T++L+  +G  A  + G     DT  D  D
Sbjct: 2   NIINLGILAHIDAGKTSVTENLLFASG--ATEKCGRVDNGDTITDSMD 47


>UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-like;
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           statin-like - Canis familiaris
          Length = 667

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = +1

Query: 88  GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           G M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 279 GSMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 312


>UniRef50_A0L3V8 Cluster: Translation elongation factor G; n=1;
           Magnetococcus sp. MC-1|Rep: Translation elongation
           factor G - Magnetococcus sp. (strain MC-1)
          Length = 707

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           KG  IN+ID+PG++DF     A L V  GA+
Sbjct: 89  KGVEINIIDTPGYIDFIEHTRAVLNVVGGAV 119



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 67  FTVDEIRGMMDKK-RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKD 243
           F  +  +GM + +   IRN++++AH   G +TL ++L   AG+I      E + T  R +
Sbjct: 10  FDAEGEKGMTESQITRIRNVALMAHGGGGATTLAETLFYNAGVIPKRGTVEGKNTVLRSE 69

Query: 244 EQDRASPLNLRPSL 285
            ++    L + P +
Sbjct: 70  PEELERGLTIAPQI 83


>UniRef50_A4S2B0 Cluster: Mitochondrial translation initiation
           factor 2; n=2; Ostreococcus|Rep: Mitochondrial
           translation initiation factor 2 - Ostreococcus
           lucimarinus CCE9901
          Length = 683

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           ++V+ HVDHGK+TL DSL  K  + AG   G T+
Sbjct: 166 VAVMGHVDHGKTTLLDSL-RKTSVAAGEAGGITQ 198


>UniRef50_A5K760 Cluster: U5 small nuclear ribonuclear protein,
           putative; n=9; Eukaryota|Rep: U5 small nuclear
           ribonuclear protein, putative - Plasmodium vivax
          Length = 1251

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 19/84 (22%), Positives = 39/84 (46%), Gaps = 3/84 (3%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLV---FITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALR 428
           ++IK+  IS+  + +  + +    + N  +     K +L N++D+PGHV+F  E   A+ 
Sbjct: 287 LSIKAIPISLILQNKMYENISSNILLNKKKNNLKYKSYLFNIVDTPGHVNFFDEFLCAVN 346

Query: 429 VTDGALXXXXXXXXXXXQTETVLR 500
           + +               TE V++
Sbjct: 347 ICECCCLVVDVTDGCMYVTENVIK 370


>UniRef50_A2E2N4 Cluster: Elongation factor G, domain IV family
           protein; n=1; Trichomonas vaginalis G3|Rep: Elongation
           factor G, domain IV family protein - Trichomonas
           vaginalis G3
          Length = 922

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 14/29 (48%), Positives = 19/29 (65%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDG 440
           K + +NLID+PGH DF  +V   L + DG
Sbjct: 196 KSYALNLIDTPGHPDFIGQVECGLDMADG 224


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 812,871,178
Number of Sequences: 1657284
Number of extensions: 16782652
Number of successful extensions: 55724
Number of sequences better than 10.0: 317
Number of HSP's better than 10.0 without gapping: 51608
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55591
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 65850543200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -