SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20050
         (647 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-lik...   172   5e-42
UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397; ro...   172   5e-42
UniRef50_Q5EMT9 Cluster: Elongation factor 1-alpha-like protein;...   166   4e-40
UniRef50_P13905 Cluster: Elongation factor 1-alpha; n=2224; cell...   156   5e-37
UniRef50_UPI0000EB0538 Cluster: UPI0000EB0538 related cluster; n...   143   4e-33
UniRef50_Q96TP0 Cluster: Elongation factor 1 alpha; n=5; Fungi/M...   133   4e-30
UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porph...   130   2e-29
UniRef50_Q2U0M0 Cluster: Translation elongation factor EF-1 alph...   128   1e-28
UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellul...   125   1e-27
UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4; Fungi/M...   121   1e-26
UniRef50_P90922 Cluster: Putative uncharacterized protein; n=3; ...   116   7e-25
UniRef50_A7RM15 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...   115   1e-24
UniRef50_Q9Y450 Cluster: HBS1-like protein; n=43; Euteleostomi|R...   113   5e-24
UniRef50_A6RVA8 Cluster: Putative uncharacterized protein; n=1; ...   108   1e-22
UniRef50_O93729 Cluster: Elongation factor 1-alpha; n=20; Archae...   107   2e-22
UniRef50_Q7YZN7 Cluster: Hsp70 subfamily B suppressor 1; n=3; Di...   106   5e-22
UniRef50_Q4P6P7 Cluster: Putative uncharacterized protein; n=1; ...   105   7e-22
UniRef50_A5X901 Cluster: Elongation factor 1-alpha; n=2; Chilodo...   105   1e-21
UniRef50_P15170 Cluster: G1 to S phase transition protein 1 homo...   105   1e-21
UniRef50_UPI0000D55B6A Cluster: PREDICTED: similar to CG1898-PA;...   104   2e-21
UniRef50_Q5KLM5 Cluster: Putative uncharacterized protein; n=2; ...   104   2e-21
UniRef50_A5JHE1 Cluster: Translation elongation factor EF-1 alph...   103   3e-21
UniRef50_O45622 Cluster: Putative uncharacterized protein; n=2; ...   103   4e-21
UniRef50_A2QW82 Cluster: Contig An11c0160, complete genome; n=8;...   102   6e-21
UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1, sub...   102   6e-21
UniRef50_UPI0000499ED8 Cluster: guanine nucleotide regulatory pr...   101   1e-20
UniRef50_Q8IIC9 Cluster: Translation elongation factor EF-1, sub...   101   2e-20
UniRef50_A6RA16 Cluster: Putative uncharacterized protein; n=1; ...   100   3e-20
UniRef50_Q86NR4 Cluster: RE29053p; n=5; Diptera|Rep: RE29053p - ...    99   5e-20
UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1; Pneum...    99   8e-20
UniRef50_Q759Q2 Cluster: ADR221Cp; n=3; Saccharomycetales|Rep: A...    99   8e-20
UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1; ...    99   1e-19
UniRef50_Q6BVD7 Cluster: Similar to sp|P32769 Saccharomyces cere...    98   2e-19
UniRef50_Q4QGW5 Cluster: Eukaryotic release factor 3, putative; ...    97   2e-19
UniRef50_Q5UHI3 Cluster: EF-1 alpha-like protein; n=6; Eukaryota...    97   3e-19
UniRef50_A4ZCD1 Cluster: GTP-binding protein; n=9; Magnoliophyta...    97   4e-19
UniRef50_A3LY56 Cluster: Predicted protein; n=2; Pichia|Rep: Pre...    97   4e-19
UniRef50_P32769 Cluster: Elongation factor 1 alpha-like protein;...    96   6e-19
UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor...    94   2e-18
UniRef50_Q259E7 Cluster: H0801D08.2 protein; n=5; Oryza sativa|R...    93   4e-18
UniRef50_Q00WU5 Cluster: EF-1 alpha-like protein; n=1; Ostreococ...    93   4e-18
UniRef50_O74774 Cluster: Elongation factor 1 alpha related prote...    93   4e-18
UniRef50_Q9HGI4 Cluster: Eukaryotic peptide chain release factor...    93   4e-18
UniRef50_Q9NCN8 Cluster: Eukaryotic release factor 3 GTPase subu...    93   5e-18
UniRef50_A4R2K6 Cluster: Putative uncharacterized protein; n=1; ...    93   7e-18
UniRef50_O13354 Cluster: Eukaryotic peptide chain release factor...    93   7e-18
UniRef50_A2AX44 Cluster: Translation elongation factor 1 like; n...    92   9e-18
UniRef50_Q2GS47 Cluster: Putative uncharacterized protein; n=1; ...    92   1e-17
UniRef50_Q19AS6 Cluster: Translation elongation factor 1 alpha; ...    91   2e-17
UniRef50_P05453 Cluster: Eukaryotic peptide chain release factor...    91   2e-17
UniRef50_A0E926 Cluster: Chromosome undetermined scaffold_84, wh...    90   4e-17
UniRef50_Q9NCN7 Cluster: Eukaryotic release factor 3 GTPase subu...    90   5e-17
UniRef50_UPI00006CC36B Cluster: Elongation factor Tu C-terminal ...    89   1e-16
UniRef50_Q23TC1 Cluster: Elongation factor Tu C-terminal domain ...    89   1e-16
UniRef50_Q5KFJ4 Cluster: Translation release factor, putative; n...    88   1e-16
UniRef50_Q9NCN5 Cluster: Eukaryotic release factor 3 GTPase subu...    87   3e-16
UniRef50_Q7YZN9 Cluster: Eukaryotic release factor 3; n=2; Dicty...    87   3e-16
UniRef50_A2FN77 Cluster: Elongation factor Tu C-terminal domain ...    86   6e-16
UniRef50_Q9LM39 Cluster: T10O22.4; n=7; Magnoliophyta|Rep: T10O2...    86   8e-16
UniRef50_Q4E4V1 Cluster: Elongation factor 1-alpha (EF-1-alpha),...    85   1e-15
UniRef50_Q8IFW1 Cluster: Elongation factor-1 alpha; n=1; Exoneur...    85   2e-15
UniRef50_Q9NCN6 Cluster: Eukaryotic release factor 3 GTPase subu...    84   3e-15
UniRef50_Q6JIY6 Cluster: Translation elongation factor 1 alpha; ...    83   6e-15
UniRef50_Q6CFF3 Cluster: Similar to tr|Q9WTY5 Mus musculus ERFS;...    83   6e-15
UniRef50_Q46516 Cluster: ORFC 179; n=1; Desulfurococcus mobilis|...    83   6e-15
UniRef50_UPI000150A7E9 Cluster: Elongation factor Tu C-terminal ...    81   2e-14
UniRef50_UPI0000E47BF2 Cluster: PREDICTED: similar to elongation...    81   2e-14
UniRef50_Q4FW53 Cluster: Hsp70 subfamily B suppressor 1; n=3; Le...    81   2e-14
UniRef50_Q96TK8 Cluster: Translation elongation factor 1 alpha; ...    81   2e-14
UniRef50_Q95UT7 Cluster: Elongation factor 1 alpha short form; n...    80   4e-14
UniRef50_Q8SRN3 Cluster: TRANSLATION ELONGATION FACTOR 1-ALPHA; ...    80   4e-14
UniRef50_Q8SS29 Cluster: TRANSLATION ELONGATION FACTOR 1 ALPHA; ...    79   7e-14
UniRef50_A4RWT6 Cluster: Predicted protein; n=2; Ostreococcus|Re...    79   9e-14
UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial pre...    77   5e-13
UniRef50_Q9UVK1 Cluster: SUP35 homolog; n=1; Pichia pastoris|Rep...    76   6e-13
UniRef50_A2WJZ4 Cluster: Putative uncharacterized protein; n=1; ...    75   1e-12
UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9; Ac...    74   3e-12
UniRef50_Q2ABX8 Cluster: Elongation factor 1-alpha; n=1; Megacop...    74   3e-12
UniRef50_Q0EDG4 Cluster: Mitochondrial EF-Tu2; n=1; Trichinella ...    74   3e-12
UniRef50_A4VDD2 Cluster: Elongation factor 1-alpha; n=1; Tetrahy...    73   5e-12
UniRef50_Q89UE2 Cluster: NodQ bifunctional enzyme; n=12; Rhizobi...    73   8e-12
UniRef50_UPI0000499770 Cluster: elongation factor-1alpha; n=1; E...    72   1e-11
UniRef50_Q5BEE6 Cluster: Elongation factor Tu; n=1; Emericella n...    72   1e-11
UniRef50_Q7R087 Cluster: GLP_56_7099_8961; n=2; Giardia intestin...    71   2e-11
UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu), mitochond...    71   2e-11
UniRef50_P56893 Cluster: Sulfate adenylyltransferase subunit 1; ...    70   4e-11
UniRef50_Q74CF6 Cluster: Elongation factor Tu GTP binding domain...    69   7e-11
UniRef50_Q8WT68 Cluster: Elongation factor-1 alpha; n=3; Endopte...    69   1e-10
UniRef50_Q19072 Cluster: Elongation factor Tu homologue precurso...    69   1e-10
UniRef50_UPI0000DD78A4 Cluster: PREDICTED: similar to statin-lik...    69   1e-10
UniRef50_Q97MT1 Cluster: GTPase, sulfate adenylate transferase s...    69   1e-10
UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial pre...    69   1e-10
UniRef50_Q8ZBP2 Cluster: Sulfate adenylyltransferase subunit 1; ...    69   1e-10
UniRef50_A0EFI6 Cluster: Elongation factor Tu; n=3; Paramecium t...    68   2e-10
UniRef50_Q45W23 Cluster: Tuf1; n=1; uncultured Pseudonocardia sp...    68   2e-10
UniRef50_Q24TA2 Cluster: Adenylylsulfate kinase/sulfate adenylyl...    68   2e-10
UniRef50_Q7K3V6 Cluster: Elongation factor Tu; n=7; Coelomata|Re...    68   2e-10
UniRef50_Q0YG57 Cluster: Small GTP-binding protein domain:Sulfat...    67   3e-10
UniRef50_Q5FSE8 Cluster: Sulfate adenylyltransferase subunit 1 /...    67   4e-10
UniRef50_A4LX06 Cluster: Sulfate adenylyltransferase; n=1; Geoba...    67   4e-10
UniRef50_Q8ZMF5 Cluster: Sulfate adenylyltransferase subunit 1; ...    67   4e-10
UniRef50_UPI00006CBD5B Cluster: Elongation factor Tu, mitochondr...    66   5e-10
UniRef50_Q5CWA0 Cluster: HBS1 eRFS. GTpase; n=2; Cryptosporidium...    66   5e-10
UniRef50_Q83JX8 Cluster: Sulfate adenylyltransferase subunit 1; ...    66   5e-10
UniRef50_Q8AAP9 Cluster: Sulfate adenylyltransferase subunit 1; ...    66   5e-10
UniRef50_UPI00006A2885 Cluster: UPI00006A2885 related cluster; n...    66   9e-10
UniRef50_A4XJZ8 Cluster: Sulfate adenylyltransferase, large subu...    66   9e-10
UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large subu...    65   1e-09
UniRef50_A4SYY3 Cluster: Sulfate adenylyltransferase, large subu...    65   1e-09
UniRef50_Q8TYZ3 Cluster: GTPase-translation elongation factor; n...    65   1e-09
UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular org...    65   1e-09
UniRef50_Q7UMW2 Cluster: Bifunctional enzyme cysN/cysC [Includes...    65   1e-09
UniRef50_Q9UVK0 Cluster: SUP35 homolog; n=1; Saccharomycodes lud...    65   2e-09
UniRef50_UPI0000F308E4 Cluster: UPI0000F308E4 related cluster; n...    64   2e-09
UniRef50_A6GJE6 Cluster: Sulfate adenylyltransferase, large subu...    64   3e-09
UniRef50_A1W6V4 Cluster: Sulfate adenylyltransferase, large subu...    64   3e-09
UniRef50_Q10600 Cluster: Bifunctional enzyme cysN/cysC [Includes...    64   3e-09
UniRef50_UPI000050FE96 Cluster: COG2895: GTPases - Sulfate adeny...    64   4e-09
UniRef50_Q08RF5 Cluster: CysN/CysC bifunctional enzyme; n=2; Cys...    64   4e-09
UniRef50_Q9PD78 Cluster: Bifunctional enzyme cysN/cysC [Includes...    64   4e-09
UniRef50_Q82L80 Cluster: Putative sulfate adenylyltransferase la...    63   5e-09
UniRef50_Q39DS0 Cluster: Sulfate adenylyltransferase, large subu...    63   5e-09
UniRef50_Q0A978 Cluster: Sulfate adenylyltransferase, large subu...    63   5e-09
UniRef50_A6GM01 Cluster: Bifunctional sulfate adenylyltransferas...    63   5e-09
UniRef50_Q9RGE9 Cluster: Sulfate adenylyltransferase subunit Cys...    62   9e-09
UniRef50_Q4QDW8 Cluster: Elongation factor TU, putative; n=5; Tr...    62   1e-08
UniRef50_Q0G239 Cluster: Binfunctional sulfate adenylyltransfera...    62   1e-08
UniRef50_Q25820 Cluster: Elongation factor Tu; n=99; cellular or...    61   2e-08
UniRef50_Q9L9U8 Cluster: Putative ATP sulfurylase large subunit;...    61   3e-08
UniRef50_Q0SH95 Cluster: CysN/CysC bifunctional enzyme; n=14; Ac...    61   3e-08
UniRef50_Q7M9D1 Cluster: GTPASE, SULFATE ADENYLATE TRANSFERASE S...    60   5e-08
UniRef50_A0BL72 Cluster: Chromosome undetermined scaffold_113, w...    60   5e-08
UniRef50_P18905 Cluster: Elongation factor Tu; n=2; Coleochaetal...    60   5e-08
UniRef50_Q2S507 Cluster: Sulfate adenylyltransferase, large subu...    60   6e-08
UniRef50_Q4JIN1 Cluster: Selenocysteine-specific translation elo...    59   8e-08
UniRef50_A7H0F4 Cluster: Selenocysteine-specific translation elo...    59   1e-07
UniRef50_A7PCT1 Cluster: Chromosome chr17 scaffold_12, whole gen...    59   1e-07
UniRef50_Q1ITG6 Cluster: Sulfate adenylyltransferase, large subu...    58   1e-07
UniRef50_A0JZN0 Cluster: Sulfate adenylyltransferase, large subu...    58   1e-07
UniRef50_Q8NLX2 Cluster: GTPases-Sulfate adenylate transferase s...    58   2e-07
UniRef50_Q1MPY9 Cluster: Selenocysteine-specific translation elo...    58   2e-07
UniRef50_A3HVR6 Cluster: Sulfate adenylyltransferase subunit 1; ...    56   6e-07
UniRef50_Q46497 Cluster: Selenocysteine-specific elongation fact...    56   1e-06
UniRef50_Q30SC0 Cluster: Translation elongation factor, selenocy...    55   1e-06
UniRef50_Q67QI5 Cluster: Selenocysteine-specific elongation fact...    54   2e-06
UniRef50_A3SGF9 Cluster: Translation elongation factor, selenocy...    54   2e-06
UniRef50_A1HSM1 Cluster: Selenocysteine-specific translation elo...    54   2e-06
UniRef50_Q0ATV7 Cluster: Selenocysteine-specific translation elo...    54   4e-06
UniRef50_A6CK31 Cluster: Selenocysteine-specific translation elo...    54   4e-06
UniRef50_Q57918 Cluster: Selenocysteine-specific elongation fact...    54   4e-06
UniRef50_Q7VI67 Cluster: Selenocysteine-specific elongation fact...    53   5e-06
UniRef50_Q22GX7 Cluster: Elongation factor Tu C-terminal domain ...    53   5e-06
UniRef50_Q8XIK3 Cluster: Selenocysteine-specific elongation fact...    53   7e-06
UniRef50_Q2LU53 Cluster: Selenocysteine-specific protein transla...    53   7e-06
UniRef50_A7QN79 Cluster: Chromosome undetermined scaffold_131, w...    53   7e-06
UniRef50_A7Q762 Cluster: Chromosome chr5 scaffold_58, whole geno...    52   9e-06
UniRef50_Q8TVI5 Cluster: Translation elongation factor, GTPase; ...    52   1e-05
UniRef50_Q74GZ1 Cluster: Selenocysteine-specific translation elo...    51   2e-05
UniRef50_A6DB59 Cluster: Putative selenocysteine-specific elonga...    51   3e-05
UniRef50_A7PSI5 Cluster: Chromosome chr6 scaffold_28, whole geno...    51   3e-05
UniRef50_A0YH51 Cluster: Selenocysteine-specific elongation fact...    50   4e-05
UniRef50_Q931D5 Cluster: SelB selenocysteine-specific elongation...    50   5e-05
UniRef50_Q1ETS8 Cluster: Translation elongation factor, selenocy...    50   5e-05
UniRef50_A6BIM9 Cluster: Putative uncharacterized protein; n=1; ...    50   5e-05
UniRef50_Q73LA2 Cluster: Selenocysteine-specific translation elo...    50   6e-05
UniRef50_Q1AUJ9 Cluster: Selenocysteine-specific translation elo...    49   8e-05
UniRef50_Q47F25 Cluster: Translation elongation factor, selenocy...    49   1e-04
UniRef50_A0LHL0 Cluster: Selenocysteine-specific translation elo...    49   1e-04
UniRef50_Q74NG5 Cluster: NEQ270; n=1; Nanoarchaeum equitans|Rep:...    49   1e-04
UniRef50_Q3E0L1 Cluster: Translation elongation factor, selenocy...    48   1e-04
UniRef50_Q1NKM4 Cluster: Translation elongation factor, selenocy...    48   1e-04
UniRef50_Q1IHM2 Cluster: Selenocysteine-specific translation elo...    48   1e-04
UniRef50_Q1FK57 Cluster: Small GTP-binding protein domain:Sulfat...    48   1e-04
UniRef50_Q18YZ1 Cluster: Selenocysteine-specific translation elo...    48   1e-04
UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS (T...    48   1e-04
UniRef50_Q663U2 Cluster: Selenocysteine-specific elongation fact...    48   2e-04
UniRef50_A5KED2 Cluster: Elongation factor, putative; n=1; Plasm...    48   2e-04
UniRef50_Q2B7L6 Cluster: Selenocysteine-specific translation elo...    48   3e-04
UniRef50_A6P2V2 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_A4E707 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_A1JVG8 Cluster: Elongation factor 1-alpha; n=2; Gibbere...    47   3e-04
UniRef50_P43927 Cluster: Selenocysteine-specific elongation fact...    47   3e-04
UniRef50_Q6MAV2 Cluster: Probable peptide chain release factor 3...    47   5e-04
UniRef50_Q46455 Cluster: Selenocysteine-specific elongation fact...    47   5e-04
UniRef50_A7HHY2 Cluster: Selenocysteine-specific translation elo...    46   6e-04
UniRef50_P14081 Cluster: Selenocysteine-specific elongation fact...    46   6e-04
UniRef50_Q8F2N6 Cluster: Peptide chain release factor 3; n=8; Ba...    46   8e-04
UniRef50_A1FN34 Cluster: Selenocysteine-specific translation elo...    46   8e-04
UniRef50_A0Z3R3 Cluster: Selenocysteine-specific elongation fact...    46   8e-04
UniRef50_A7QC01 Cluster: Chromosome chr10 scaffold_76, whole gen...    46   8e-04
UniRef50_UPI0000EB403C Cluster: UPI0000EB403C related cluster; n...    46   0.001
UniRef50_Q0BZB1 Cluster: Selenocysteine-specific translation elo...    46   0.001
UniRef50_Q7URR0 Cluster: Translation initiation factor IF-2; n=1...    46   0.001
UniRef50_A7CTC1 Cluster: Peptide chain release factor 3; n=2; Ba...    45   0.001
UniRef50_A7PFT2 Cluster: Chromosome chr11 scaffold_14, whole gen...    45   0.001
UniRef50_Q7R7M3 Cluster: Elongation factor Tu family, putative; ...    45   0.001
UniRef50_UPI000050FBE9 Cluster: COG3276: Selenocysteine-specific...    45   0.002
UniRef50_O67141 Cluster: Elongation factor SelB; n=1; Aquifex ae...    45   0.002
UniRef50_A0YGX4 Cluster: Translation elongation factor, selenocy...    45   0.002
UniRef50_Q4G4A5 Cluster: Elongation factor 1A; n=86; Eukaryota|R...    45   0.002
UniRef50_A5Z9F8 Cluster: Putative uncharacterized protein; n=1; ...    44   0.002
UniRef50_A4X2G5 Cluster: Selenocysteine-specific translation elo...    44   0.002
UniRef50_Q5WBK2 Cluster: Translation elongation factor G; n=1; B...    44   0.003
UniRef50_Q67MT5 Cluster: Peptide chain release factor 3; n=13; B...    44   0.003
UniRef50_A5KIG4 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_A0X1J6 Cluster: Selenocysteine-specific translation elo...    44   0.004
UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog; ...    44   0.004
UniRef50_Q8TJT7 Cluster: Translation initiation factor 2 subunit...    44   0.004
UniRef50_A6G2B2 Cluster: Translation elongation factor, selenocy...    43   0.006
UniRef50_A3Q882 Cluster: Selenocysteine-specific translation elo...    43   0.006
UniRef50_Q8I592 Cluster: Elongation factor g, putative; n=1; Pla...    43   0.006
UniRef50_Q7Q3I6 Cluster: ENSANGP00000010178; n=1; Anopheles gamb...    43   0.006
UniRef50_Q4Y6S3 Cluster: Elongation factor g, putative; n=4; Pla...    43   0.006
UniRef50_A4YIX9 Cluster: Protein synthesis factor, GTP-binding; ...    43   0.006
UniRef50_Q0LF89 Cluster: Selenocysteine-specific translation elo...    43   0.007
UniRef50_A0KL71 Cluster: Selenocysteine-specific translation elo...    43   0.007
UniRef50_Q55002 Cluster: Oxytetracycline resistance protein; n=2...    43   0.007
UniRef50_O36041 Cluster: Eukaryotic translation initiation facto...    43   0.007
UniRef50_Q8TXJ4 Cluster: Elongation factor 2 (EF-2) [Contains: M...    43   0.007
UniRef50_A4FHF5 Cluster: Tetracycline resistance protein; n=1; S...    42   0.010
UniRef50_Q6AJD2 Cluster: Peptide chain release factor 3; n=41; B...    42   0.010
UniRef50_Q8UFQ0 Cluster: Tetracycline resistance protein, tetM/t...    42   0.013
UniRef50_Q1Z854 Cluster: Hypothetical selenocysteine-specific tr...    42   0.013
UniRef50_Q4U972 Cluster: Translation elongation factor 1-alpha, ...    42   0.013
UniRef50_Q8EWU0 Cluster: Translation initiation factor IF-2; n=2...    42   0.013
UniRef50_Q1IY97 Cluster: Peptide chain release factor 3; n=1; De...    42   0.017
UniRef50_Q0HP29 Cluster: Selenocysteine-specific translation elo...    42   0.017
UniRef50_Q9WZN3 Cluster: Translation initiation factor IF-2; n=5...    42   0.017
UniRef50_Q7WHG2 Cluster: Translation initiation factor IF-2; n=2...    42   0.017
UniRef50_Q5PAJ5 Cluster: Translation initiation factor IF-2; n=3...    42   0.017
UniRef50_UPI0000E87FA9 Cluster: translation initiation factor IF...    41   0.022
UniRef50_Q5GBH8 Cluster: TetT; n=2; Lactobacillales|Rep: TetT - ...    41   0.022
UniRef50_Q4HK10 Cluster: Selenocysteine-specific translation elo...    41   0.022
UniRef50_Q1Q1G5 Cluster: Strongly similar to translation initiat...    41   0.022
UniRef50_A6CF43 Cluster: Translation initiation factor IF-2; n=1...    41   0.022
UniRef50_A5DTX8 Cluster: Putative uncharacterized protein; n=3; ...    41   0.022
UniRef50_Q46306 Cluster: Tetracycline resistance protein tetP (T...    41   0.022
UniRef50_Q81NX9 Cluster: GTP-binding elongation factor protein, ...    41   0.030
UniRef50_Q1VQ31 Cluster: Tetracycline resistance protein; n=1; P...    41   0.030
UniRef50_A7ANX2 Cluster: Elongation factor Tu GTP binding domain...    41   0.030
UniRef50_Q8F7K1 Cluster: Translation initiation factor IF-2; n=4...    41   0.030
UniRef50_UPI0000519D80 Cluster: PREDICTED: similar to mitochondr...    40   0.039
UniRef50_Q6LH28 Cluster: Hypothetical selenocysteine-specific tr...    40   0.039
UniRef50_Q1ZC67 Cluster: Selenocysteine synthase; n=1; Psychromo...    40   0.039
UniRef50_A0UWB2 Cluster: Small GTP-binding protein; n=14; Bacter...    40   0.039
UniRef50_Q6CBI0 Cluster: Yarrowia lipolytica chromosome C of str...    40   0.039
UniRef50_P0A3B4 Cluster: GTP-binding protein typA/bipA; n=97; Ba...    40   0.039
UniRef50_Q5QTY8 Cluster: Translation initiation factor IF-2; n=1...    40   0.039
UniRef50_Q9RTG5 Cluster: Translation initiation factor IF-2; n=4...    40   0.039
UniRef50_Q8F983 Cluster: Elongation factor G; n=98; cellular org...    40   0.039
UniRef50_O07170 Cluster: Elongation factor G-like protein; n=24;...    40   0.039
UniRef50_Q2YZV2 Cluster: Translation elongation factor G; n=1; u...    40   0.052
UniRef50_A6Q226 Cluster: Translation initiation factor IF-2; n=5...    40   0.052
UniRef50_A6GK83 Cluster: Translation initiation factor IF-2; n=1...    40   0.052
UniRef50_A1SQK9 Cluster: Small GTP-binding protein; n=2; Actinom...    40   0.052
UniRef50_Q7RJ38 Cluster: Elongation factor Tu family, putative; ...    40   0.052
UniRef50_Q02652 Cluster: Tetracycline resistance protein tetM; n...    40   0.052
UniRef50_Q8R5Z1 Cluster: Translation initiation factor IF-2; n=3...    40   0.052
UniRef50_UPI0000DB7182 Cluster: PREDICTED: similar to elongation...    40   0.069
UniRef50_Q1ZR84 Cluster: Selenocysteinyl-tRNA-specific translati...    40   0.069
UniRef50_A6DBA3 Cluster: Translation initiation factor IF-2; n=1...    40   0.069
UniRef50_Q8I568 Cluster: TetQ family GTPase, putative; n=1; Plas...    40   0.069
UniRef50_Q5FLA9 Cluster: Peptide chain release factor 3; n=66; B...    40   0.069
UniRef50_Q8D2X6 Cluster: Translation initiation factor IF-2; n=1...    40   0.069
UniRef50_Q3ZXU3 Cluster: Translation initiation factor IF-2; n=8...    40   0.069
UniRef50_Q969S9-2 Cluster: Isoform 2 of Q969S9 ; n=8; Tetrapoda|...    39   0.091
UniRef50_Q97KR3 Cluster: Tetracycline resistance protein tetP, c...    39   0.091
UniRef50_Q2GDP0 Cluster: Translation initiation factor IF-2; n=1...    39   0.091
UniRef50_A6G6E0 Cluster: Protein translation elongation factor G...    39   0.091
UniRef50_A1ZR77 Cluster: Translation elongation factor G; n=2; B...    39   0.091
UniRef50_A2XIM0 Cluster: Putative uncharacterized protein; n=1; ...    39   0.091
UniRef50_Q8I335 Cluster: GTP-binding protein, putative; n=1; Pla...    39   0.091
UniRef50_Q4QHR6 Cluster: Translation initiation factor eif-2b ga...    39   0.091
UniRef50_A7AQT2 Cluster: Elongation factor G 2, mitochondrial, p...    39   0.091
UniRef50_A5K8L7 Cluster: TetQ family GTPase, putative; n=1; Plas...    39   0.091
UniRef50_A0BTU2 Cluster: Chromosome undetermined scaffold_128, w...    39   0.091
UniRef50_P44910 Cluster: GTP-binding protein typA/bipA homolog; ...    39   0.091
UniRef50_P73473 Cluster: Peptide chain release factor 3; n=49; B...    39   0.091
UniRef50_P55875 Cluster: Translation initiation factor IF-2; n=7...    39   0.091
UniRef50_Q4FVL5 Cluster: Translation initiation factor IF-2; n=1...    39   0.091
UniRef50_P55972 Cluster: Translation initiation factor IF-2; n=5...    39   0.091
UniRef50_Q969S9 Cluster: Elongation factor G 2, mitochondrial pr...    39   0.091
UniRef50_Q9RXC2 Cluster: Elongation factor G; n=2; Deinococcus|R...    39   0.12 
UniRef50_Q7UN30 Cluster: Elongation factor G; n=2; Planctomyceta...    39   0.12 
UniRef50_Q1GFM6 Cluster: Peptide chain release factor 3; n=41; P...    39   0.12 
UniRef50_A5D2S0 Cluster: Translation initiation factor 2; n=5; C...    39   0.12 
UniRef50_A7QHK9 Cluster: Chromosome chr5 scaffold_98, whole geno...    39   0.12 
UniRef50_Q4Y0B9 Cluster: TetQ family GTPase, putative; n=5; Plas...    39   0.12 
UniRef50_Q8ZZV4 Cluster: Translation initiation factor aIF-2 gam...    39   0.12 
UniRef50_Q837X4 Cluster: Peptide chain release factor 3; n=47; F...    39   0.12 
UniRef50_Q9PGR3 Cluster: Translation initiation factor IF-2; n=2...    39   0.12 
UniRef50_Q67P86 Cluster: Translation initiation factor IF-2; n=1...    39   0.12 
UniRef50_Q1NNQ3 Cluster: Small GTP-binding protein domain; n=4; ...    38   0.16 
UniRef50_A6QBQ5 Cluster: Translation initiation factor IF-2; n=1...    38   0.16 
UniRef50_Q4FNM9 Cluster: Translation initiation factor IF-2; n=2...    38   0.16 
UniRef50_Q609C0 Cluster: Translation initiation factor IF-2; n=8...    38   0.16 
UniRef50_Q72ER1 Cluster: Translation initiation factor IF-2; n=3...    38   0.16 
UniRef50_UPI0000D56919 Cluster: PREDICTED: similar to CG31159-PA...    38   0.21 
UniRef50_Q2RJM5 Cluster: Translation initiation factor IF-2; n=3...    38   0.21 
UniRef50_A6G5J6 Cluster: Translation initiation factor IF-2; n=1...    38   0.21 
UniRef50_A1I9J9 Cluster: Translation elongation factor G; n=1; C...    38   0.21 
UniRef50_A1AV99 Cluster: Translation initiation factor IF-2; n=3...    38   0.21 
UniRef50_Q20447 Cluster: Putative uncharacterized protein; n=2; ...    38   0.21 
UniRef50_P17889 Cluster: Translation initiation factor IF-2; n=6...    38   0.21 
UniRef50_UPI00004996CE Cluster: 116 kda u5 small nuclear ribonuc...    38   0.28 
UniRef50_Q4S9H1 Cluster: Chromosome undetermined SCAF14696, whol...    38   0.28 
UniRef50_Q30SS6 Cluster: Initiation factor 2; n=1; Thiomicrospir...    38   0.28 
UniRef50_Q1JYY0 Cluster: Selenocysteine-specific translation elo...    38   0.28 
UniRef50_A5ZAJ3 Cluster: Putative uncharacterized protein; n=1; ...    38   0.28 
UniRef50_A5UZQ2 Cluster: Translation initiation factor IF-2; n=5...    38   0.28 
UniRef50_A5NXM0 Cluster: Selenocysteine-specific translation elo...    38   0.28 
UniRef50_Q4N072 Cluster: GTP-binding elongation factor, putative...    38   0.28 
UniRef50_A5K6I6 Cluster: GTP-binding protein, putative; n=2; cel...    38   0.28 
UniRef50_P34617 Cluster: Uncharacterized GTP-binding protein ZK1...    38   0.28 
UniRef50_Q92IQ1 Cluster: GTP-binding protein lepA; n=187; Bacter...    38   0.28 
UniRef50_O94429 Cluster: Elongation factor G 2, mitochondrial pr...    38   0.28 
UniRef50_Q6G589 Cluster: Peptide chain release factor 3; n=14; A...    37   0.37 
UniRef50_Q0AYI8 Cluster: Translation initiation factor IF-2; n=1...    37   0.37 
UniRef50_A7I3V0 Cluster: Translation initiation factor IF-2; n=1...    37   0.37 
UniRef50_A7HB64 Cluster: Translation elongation factor G; n=2; A...    37   0.37 
UniRef50_A6NTY0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.37 
UniRef50_A4E859 Cluster: Putative uncharacterized protein; n=1; ...    37   0.37 
UniRef50_A7PLZ9 Cluster: Chromosome chr14 scaffold_21, whole gen...    37   0.37 
UniRef50_Q98QW3 Cluster: GTP-binding protein lepA; n=52; cellula...    37   0.37 
UniRef50_Q97S57 Cluster: Translation initiation factor IF-2; n=9...    37   0.37 
UniRef50_Q7VHF6 Cluster: Translation initiation factor IF-2; n=1...    37   0.37 
UniRef50_Q74CT3 Cluster: Translation initiation factor IF-2; n=2...    37   0.37 
UniRef50_Q30WJ0 Cluster: Translation initiation factor IF-2; n=1...    37   0.37 
UniRef50_UPI0000E46328 Cluster: PREDICTED: similar to G elongati...    37   0.48 
UniRef50_Q9AIG7 Cluster: Elongation factor G; n=2; Candidatus Ca...    37   0.48 
UniRef50_Q1ATN1 Cluster: Small GTP-binding protein domain; n=1; ...    37   0.48 
UniRef50_Q0S473 Cluster: Elongation factor EF2; n=1; Rhodococcus...    37   0.48 
UniRef50_A5ZXF5 Cluster: Putative uncharacterized protein; n=2; ...    37   0.48 
UniRef50_A3LLY2 Cluster: GTP-binding protein LepA; n=4; Bacteria...    37   0.48 
UniRef50_A0NL43 Cluster: Translation initiation factor 2; n=2; O...    37   0.48 
UniRef50_Q606M6 Cluster: Peptide chain release factor 3; n=3; Pr...    37   0.48 
UniRef50_Q5QXU1 Cluster: Peptide chain release factor 3; n=5; Ga...    37   0.48 
UniRef50_Q73NP6 Cluster: Translation initiation factor IF-2; n=2...    37   0.48 
UniRef50_Q6MTQ0 Cluster: Translation initiation factor IF-2; n=2...    37   0.48 
UniRef50_Q6AJY4 Cluster: Translation initiation factor IF-2; n=3...    37   0.48 
UniRef50_Q9AA65 Cluster: Elongation factor Tu family protein; n=...    36   0.64 
UniRef50_Q5FMW9 Cluster: Translation elongation factors; n=2; La...    36   0.64 
UniRef50_A6CUD1 Cluster: Translation initiation factor IF-2; n=1...    36   0.64 
UniRef50_A3ZU78 Cluster: Translation initiation factor; n=1; Bla...    36   0.64 
UniRef50_A0Q2C8 Cluster: Translation elongation factor G; n=1; C...    36   0.64 
UniRef50_Q98RS6 Cluster: U5 small nuclear ribonucleoprotein 116 ...    36   0.64 
UniRef50_A6S9S7 Cluster: Putative uncharacterized protein; n=1; ...    36   0.64 
UniRef50_Q5NQ27 Cluster: Translation initiation factor IF-2; n=2...    36   0.64 
UniRef50_Q5FQM3 Cluster: Translation initiation factor IF-2; n=8...    36   0.64 
UniRef50_Q8FXT2 Cluster: Translation initiation factor IF-2; n=3...    36   0.64 
UniRef50_O58822 Cluster: Probable translation initiation factor ...    36   0.64 
UniRef50_Q6AKM0 Cluster: Putative uncharacterized protein; n=1; ...    36   0.84 
UniRef50_A6LU84 Cluster: Small GTP-binding protein; n=1; Clostri...    36   0.84 
UniRef50_A6C5F4 Cluster: Elongation factor G; n=1; Planctomyces ...    36   0.84 
UniRef50_Q2XN58 Cluster: Auxin down-regulated protein; n=2; Glyc...    36   0.84 
UniRef50_Q9VCX4 Cluster: CG31159-PA; n=4; Diptera|Rep: CG31159-P...    36   0.84 
UniRef50_Q24BY4 Cluster: Elongation factor Tu GTP binding domain...    36   0.84 
UniRef50_Q5KLM1 Cluster: GTP-binding protein 1 (G-protein 1), pu...    36   0.84 
UniRef50_Q08491 Cluster: Superkiller protein 7; n=2; Saccharomyc...    36   0.84 
UniRef50_Q9PGX4 Cluster: Peptide chain release factor 3; n=302; ...    36   0.84 
UniRef50_Q5GS99 Cluster: Translation initiation factor IF-2; n=6...    36   0.84 
UniRef50_Q6YR66 Cluster: Translation initiation factor IF-2; n=3...    36   0.84 
UniRef50_Q5HB61 Cluster: Translation initiation factor IF-2; n=6...    36   0.84 
UniRef50_Q62AN3 Cluster: Selenocysteine-specific translation elo...    36   1.1  
UniRef50_A6EB22 Cluster: Translation initiation factor IF-2; n=2...    36   1.1  
UniRef50_Q54D24 Cluster: ABC transporter B family protein; n=2; ...    36   1.1  
UniRef50_Q4Q2R0 Cluster: Selenocysteine-specific elongation fact...    36   1.1  
UniRef50_Q2JDK2 Cluster: GTP-binding protein lepA; n=24; Actinom...    36   1.1  
UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5...    36   1.1  
UniRef50_Q6ML87 Cluster: PrfC protein; n=1; Bdellovibrio bacteri...    35   1.5  
UniRef50_A5CEN6 Cluster: Translation initiation factor IF-2; n=1...    35   1.5  
UniRef50_A4YUJ6 Cluster: Protein chain elongation factor EF-G, G...    35   1.5  
UniRef50_A4A194 Cluster: Small GTP-binding protein domain; n=1; ...    35   1.5  
UniRef50_A0L3V8 Cluster: Translation elongation factor G; n=1; M...    35   1.5  
UniRef50_Q9LS91 Cluster: Elongation factor EF-2; n=1; Arabidopsi...    35   1.5  
UniRef50_A7QSS1 Cluster: Chromosome chr4 scaffold_162, whole gen...    35   1.5  
UniRef50_Q7Q1K8 Cluster: ENSANGP00000010217; n=2; Coelomata|Rep:...    35   1.5  
UniRef50_Q4Q219 Cluster: Mitochondrial elongation factor G, puta...    35   1.5  
UniRef50_Q6BVE5 Cluster: Debaryomyces hansenii chromosome C of s...    35   1.5  
UniRef50_Q4P257 Cluster: Putative uncharacterized protein; n=1; ...    35   1.5  
UniRef50_A3LWR2 Cluster: Mitochondrial elongation factor G-like ...    35   1.5  
UniRef50_P70882 Cluster: Tetracycline resistance protein tetQ (T...    35   1.5  
UniRef50_Q7VA20 Cluster: Translation initiation factor IF-2; n=2...    35   1.5  
UniRef50_Q74IS8 Cluster: Translation initiation factor IF-2; n=3...    35   1.5  
UniRef50_P39677 Cluster: Elongation factor G 2, mitochondrial pr...    35   1.5  
UniRef50_Q2IJP9 Cluster: Peptide chain release factor 3; n=2; Ba...    35   2.0  
UniRef50_Q5FDV4 Cluster: GTP-binding protein TypA/BipA homolog; ...    35   2.0  
UniRef50_Q0EZ74 Cluster: Translation initiation factor IF-2; n=1...    35   2.0  
UniRef50_A6BAW2 Cluster: BipA protein; n=1; Vibrio parahaemolyti...    35   2.0  
UniRef50_A3ER81 Cluster: Putative translation initiation factor ...    35   2.0  
UniRef50_Q98RT0 Cluster: Eukaryotic translation initiation facto...    35   2.0  
UniRef50_A7PJC5 Cluster: Chromosome chr12 scaffold_18, whole gen...    35   2.0  
UniRef50_A5AF37 Cluster: Putative uncharacterized protein; n=1; ...    35   2.0  
UniRef50_Q7QZ18 Cluster: GLP_464_49314_47878; n=2; Giardia intes...    35   2.0  
UniRef50_A7ARF7 Cluster: GTP binding protein, putative; n=1; Bab...    35   2.0  
UniRef50_A5JZM2 Cluster: GTP-binding protein TypA, putative; n=7...    35   2.0  
UniRef50_A2EAD8 Cluster: Elongation factor Tu GTP binding domain...    35   2.0  
UniRef50_A3LY41 Cluster: Predicted protein; n=3; Saccharomycetac...    35   2.0  
UniRef50_Q1XDN0 Cluster: Translation initiation factor IF-2, chl...    35   2.0  
UniRef50_Q73R08 Cluster: Elongation factor G 1; n=2; Treponema|R...    35   2.0  
UniRef50_UPI00015BD5D6 Cluster: UPI00015BD5D6 related cluster; n...    34   2.6  
UniRef50_UPI0000E49F38 Cluster: PREDICTED: similar to MGC82641 p...    34   2.6  
UniRef50_Q6AKJ8 Cluster: Probable elongation factor G; n=1; Desu...    34   2.6  
UniRef50_Q0HFP5 Cluster: Transcriptional regulator, LysR family;...    34   2.6  
UniRef50_A4E6U7 Cluster: Putative uncharacterized protein; n=1; ...    34   2.6  
UniRef50_A4RX89 Cluster: Predicted protein; n=2; Ostreococcus|Re...    34   2.6  
UniRef50_Q95Y73 Cluster: Putative uncharacterized protein; n=2; ...    34   2.6  
UniRef50_Q4QBM3 Cluster: Translation initiation factor IF-2, put...    34   2.6  
UniRef50_Q384D0 Cluster: Elongation factor G2-like protein; n=5;...    34   2.6  
UniRef50_A7SA88 Cluster: Predicted protein; n=1; Nematostella ve...    34   2.6  
UniRef50_A7S2I1 Cluster: Predicted protein; n=1; Nematostella ve...    34   2.6  
UniRef50_A3FPW4 Cluster: Elongation factor-like protein; n=3; Cr...    34   2.6  
UniRef50_A0BPT3 Cluster: Chromosome undetermined scaffold_12, wh...    34   2.6  
UniRef50_A2R3P3 Cluster: Contig An14c0170, complete genome; n=7;...    34   2.6  
UniRef50_UPI0000DA1A06 Cluster: PREDICTED: similar to elongation...    34   3.4  
UniRef50_Q8C3X4-2 Cluster: Isoform 2 of Q8C3X4 ; n=3; Murinae|Re...    34   3.4  
UniRef50_Q8R7R5 Cluster: Translation elongation and release fact...    34   3.4  
UniRef50_Q7MVV0 Cluster: Translation elongation factor G, putati...    34   3.4  
UniRef50_Q64MT7 Cluster: GTP-binding elongation factor family pr...    34   3.4  
UniRef50_Q2LWU6 Cluster: Bacterial protein translation Initiatio...    34   3.4  
UniRef50_A7IC08 Cluster: Translation initiation factor IF-2; n=2...    34   3.4  
UniRef50_Q00ZZ1 Cluster: GTP-binding membrane protein LepA homol...    34   3.4  
UniRef50_Q4QHR7 Cluster: Eukaryotic translation initiation facto...    34   3.4  
UniRef50_Q4N0F2 Cluster: Translation initiation factor IF-2, put...    34   3.4  
UniRef50_A5HWL3 Cluster: Elongation factor 1-alpha; n=6; Gloeopo...    34   3.4  
UniRef50_Q4JA97 Cluster: GTP-binding protein 1; n=4; Sulfolobace...    34   3.4  
UniRef50_Q9PKU0 Cluster: Translation initiation factor IF-2; n=1...    34   3.4  
UniRef50_Q7VQM3 Cluster: Translation initiation factor IF-2; n=2...    34   3.4  
UniRef50_O29490 Cluster: Probable translation initiation factor ...    34   3.4  
UniRef50_O59683 Cluster: Translation initiation factor IF-2, mit...    34   3.4  
UniRef50_Q7MA53 Cluster: Elongation factor G; n=36; Bacteria|Rep...    34   3.4  
UniRef50_Q39SN2 Cluster: Elongation factor G 2; n=4; Bacteria|Re...    34   3.4  
UniRef50_Q660H9 Cluster: Elongation factor G 2; n=3; Borrelia bu...    34   3.4  
UniRef50_UPI0000D62D3D Cluster: UPI0000D62D3D related cluster; n...    33   4.5  
UniRef50_Q6F0Z6 Cluster: GTP-binding membrane protein, elongatio...    33   4.5  
UniRef50_Q1ZVV6 Cluster: GTP-binding regulator BipA/TypA; n=4; V...    33   4.5  
UniRef50_A6PMK2 Cluster: Translation initiation factor IF-2; n=1...    33   4.5  
UniRef50_A3J586 Cluster: Putative uncharacterized protein; n=3; ...    33   4.5  
UniRef50_A2VTQ7 Cluster: Elongation factor EF-Tu; n=1; Burkholde...    33   4.5  
UniRef50_A7P1C4 Cluster: Chromosome chr19 scaffold_4, whole geno...    33   4.5  
UniRef50_A7AM19 Cluster: Translation elongation factor G, putati...    33   4.5  
UniRef50_A5K9J3 Cluster: MB2 protein, putative; n=1; Plasmodium ...    33   4.5  
UniRef50_A0D5J3 Cluster: Chromosome undetermined scaffold_39, wh...    33   4.5  
UniRef50_Q2GQL9 Cluster: Putative uncharacterized protein; n=1; ...    33   4.5  
UniRef50_A1DDI0 Cluster: Ribosome biogenesis protein Ria1, putat...    33   4.5  
UniRef50_P47388 Cluster: Translation initiation factor IF-2; n=6...    33   4.5  
UniRef50_Q6MMS6 Cluster: Translation initiation factor IF-2; n=1...    33   4.5  
UniRef50_Q09130 Cluster: Eukaryotic translation initiation facto...    33   4.5  
UniRef50_Q8N442 Cluster: GTP-binding protein GUF1 homolog; n=108...    33   4.5  
UniRef50_P34811 Cluster: Elongation factor G, chloroplast precur...    33   4.5  
UniRef50_Q6IRN1 Cluster: MGC83880 protein; n=7; Coelomata|Rep: M...    33   6.0  
UniRef50_Q4T508 Cluster: Chromosome 1 SCAF9472, whole genome sho...    33   6.0  
UniRef50_Q72B39 Cluster: Translation elongation factor G; n=3; D...    33   6.0  
UniRef50_Q3JV89 Cluster: Putative uncharacterized protein; n=6; ...    33   6.0  
UniRef50_Q10878 Cluster: POSSIBLE FATTY-ACID-CoA LIGASE FADD10; ...    33   6.0  
UniRef50_Q4C3K5 Cluster: Putative uncharacterized protein; n=1; ...    33   6.0  
UniRef50_A6PUV8 Cluster: Small GTP-binding protein; n=1; Victiva...    33   6.0  
UniRef50_A6C5G4 Cluster: Protein translation elongation factor G...    33   6.0  
UniRef50_A0JYS6 Cluster: GTP-binding protein TypA; n=101; Bacter...    33   6.0  
UniRef50_A2XK54 Cluster: Putative uncharacterized protein; n=3; ...    33   6.0  
UniRef50_Q4QA83 Cluster: Elongation factor, putative; n=5; Trypa...    33   6.0  
UniRef50_Q239N3 Cluster: Elongation factor Tu GTP binding domain...    33   6.0  
UniRef50_O77136 Cluster: Translation initiation factor 2; n=1; A...    33   6.0  
UniRef50_A7AQ93 Cluster: GTP-binding protein LepA family protein...    33   6.0  
UniRef50_Q6C705 Cluster: Similar to DEHA0E18414g Debaryomyces ha...    33   6.0  
UniRef50_Q5KNR0 Cluster: GTPase, putative; n=1; Filobasidiella n...    33   6.0  
UniRef50_Q5KGT3 Cluster: Pre-mRNA splicing factor, putative; n=3...    33   6.0  
UniRef50_Q4P305 Cluster: Putative uncharacterized protein; n=1; ...    33   6.0  
UniRef50_A7TLH4 Cluster: Putative uncharacterized protein; n=1; ...    33   6.0  
UniRef50_Q8TV36 Cluster: Translation initiation factor 2, GTPase...    33   6.0  
UniRef50_O59155 Cluster: Putative uncharacterized protein PH1486...    33   6.0  
UniRef50_Q68WI4 Cluster: Translation initiation factor IF-2; n=1...    33   6.0  
UniRef50_Q98R05 Cluster: Translation initiation factor IF-2; n=8...    33   6.0  
UniRef50_P46943 Cluster: GTP-binding protein GUF1; n=37; root|Re...    33   6.0  
UniRef50_Q96RP9 Cluster: Elongation factor G 1, mitochondrial pr...    33   6.0  
UniRef50_UPI0000E105E9 Cluster: putative polyprenyl diphosphate ...    33   7.9  
UniRef50_UPI00006CBFC8 Cluster: Elongation factor Tu GTP binding...    33   7.9  
UniRef50_UPI0000498A6D Cluster: CXXC-rich protein; n=4; Entamoeb...    33   7.9  
UniRef50_UPI00003933D9 Cluster: COG1217: Predicted membrane GTPa...    33   7.9  
UniRef50_UPI000065EB23 Cluster: Translation initiation factor IF...    33   7.9  
UniRef50_Q7MWJ5 Cluster: GTP-binding protein TypA; n=31; Bacteri...    33   7.9  
UniRef50_Q4AGI8 Cluster: Elongation factor G, C-terminal:Protein...    33   7.9  
UniRef50_Q0RNV6 Cluster: Elongation factor G; n=1; Frankia alni ...    33   7.9  
UniRef50_A5TSU9 Cluster: Possible TPS family two-partner secreti...    33   7.9  
UniRef50_A3TP61 Cluster: Translation elongation factor EF-G; n=1...    33   7.9  
UniRef50_A0LHL8 Cluster: Translation initiation factor IF-2; n=1...    33   7.9  
UniRef50_Q0E3S2 Cluster: Os02g0157700 protein; n=4; cellular org...    33   7.9  
UniRef50_O82501 Cluster: F2P3.9 protein; n=7; Magnoliophyta|Rep:...    33   7.9  
UniRef50_A6MVX8 Cluster: Translation initiation factor 2; n=1; R...    33   7.9  
UniRef50_A4S2B0 Cluster: Mitochondrial translation initiation fa...    33   7.9  
UniRef50_Q9W2H0 Cluster: CG9841-PA; n=1; Drosophila melanogaster...    33   7.9  
UniRef50_Q9VV61 Cluster: CG33158-PB; n=4; Sophophora|Rep: CG3315...    33   7.9  
UniRef50_Q4UGH7 Cluster: Rna-associated protein, putative; n=2; ...    33   7.9  
UniRef50_O62108 Cluster: Putative uncharacterized protein selb-1...    33   7.9  
UniRef50_A0BK03 Cluster: Chromosome undetermined scaffold_111, w...    33   7.9  
UniRef50_Q6CDQ9 Cluster: Similar to DEHA0C03773g Debaryomyces ha...    33   7.9  
UniRef50_A6SF10 Cluster: Putative uncharacterized protein; n=1; ...    33   7.9  
UniRef50_A2R994 Cluster: Contig An17c0030, complete genome; n=1;...    33   7.9  
UniRef50_A1CA46 Cluster: Translation elongation factor G2, putat...    33   7.9  
UniRef50_A0RUB8 Cluster: Translation initiation factor 2; n=2; T...    33   7.9  

>UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-like;
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           statin-like - Canis familiaris
          Length = 667

 Score =  172 bits (419), Expect = 5e-42
 Identities = 85/119 (71%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFET+KYY+TIIDAPGH
Sbjct: 320 EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGH 375

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 376 RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 434



 Score =  141 bits (342), Expect = 1e-32
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 281 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 340

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 341 DKLKAE 346



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEP YSE R++EI KEVS+YIKKIGYNPA V FVPISGWHG
Sbjct: 437 STEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 478


>UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397;
           root|Rep: Elongation factor 1-alpha 2 - Homo sapiens
           (Human)
          Length = 463

 Score =  172 bits (419), Expect = 5e-42
 Identities = 85/119 (71%), Positives = 96/119 (80%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDI+LWKFET+KYY+TIIDAPGH
Sbjct: 40  EKFEKEAAEMGKGS----FKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGH 95

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVG  K
Sbjct: 96  RDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNK 154



 Score =  141 bits (342), Expect = 1e-32
 Identities = 65/66 (98%), Positives = 65/66 (98%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           STEP YSE R++EI KEVS+YIKKIGYNPA V FVPISGWHG
Sbjct: 157 STEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198


>UniRef50_Q5EMT9 Cluster: Elongation factor 1-alpha-like protein;
           n=6; Fungi/Metazoa group|Rep: Elongation factor
           1-alpha-like protein - Magnaporthe grisea (Rice blast
           fungus) (Pyricularia grisea)
          Length = 473

 Score =  166 bits (404), Expect = 4e-40
 Identities = 81/119 (68%), Positives = 94/119 (78%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + Y +E  E G G+     +    + + K   ERGITIDIALWKFET+KY VT+IDAPGH
Sbjct: 41  EKYEKEAAELGKGS----FKYAWVLDKLKAERERGITIDIALWKFETAKYQVTVIDAPGH 96

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFIKNMITGTSQADCA+L++ AGTGEFEAGISK+GQTREHALLAFTLGV+QLIV   K
Sbjct: 97  RDFIKNMITGTSQADCAILVIGAGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNK 155



 Score =  123 bits (296), Expect = 4e-27
 Identities = 55/64 (85%), Positives = 61/64 (95%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           KEK+H+N+VVIGHVDSGKSTTTGHLIYK  GID+RTIEK+EKEA E+GKGSFKYAWVLDK
Sbjct: 4   KEKSHLNVVVIGHVDSGKSTTTGHLIYKLKGIDQRTIEKYEKEAAELGKGSFKYAWVLDK 63

Query: 242 LKAE 253
           LKAE
Sbjct: 64  LKAE 67



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 20/37 (54%), Positives = 32/37 (86%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +++ R++EI KE S+++KKIG+NP +V FVPISG++G
Sbjct: 161 WAQSRYDEIVKETSNFLKKIGFNPDSVPFVPISGFNG 197


>UniRef50_P13905 Cluster: Elongation factor 1-alpha; n=2224;
           cellular organisms|Rep: Elongation factor 1-alpha -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 449

 Score =  156 bits (378), Expect = 5e-37
 Identities = 73/90 (81%), Positives = 81/90 (90%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + 
Sbjct: 60  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 119

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           TG FEAGISK+GQTREHALLAFTLGVKQ+I
Sbjct: 120 TGGFEAGISKDGQTREHALLAFTLGVKQMI 149



 Score =  126 bits (303), Expect = 6e-28
 Identities = 59/66 (89%), Positives = 60/66 (90%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 26/42 (61%), Positives = 34/42 (80%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +T P YS+ R++EI KEVSSY+KK+GYNP  + FVPISG+ G
Sbjct: 157 ATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEG 198


>UniRef50_UPI0000EB0538 Cluster: UPI0000EB0538 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB0538 UniRef100
           entry - Canis familiaris
          Length = 357

 Score =  143 bits (346), Expect = 4e-33
 Identities = 72/87 (82%), Positives = 76/87 (87%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E GIT+DI+LWKFETSKYYVTI DA GH+  IKNMITGT QADCAVLIVAAG GEFEAGI
Sbjct: 69  EHGITVDISLWKFETSKYYVTITDATGHKH-IKNMITGTPQADCAVLIVAAGVGEFEAGI 127

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
           SK GQTREHALLA TLGVKQL+VG  K
Sbjct: 128 SKMGQTREHALLA-TLGVKQLVVGVNK 153



 Score =  115 bits (276), Expect = 1e-24
 Identities = 57/68 (83%), Positives = 59/68 (86%), Gaps = 2/68 (2%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDS--GKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           MGKE THINI+VI H     GKSTTTGHLIYKCGGIDKRTIEKFE EA EMGKGSF+YAW
Sbjct: 1   MGKEMTHINIIVISHWMHRLGKSTTTGHLIYKCGGIDKRTIEKFE-EAAEMGKGSFRYAW 59

Query: 230 VLDKLKAE 253
           VLDKLKAE
Sbjct: 60  VLDKLKAE 67


>UniRef50_Q96TP0 Cluster: Elongation factor 1 alpha; n=5;
           Fungi/Metazoa group|Rep: Elongation factor 1 alpha -
           Gibberella intermedia (Bulb rot disease fungus)
           (Fusariumproliferatum)
          Length = 108

 Score =  133 bits (321), Expect = 4e-30
 Identities = 61/67 (91%), Positives = 65/67 (97%), Gaps = 1/67 (1%)
 Frame = +2

Query: 56  MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 232
           MGKE KTH+N+VVIGHVDSGKSTTTGHLIY+CGGIDKRTIEKFEKEA E+GKGSFKYAWV
Sbjct: 1   MGKEDKTHLNVVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWV 60

Query: 233 LDKLKAE 253
           LDKLKAE
Sbjct: 61  LDKLKAE 67



 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 42/72 (58%), Positives = 51/72 (70%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + + +E  E G G+     +    + + K   ERGITIDIALWKFET +YYVT+IDAPGH
Sbjct: 41  EKFEKEAAELGKGS----FKYAWVLDKLKAERERGITIDIALWKFETPRYYVTVIDAPGH 96

Query: 340 RDFIKNMITGTS 375
           RDFIKNMITGTS
Sbjct: 97  RDFIKNMITGTS 108


>UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porphyra
           purpurea|Rep: Elongation factor 1-alpha S - Porphyra
           purpurea
          Length = 515

 Score =  130 bits (315), Expect = 2e-29
 Identities = 63/95 (66%), Positives = 75/95 (78%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKF T+K+  T+IDAPGHRDFIKNMITGTSQAD A+L++   
Sbjct: 60  LDKLKAERERGITIDIALWKFSTAKFEYTVIDAPGHRDFIKNMITGTSQADVALLVIDG- 118

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
              FEAGI++ G T+EHALLA+TLGVKQL VG  K
Sbjct: 119 -NNFEAGIAEGGSTKEHALLAYTLGVKQLAVGINK 152



 Score =  125 bits (302), Expect = 8e-28
 Identities = 57/66 (86%), Positives = 61/66 (92%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHIN+VVIGHVD+GKSTTTGHLIYK GGID RTI KFE +A+EMGK SFKYAWVL
Sbjct: 1   MGKEKTHINLVVIGHVDAGKSTTTGHLIYKLGGIDARTIAKFEADAKEMGKSSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66


>UniRef50_Q2U0M0 Cluster: Translation elongation factor EF-1
           alpha/Tu; n=1; Aspergillus oryzae|Rep: Translation
           elongation factor EF-1 alpha/Tu - Aspergillus oryzae
          Length = 534

 Score =  128 bits (309), Expect = 1e-28
 Identities = 57/87 (65%), Positives = 72/87 (82%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITIDI+L  FET K+ VT+IDAPGHRD+IKN ITG SQADCA+L+ +A  GEFEAG+
Sbjct: 178 KRGITIDISLCTFETPKFVVTVIDAPGHRDYIKNTITGASQADCAILVTSATNGEFEAGV 237

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
            + GQ+R+H +LA+TLGV+QLIV   K
Sbjct: 238 DQGGQSRQHLVLAYTLGVRQLIVAVNK 264



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 26/44 (59%), Positives = 30/44 (68%)
 Frame = +2

Query: 515 NGSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           N    P Y++    EI KE S +IKKIGYNP AVAFVPISG +G
Sbjct: 263 NKMDTPRYTDDCLNEIVKETSDFIKKIGYNPKAVAFVPISGLYG 306



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 19/97 (19%)
 Frame = +2

Query: 20  YYTQFVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKF------ 181
           Y+T  V +      +EK HI  V +GH+D GKSTT   LIY+ G +    I ++      
Sbjct: 81  YFTSSVAKPFLACNREKPHITAVFLGHLDHGKSTTADQLIYQYGRVSGNPIAEYGSMLSL 140

Query: 182 -------------EKEAQEMGKGSFKYAWVLDKLKAE 253
                            QE G  S+KY WV++KL+AE
Sbjct: 141 SSDLLCAGARPHDNHSPQEAGP-SYKYGWVIEKLRAE 176


>UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellular
           organisms|Rep: Elongation factor 1-alpha - Sulfolobus
           solfataricus
          Length = 435

 Score =  125 bits (301), Expect = 1e-27
 Identities = 56/87 (64%), Positives = 70/87 (80%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+TI++   +FET KY+ TIIDAPGHRDF+KNMITG SQAD A+L+V+A  GE+EAG+
Sbjct: 67  ERGVTINLTFMRFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKGEYEAGM 126

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
           S  GQTREH +LA T+G+ QLIV   K
Sbjct: 127 SVEGQTREHIILAKTMGLDQLIVAVNK 153



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 30/63 (47%), Positives = 49/63 (77%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K H+N++VIGH+D GKST  G L+   G ID++T+++ E+ A+++GK S K+A++LD+L
Sbjct: 3   QKPHLNLIVIGHIDHGKSTLVGRLLMDRGFIDEKTVKEAEEAAKKLGKESEKFAFLLDRL 62

Query: 245 KAE 253
           K E
Sbjct: 63  KEE 65



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 17/36 (47%), Positives = 25/36 (69%)
 Frame = +2

Query: 524 TEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 631
           TEPPY E R++EI  +VS +++  G+N   V FVP+
Sbjct: 157 TEPPYDEKRYKEIVDQVSKFMRSYGFNTNKVRFVPV 192


>UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4;
           Fungi/Metazoa group|Rep: Elongation factor 1 alpha -
           Brugia pahangi (Filarial nematode worm)
          Length = 123

 Score =  121 bits (292), Expect = 1e-26
 Identities = 64/100 (64%), Positives = 70/100 (70%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE +   K         
Sbjct: 23  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKERKRWAKVHSSMHGCW 82

Query: 236 DKLKAELSVVSQSILLSGSSKLASTMLPSLMLLDTEISSR 355
              +  ++VVS S L  GSSK ++TM P   L D  ISSR
Sbjct: 83  TSWRRNVNVVSPSTLPCGSSKPSNTMSPLSTLQDIVISSR 122


>UniRef50_P90922 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 610

 Score =  116 bits (278), Expect = 7e-25
 Identities = 55/95 (57%), Positives = 68/95 (71%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + +T+   ERG+T+DI    FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A 
Sbjct: 241 LDETEEERERGVTMDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNAT 300

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           TGEFE G    GQT+EHALL  +LGV QLIV   K
Sbjct: 301 TGEFETGFENGGQTKEHALLLRSLGVTQLIVAVNK 335



 Score = 79.0 bits (186), Expect = 9e-14
 Identities = 34/63 (53%), Positives = 46/63 (73%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ 
Sbjct: 185 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 244

Query: 245 KAE 253
           + E
Sbjct: 245 EEE 247


>UniRef50_A7RM15 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 473

 Score =  115 bits (276), Expect = 1e-24
 Identities = 53/87 (60%), Positives = 66/87 (75%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGIT+D+ L +F+T    +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG 
Sbjct: 112 ERGITMDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGF 171

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
              GQTREHA+L  +LGV QLIV   K
Sbjct: 172 ESGGQTREHAILVRSLGVTQLIVAINK 198



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 31/80 (38%), Positives = 46/80 (57%), Gaps = 13/80 (16%)
 Frame = +2

Query: 53  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFE-------------KEA 193
           K  + K  +N+V+IGHVD+GKST  GHL++  G + K+ + K+               E+
Sbjct: 31  KRHQGKELLNLVIIGHVDAGKSTLMGHLLFLLGDVSKKAMHKYPFFFLIIIFNLKACTES 90

Query: 194 QEMGKGSFKYAWVLDKLKAE 253
           ++ GK SF YAWVLD+   E
Sbjct: 91  KKAGKASFAYAWVLDETGEE 110



 Score = 33.5 bits (73), Expect = 4.5
 Identities = 12/37 (32%), Positives = 24/37 (64%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +SE R+  I  ++  ++K++G+  + V +VP+SG  G
Sbjct: 204 WSEERYLHIVSKLKHFLKQVGFKDSDVVYVPVSGLSG 240


>UniRef50_Q9Y450 Cluster: HBS1-like protein; n=43; Euteleostomi|Rep:
           HBS1-like protein - Homo sapiens (Human)
          Length = 684

 Score =  113 bits (271), Expect = 5e-24
 Identities = 52/87 (59%), Positives = 64/87 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
              GQTREH LL  +LGV QL V   K
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNK 407



 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 35/62 (56%), Positives = 48/62 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 248 AE 253
            E
Sbjct: 318 EE 319



 Score = 33.1 bits (72), Expect = 6.0
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RF+EI  ++  ++K+ G+  + V F+P SG  G
Sbjct: 413 WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449


>UniRef50_A6RVA8 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 756

 Score =  108 bits (260), Expect = 1e-22
 Identities = 52/86 (60%), Positives = 66/86 (76%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RG+TIDIA+ KFET K   TI+DAPGHRDFI NMI G SQAD AVL++ A  G FE+G+ 
Sbjct: 409 RGVTIDIAMNKFETEKTTFTILDAPGHRDFIPNMIAGASQADFAVLVIDASVGSFESGL- 467

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
             GQT+EHALLA ++GV+++I+   K
Sbjct: 468 -KGQTKEHALLARSMGVQRIIIAVNK 492



 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 35/66 (53%), Positives = 45/66 (68%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           K K   N VVIGHVD+GKST  G L+Y    +D+RT++++ KEA+ MGK SF  AWVLD+
Sbjct: 343 KSKNAANFVVIGHVDAGKSTLMGRLLYDLKVVDQRTVDRYRKEAEAMGKSSFALAWVLDQ 402

Query: 242 LKAELS 259
              E S
Sbjct: 403 GTEERS 408



 Score = 39.1 bits (87), Expect = 0.091
 Identities = 14/37 (37%), Positives = 25/37 (67%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +S+ RF+EI ++VS+++   G+    + F+P SG HG
Sbjct: 498 WSQERFDEISQQVSAFLTAAGFQEQNIKFIPCSGLHG 534


>UniRef50_O93729 Cluster: Elongation factor 1-alpha; n=20;
           Archaea|Rep: Elongation factor 1-alpha - Pyrobaculum
           aerophilum
          Length = 444

 Score =  107 bits (257), Expect = 2e-22
 Identities = 49/87 (56%), Positives = 62/87 (71%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+TI+     FET+K ++TIID PGHRDF+KNMI G SQAD A+ +++A  GEFEA I
Sbjct: 78  ERGVTIEATHVGFETNKLFITIIDLPGHRDFVKNMIVGASQADAALFVISARPGEFEAAI 137

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
              GQ REH  L  TLGV+Q++V   K
Sbjct: 138 GPQGQGREHLFLIRTLGVQQIVVAVNK 164



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 29/63 (46%), Positives = 48/63 (76%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K HIN+ V+GHVD+GKST  G L+Y+ G +D++ +++ E+ A+++GK  F +AW+LD+ 
Sbjct: 14  QKPHINLAVVGHVDNGKSTLVGRLLYETGYVDEKALKEIEEMAKKIGKEDFAFAWILDRF 73

Query: 245 KAE 253
           K E
Sbjct: 74  KEE 76



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 15/37 (40%), Positives = 26/37 (70%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           Y + R+E++K EVS  +K +GY+P+ + F+P+S   G
Sbjct: 170 YDQKRYEQVKAEVSKLLKLLGYDPSKIHFIPVSAIKG 206


>UniRef50_Q7YZN7 Cluster: Hsp70 subfamily B suppressor 1; n=3;
           Dictyostelium discoideum|Rep: Hsp70 subfamily B
           suppressor 1 - Dictyostelium discoideum (Slime mold)
          Length = 317

 Score =  106 bits (254), Expect = 5e-22
 Identities = 50/87 (57%), Positives = 66/87 (75%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+D+ +  FET    +T++DAPGHRDFI NMI+GT+QAD A+L++ A   EFEAG 
Sbjct: 49  ERGVTMDVCVRYFETEHRRITLLDAPGHRDFIPNMISGTTQADVAILLINA--SEFEAGF 106

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
           S  GQT+EHALLA +LG+ +LIV   K
Sbjct: 107 SAEGQTKEHALLAKSLGIMELIVAVNK 133



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 27/47 (57%), Positives = 36/47 (76%)
 Frame = +2

Query: 113 KSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           KSTT GH+++K G +DKRT+ KFE E+  MGK SF +AWVLD+ + E
Sbjct: 1   KSTTMGHILFKLGYVDKRTMSKFENESNRMGKSSFHFAWVLDEQEEE 47


>UniRef50_Q4P6P7 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 965

 Score =  105 bits (253), Expect = 7e-22
 Identities = 51/83 (61%), Positives = 62/83 (74%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+TIDIA   F T     T++DAPGHRDFI NMI+G +QAD A+L+V +  G FEAG 
Sbjct: 590 ERGVTIDIAQDHFSTQHRTFTLLDAPGHRDFIPNMISGAAQADSALLVVDSIQGAFEAGF 649

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
             NGQTREHALL  +LGV+QL+V
Sbjct: 650 GPNGQTREHALLVRSLGVQQLVV 672



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 31/81 (38%), Positives = 51/81 (62%), Gaps = 1/81 (1%)
 Frame = +2

Query: 14  LGYYTQFVIRD*PKMGKE-KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE 190
           +G   + +I +  K  +E K  +++VV+GHVD+GKST  G ++ + G + +R     E+ 
Sbjct: 508 MGIAHERIIEEYRKREREGKAELSLVVVGHVDAGKSTLMGRMLLELGSLSQREYSTNERA 567

Query: 191 AQEMGKGSFKYAWVLDKLKAE 253
           +Q++GKGSF YAW LD  + E
Sbjct: 568 SQKIGKGSFAYAWALDSSEEE 588


>UniRef50_A5X901 Cluster: Elongation factor 1-alpha; n=2;
           Chilodonella uncinata|Rep: Elongation factor 1-alpha -
           Chilodonella uncinata
          Length = 403

 Score =  105 bits (251), Expect = 1e-21
 Identities = 52/89 (58%), Positives = 63/89 (70%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           R I IDI   +  T      ++DAPGHRDF+K++ITG  QAD  +L+V A  GEFEAGIS
Sbjct: 54  REIGIDIHKTQIYTENRNYMLVDAPGHRDFVKSLITGVCQADFCLLVVVAAAGEFEAGIS 113

Query: 439 KNGQTREHALLAFTLGVKQLIVGETKWFH 525
           K+GQTRE ALLA+TLGVKQ IV  +K  H
Sbjct: 114 KDGQTREQALLAYTLGVKQFIVVVSKMDH 142



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 18/49 (36%), Positives = 31/49 (63%)
 Frame = +2

Query: 107 SGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           SGKST   HL Y CGG+D+RT   ++++ + MG     + W++D+ + +
Sbjct: 1   SGKSTIVAHLAYLCGGLDRRTRMDYDEQRKLMGDKPLSFGWLMDRYRTD 49



 Score = 33.9 bits (74), Expect = 3.4
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           YS+ RF EI+ E+     K+G     + FV IS W G
Sbjct: 147 YSQIRFAEIQTEIRLMFTKMGVKADQIPFVAISAWFG 183


>UniRef50_P15170 Cluster: G1 to S phase transition protein 1
           homolog; n=77; Eukaryota|Rep: G1 to S phase transition
           protein 1 homolog - Homo sapiens (Human)
          Length = 499

 Score =  105 bits (251), Expect = 1e-21
 Identities = 48/83 (57%), Positives = 61/83 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G 
Sbjct: 135 DKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGF 194

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREHA+LA T GVK LIV
Sbjct: 195 EKGGQTREHAMLAKTAGVKHLIV 217



 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 31/68 (45%), Positives = 47/68 (69%)
 Frame = +2

Query: 50  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 229
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 230 VLDKLKAE 253
            LD  + E
Sbjct: 126 ALDTNQEE 133



 Score = 36.3 bits (80), Expect = 0.64
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           +S  R+EE K+++  ++KK+G+NP   + F+P SG  G
Sbjct: 229 WSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTG 266


>UniRef50_UPI0000D55B6A Cluster: PREDICTED: similar to CG1898-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1898-PA - Tribolium castaneum
          Length = 792

 Score =  104 bits (250), Expect = 2e-21
 Identities = 50/86 (58%), Positives = 61/86 (70%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGIT+D+   +FET   +VT++DAPGH+DFI NMI+G  QAD A+L+V A  GEFE G  
Sbjct: 430 RGITMDVGRSQFETKSKHVTLLDAPGHKDFIPNMISGAGQADVALLVVDATRGEFETGFD 489

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
             GQTREHALL  +LGV QL V   K
Sbjct: 490 FGGQTREHALLVRSLGVTQLAVAINK 515



 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 34/65 (52%), Positives = 50/65 (76%)
 Frame = +2

Query: 59  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 238
           G  K H+ +VVIGHVD+GKST  GHL+Y  G ++++T+ K+E+E++++GK SF YAWVLD
Sbjct: 363 GDSKEHLYMVVIGHVDAGKSTLMGHLLYDLGQVNQKTMHKYEQESRKVGKQSFMYAWVLD 422

Query: 239 KLKAE 253
           +   E
Sbjct: 423 ETGEE 427



 Score = 33.9 bits (74), Expect = 3.4
 Identities = 13/37 (35%), Positives = 24/37 (64%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +S+ RF++I +++  ++K+ G+    V FVP SG  G
Sbjct: 521 WSKERFDDISQKLKVFLKQAGFREGDVTFVPCSGLTG 557


>UniRef50_Q5KLM5 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 914

 Score =  104 bits (250), Expect = 2e-21
 Identities = 49/87 (56%), Positives = 62/87 (71%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RG+TIDIA   F T     T++DAPGHRDFI  MI+G +QAD A+L++    GEFEAG 
Sbjct: 544 DRGVTIDIATTHFVTPHRNFTLLDAPGHRDFIPAMISGAAQADVALLVIDGSPGEFEAGF 603

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
            + GQTREHA L  +LGVK++IVG  K
Sbjct: 604 ERGGQTREHAWLVRSLGVKEIIVGVNK 630



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 25/62 (40%), Positives = 43/62 (69%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K +++++V+GHVD+GKST  G ++Y  G + ++     E+ ++++GKGSF +AW LD L 
Sbjct: 481 KKNVSLIVVGHVDAGKSTLMGRVLYDIGELSEKEKIANERGSKKLGKGSFAFAWGLDALG 540

Query: 248 AE 253
            E
Sbjct: 541 DE 542


>UniRef50_A5JHE1 Cluster: Translation elongation factor EF-1 alpha
           subunit; n=2; Euryarchaeota|Rep: Translation elongation
           factor EF-1 alpha subunit - Methanohalophilus
           portucalensis
          Length = 354

 Score =  103 bits (248), Expect = 3e-21
 Identities = 52/87 (59%), Positives = 61/87 (70%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGITIDIA  +F+T KYY TI+D PGHRDF+KNMITG SQAD AVL+VAA  G      
Sbjct: 46  ERGITIDIAHKRFDTDKYYFTIVDCPGHRDFVKNMITGASQADAAVLVVAATDGVM---- 101

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QT+EH  L+ TLG+ QLI+   K
Sbjct: 102 ---AQTKEHVFLSRTLGINQLIIAVNK 125



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 21/40 (52%), Positives = 28/40 (70%)
 Frame = +2

Query: 134 LIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           L+Y  G I +  I+KF +EA+E GK SF +AWV+D LK E
Sbjct: 5   LLYXTGAIPQHIIDKFREEAKEKGKESFAFAWVMDSLKEE 44



 Score = 38.3 bits (85), Expect = 0.16
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           YSE ++ ++KK+VS  +  +G+  A V F+P S + G
Sbjct: 131 YSEDKYNQVKKDVSELLGMVGFKAADVPFIPTSAFEG 167


>UniRef50_O45622 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 532

 Score =  103 bits (247), Expect = 4e-21
 Identities = 50/115 (43%), Positives = 72/115 (62%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + Y RE +E G  +    L  C+     +   E+G T+++    FET K + TI+DAPGH
Sbjct: 142 EKYEREAKEKGRESW--YLSWCMDTNDEE--REKGKTVEVGRAYFETEKRHFTILDAPGH 197

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIV 504
           + F+ NMI G +QAD AVL+++A  GEFE G  + GQTREH++L  T GVK L++
Sbjct: 198 KSFVPNMIVGANQADLAVLVISARRGEFETGFDRGGQTREHSMLVKTAGVKHLVI 252



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 31/60 (51%), Positives = 45/60 (75%)
 Frame = +2

Query: 59  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 238
           G  K HIN+V +GHVD+GKST  G L++  G +DKRT+EK+E+EA+E G+ S+  +W +D
Sbjct: 104 GTHKEHINMVFVGHVDAGKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMD 163



 Score = 36.3 bits (80), Expect = 0.64
 Identities = 14/38 (36%), Positives = 27/38 (71%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           + E RF+EI+ +++ +++K+G+NP   + +VP SG  G
Sbjct: 264 WEEERFKEIEGKLTPFLRKLGFNPKTDITYVPCSGLTG 301


>UniRef50_A2QW82 Cluster: Contig An11c0160, complete genome; n=8;
           Eurotiomycetidae|Rep: Contig An11c0160, complete genome
           - Aspergillus niger
          Length = 809

 Score =  102 bits (245), Expect = 6e-21
 Identities = 48/86 (55%), Positives = 63/86 (73%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RG+TIDIA  KFET     TI+DAPGHRDF+ NMI G SQAD AVL++ +  G FE+G+ 
Sbjct: 463 RGVTIDIATNKFETESTVFTIVDAPGHRDFVPNMIAGASQADFAVLVIDSSIGNFESGL- 521

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
             GQT+EHALL  ++GV+++I+   K
Sbjct: 522 -KGQTKEHALLVRSMGVQRIIIAVNK 546



 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 32/60 (53%), Positives = 44/60 (73%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           + K  +N  VIGHVD+GKST  G L+     +D+RT+EK+ KEA+++GKGSF  AWVLD+
Sbjct: 397 QRKKAMNFAVIGHVDAGKSTLMGRLLADLKAVDQRTLEKYRKEAEKIGKGSFALAWVLDQ 456



 Score = 38.3 bits (85), Expect = 0.16
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RFEEI+++VSS++   G+    +AFVP SG  G
Sbjct: 552 WDQGRFEEIEQQVSSFLTTAGFQAKNIAFVPCSGISG 588


>UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1,
           subunit alpha; n=1; Halorubrum lacusprofundi ATCC
           49239|Rep: Translation elongation factor EF-1, subunit
           alpha - Halorubrum lacusprofundi ATCC 49239
          Length = 540

 Score =  102 bits (245), Expect = 6e-21
 Identities = 51/87 (58%), Positives = 64/87 (73%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+TIDIA  +F+T  YY TI+D PGHRDF+KNMITG SQAD AVL+VAA     + G+
Sbjct: 186 ERGVTIDIAHQEFDTDNYYFTIVDCPGHRDFVKNMITGASQADNAVLVVAA-----DDGV 240

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
           +   QTREH  LA TLG+ ++I+G  K
Sbjct: 241 AP--QTREHVFLARTLGINEIIIGVNK 265



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 34/78 (43%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +2

Query: 23  YTQFVI-RD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE 199
           Y+Q  + RD P    +K H N+ +IGHVD GKST  G L+++ G + +  IE+  +EA+E
Sbjct: 109 YSQSALARDYPM--SDKPHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREEAEE 166

Query: 200 MGKGSFKYAWVLDKLKAE 253
            GKG F++A+V+D L  E
Sbjct: 167 KGKGGFEFAYVMDNLAEE 184


>UniRef50_UPI0000499ED8 Cluster: guanine nucleotide regulatory
           protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep:
           guanine nucleotide regulatory protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 488

 Score =  101 bits (243), Expect = 1e-20
 Identities = 49/86 (56%), Positives = 59/86 (68%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +GITID+    FET K   TI+DAPGHR F+ NMI+  +QAD AVLIV+A  GEFE G  
Sbjct: 123 KGITIDVGRALFETEKRRYTILDAPGHRSFVPNMISAAAQADIAVLIVSARKGEFETGFD 182

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
           K GQTREH+ L  T GVK +I+   K
Sbjct: 183 KGGQTREHSQLCRTAGVKTVIIAVNK 208



 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 30/64 (46%), Positives = 50/64 (78%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K   NI+ IGHVD+GKSTT+G+++++ G I++R I+KFEKEA+E  + S+  A+++D+++
Sbjct: 59  KESANIIFIGHVDAGKSTTSGNILFQSGNIEQRIIDKFEKEAKENQRESWWLAYIMDQIE 118

Query: 248 AELS 259
            E S
Sbjct: 119 EEKS 122


>UniRef50_Q8IIC9 Cluster: Translation elongation factor EF-1,
           subunit alpha, putative; n=11; Apicomplexa|Rep:
           Translation elongation factor EF-1, subunit alpha,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 555

 Score =  101 bits (242), Expect = 2e-20
 Identities = 47/87 (54%), Positives = 61/87 (70%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    FET     TI+DAPGH++FI NMI+G +QAD  VLI++A  GEFE G 
Sbjct: 180 QKGKTVEVGRAHFETKDRRFTILDAPGHKNFIPNMISGAAQADIGVLIISARKGEFETGF 239

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
            + GQTREH LLA TLG+ QLIV   K
Sbjct: 240 ERGGQTREHTLLARTLGINQLIVAINK 266



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 28/57 (49%), Positives = 44/57 (77%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 238
           + H+NI+ IGHVD+GKST  G+++Y  G +D RTIEK+E+EA+E  + S+  A+++D
Sbjct: 117 RPHLNIIFIGHVDAGKSTACGNILYILGYVDDRTIEKYEREAKEKSRESWFLAFIMD 173



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYN-PAAVAFVPISGWHG 646
           +SE R+EEI+K+++ YIK  GYN    V FVPISG  G
Sbjct: 274 WSESRYEEIQKKITPYIKSCGYNINKDVFFVPISGLTG 311


>UniRef50_A6RA16 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 957

 Score =  100 bits (239), Expect = 3e-20
 Identities = 48/86 (55%), Positives = 63/86 (73%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RG+TIDIA  +F T     TI+DAPGHRDF+ NMI G SQAD AVL++ A TG FE+G+ 
Sbjct: 485 RGVTIDIATNRFATENTNFTILDAPGHRDFVPNMIAGASQADFAVLVLDATTGNFESGL- 543

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
             GQT+EHALL  ++GV++++V   K
Sbjct: 544 -RGQTKEHALLVRSMGVQRIVVAVNK 568



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 33/60 (55%), Positives = 45/60 (75%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           + K   N VVIGHVD+GKST  G L+Y+   +D+RTI++++KEA  +GKGSF  AWVLD+
Sbjct: 419 ERKKAANFVVIGHVDAGKSTLMGRLLYELKAVDQRTIDRYQKEADRIGKGSFALAWVLDQ 478



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 13/37 (35%), Positives = 24/37 (64%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +S  RF+EI+++ +S++   G+    ++FVP SG  G
Sbjct: 574 WSHDRFDEIQQQTASFLTTAGFQAKNISFVPCSGLRG 610


>UniRef50_Q86NR4 Cluster: RE29053p; n=5; Diptera|Rep: RE29053p -
           Drosophila melanogaster (Fruit fly)
          Length = 670

 Score =   99 bits (238), Expect = 5e-20
 Identities = 46/80 (57%), Positives = 59/80 (73%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGIT+D+   + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEFE+G  
Sbjct: 309 RGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFE 368

Query: 439 KNGQTREHALLAFTLGVKQL 498
             GQTREHA+L  +LGV QL
Sbjct: 369 LGGQTREHAILVRSLGVNQL 388



 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 33/63 (52%), Positives = 49/63 (77%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+ 
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 245 KAE 253
             E
Sbjct: 304 GEE 306


>UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1;
           Pneumocystis carinii|Rep: Eukaryotic release factor 3 -
           Pneumocystis carinii
          Length = 629

 Score = 99.1 bits (236), Expect = 8e-20
 Identities = 49/119 (41%), Positives = 73/119 (61%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           + Y ++ +E G  +      +   +  TK    +G T+++    FET K   TI+DAPGH
Sbjct: 235 EKYEKDAKEAGRESW----YLSWALDSTKEERSKGKTVELGRAYFETEKRRYTILDAPGH 290

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           + ++ NMI GT+QA+ AVL+++A  GE+E G  K GQTREHA+L+ T GV +LIV   K
Sbjct: 291 KSYVPNMIEGTAQAEVAVLVISARKGEYETGFEKGGQTREHAMLSKTQGVSKLIVAINK 349



 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 34/64 (53%), Positives = 48/64 (75%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H+N+V IGHVD+GKST  G+++Y  G +DKRT+EK+EK+A+E G+ S+  +W LD  K
Sbjct: 200 KEHVNVVFIGHVDAGKSTLGGNILYMTGMVDKRTMEKYEKDAKEAGRESWYLSWALDSTK 259

Query: 248 AELS 259
            E S
Sbjct: 260 EERS 263


>UniRef50_Q759Q2 Cluster: ADR221Cp; n=3; Saccharomycetales|Rep:
           ADR221Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 614

 Score = 99.1 bits (236), Expect = 8e-20
 Identities = 45/93 (48%), Positives = 63/93 (67%)
 Frame = +1

Query: 238 QTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           QT     RG+T+DI   +FET+K   T+IDAPGHRDF+ N +TG + AD A++ +   T 
Sbjct: 232 QTNEERARGVTVDICTSEFETAKSTFTVIDAPGHRDFVPNAVTGVNLADVAIVTIDCATD 291

Query: 418 EFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
            FE+G + +GQTREH +LA +LGVK +I+   K
Sbjct: 292 AFESGFNLDGQTREHIILARSLGVKHIILAMNK 324



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 29/64 (45%), Positives = 45/64 (70%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           ++K H++ VV+GHVD+GKST  G L+Y  G +D + I + ++E++  GKGSF  AWV+D+
Sbjct: 173 EKKPHMSFVVLGHVDAGKSTLMGRLLYDVGAVDTKLIRQLKRESELAGKGSFHLAWVMDQ 232

Query: 242 LKAE 253
              E
Sbjct: 233 TNEE 236


>UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 654

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 63/86 (73%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RG+T+DIA   FET K   TI+DAPGH+DFI NMI+G+SQAD  VL++ A T  FEAG+ 
Sbjct: 305 RGVTVDIATNYFETEKTRFTILDAPGHKDFIPNMISGSSQADFPVLVIDASTNSFEAGL- 363

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
             GQT+EH L+A ++G++ +IV   K
Sbjct: 364 -KGQTKEHILIARSMGMQHIIVAVNK 388



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 29/60 (48%), Positives = 41/60 (68%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAELS 259
           N VV+GHVD GKST  G L+Y    +D+R+++K  KEA+ +GK SF  AW++D+   E S
Sbjct: 245 NFVVVGHVDHGKSTLMGRLLYDLKVVDQRSLDKLRKEAETIGKSSFALAWIMDETSEERS 304


>UniRef50_Q6BVD7 Cluster: Similar to sp|P32769 Saccharomyces
           cerevisiae YKR084c HBS1; n=5; Saccharomycetales|Rep:
           Similar to sp|P32769 Saccharomyces cerevisiae YKR084c
           HBS1 - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 600

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 45/89 (50%), Positives = 61/89 (68%)
 Frame = +1

Query: 238 QTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           QT     RG+T+DI    FET     T IDAPGH+DF+  MI+G SQAD A+L++ + TG
Sbjct: 221 QTSEERSRGVTVDICATNFETETSRFTAIDAPGHKDFVPQMISGVSQADFALLVIDSITG 280

Query: 418 EFEAGISKNGQTREHALLAFTLGVKQLIV 504
           EFE+G + +GQT+EH +LA  LG+ +L V
Sbjct: 281 EFESGFTMDGQTKEHTILAKNLGIARLCV 309



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 29/64 (45%), Positives = 44/64 (68%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H + VVIGHVD+GKST  G L++  G ID +T+    ++++++GKGSF  AW++D+  
Sbjct: 164 KPHKSFVVIGHVDAGKSTLMGRLLFDLGVIDAKTVNNLVRQSEKIGKGSFALAWIMDQTS 223

Query: 248 AELS 259
            E S
Sbjct: 224 EERS 227



 Score = 33.1 bits (72), Expect = 6.0
 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 2/39 (5%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYI--KKIGYNPAAVAFVPISGWHG 646
           +SE RFE+IK +++ ++    IG++   + FVPISG  G
Sbjct: 319 WSERRFEDIKFQMTEFLTGSDIGFSSDQIDFVPISGLTG 357


>UniRef50_Q4QGW5 Cluster: Eukaryotic release factor 3, putative;
           n=8; Trypanosomatidae|Rep: Eukaryotic release factor 3,
           putative - Leishmania major
          Length = 763

 Score = 97.5 bits (232), Expect = 2e-19
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 5/92 (5%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +GIT +     FET K  VT++DAPGH+ F+ +MI G +QAD  VL++++ TGEFE G  
Sbjct: 388 KGITRETGAAYFETEKRRVTVLDAPGHKAFVPSMIGGATQADICVLVISSRTGEFETGFE 447

Query: 439 KNGQTREHALLAFTLGVKQLI-----VGETKW 519
           K GQTREHA+L  T GVKQ+I     + E KW
Sbjct: 448 KGGQTREHAMLVRTCGVKQMICVINKMDEMKW 479



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 28/64 (43%), Positives = 44/64 (68%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           + H NIV  GHVD+GKST +GHL+ + G +D+R +EK  +EA+   +  ++YA+V+D  +
Sbjct: 324 RPHFNIVFCGHVDAGKSTISGHLLMEKGLVDQREMEKLRREAEINHREGWEYAYVMDVSE 383

Query: 248 AELS 259
            E S
Sbjct: 384 EERS 387


>UniRef50_Q5UHI3 Cluster: EF-1 alpha-like protein; n=6;
           Eukaryota|Rep: EF-1 alpha-like protein - Bigelowiella
           natans (Pedinomonas minutissima) (Chlorarachnion
           sp.(strain CCMP 621))
          Length = 513

 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 50/95 (52%), Positives = 63/95 (66%), Gaps = 8/95 (8%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+TI     +F T+ ++ T+IDAPGH+DFIKNMI+G SQAD A+L+V A  G FEA I
Sbjct: 82  ERGVTISCTTKEFHTTNFHYTVIDAPGHKDFIKNMISGASQADVALLMVPAKKGGFEAAI 141

Query: 436 SK--------NGQTREHALLAFTLGVKQLIVGETK 516
            K         GQTR HA L   LG++Q+IVG  K
Sbjct: 142 QKGEGGDAANKGQTRHHAELTKLLGIQQIIVGVNK 176



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 30/63 (47%), Positives = 46/63 (73%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K H+ +V++GHVD+GKSTTTGHL+++ G +D+R       +A+EM K SF +A+ +DK 
Sbjct: 18  DKPHLGVVIVGHVDAGKSTTTGHLLFELGTMDERAKADLIAKAKEMKKESFAFAFFMDKQ 77

Query: 245 KAE 253
           K E
Sbjct: 78  KEE 80


>UniRef50_A4ZCD1 Cluster: GTP-binding protein; n=9;
           Magnoliophyta|Rep: GTP-binding protein - Triticum
           aestivum (Wheat)
          Length = 533

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 43/82 (52%), Positives = 58/82 (70%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +G T+++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  
Sbjct: 154 KGKTVEVGRAHFETENTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYE 213

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
           + GQTREH LLA TLGV +L+V
Sbjct: 214 RGGQTREHVLLAKTLGVAKLVV 235



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 30/64 (46%), Positives = 47/64 (73%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           +EK HIN+V IGHVD+GKST  G +++  G +D RTI+K+EKEA++  + S+  A+++D 
Sbjct: 88  EEKRHINLVFIGHVDAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDT 147

Query: 242 LKAE 253
            + E
Sbjct: 148 NEEE 151


>UniRef50_A3LY56 Cluster: Predicted protein; n=2; Pichia|Rep:
           Predicted protein - Pichia stipitis (Yeast)
          Length = 581

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 46/93 (49%), Positives = 61/93 (65%)
 Frame = +1

Query: 238 QTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           QT      G+T+DI    FET     T IDAPGH+DF+  MI G SQAD A+L+V + TG
Sbjct: 202 QTAEERSHGVTVDICATDFETPTTRFTAIDAPGHKDFVPQMIGGVSQADLALLVVDSITG 261

Query: 418 EFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           EFEAG + +GQT+EH +LA  LG++++ V   K
Sbjct: 262 EFEAGFAMDGQTKEHTILAKNLGIERICVAVNK 294



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 31/64 (48%), Positives = 43/64 (67%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H + VVIGHVD+GKST  G +++  G +D RT+ +  KEA+  GKGSF  AW++D+  
Sbjct: 145 KPHKSFVVIGHVDAGKSTLMGRILFDYGIVDARTVNRLVKEAENAGKGSFALAWIMDQTA 204

Query: 248 AELS 259
            E S
Sbjct: 205 EERS 208


>UniRef50_P32769 Cluster: Elongation factor 1 alpha-like protein;
           n=2; Saccharomyces cerevisiae|Rep: Elongation factor 1
           alpha-like protein - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 611

 Score = 96.3 bits (229), Expect = 6e-19
 Identities = 46/93 (49%), Positives = 58/93 (62%)
 Frame = +1

Query: 238 QTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           QT    ERG+T+ I    F T +   TI+DAPGHRDF+ N I G SQAD A+L V   T 
Sbjct: 222 QTNEERERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTN 281

Query: 418 EFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
            FE+G   +GQT+EH LLA +LG+  LI+   K
Sbjct: 282 AFESGFDLDGQTKEHMLLASSLGIHNLIIAMNK 314



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 26/60 (43%), Positives = 43/60 (71%)
 Frame = +2

Query: 74  HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           H++ VV+GHVD+GKST  G L+Y    +++  + K ++E++ MGK SFK+AW++D+   E
Sbjct: 167 HLSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEE 226



 Score = 36.3 bits (80), Expect = 0.64
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +S+ RFEEIK ++  Y+  IG+    + +VPISG+ G
Sbjct: 320 WSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSG 356


>UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=2; Schizosaccharomyces pombe|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Schizosaccharomyces pombe (Fission yeast)
          Length = 662

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 41/83 (49%), Positives = 58/83 (69%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+G T+++    FET     +++DAPGH+ ++ NMI G SQAD  VL+++A  GEFEAG 
Sbjct: 299 EKGKTVEVGRAYFETEHRRFSLLDAPGHKGYVTNMINGASQADIGVLVISARRGEFEAGF 358

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            + GQTREHA+LA T G+  L+V
Sbjct: 359 ERGGQTREHAVLARTQGINHLVV 381



 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 33/62 (53%), Positives = 45/62 (72%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H+NIV IGHVD+GKST  G++++  G +DKRT+EK E+EA+E GK S+  +W LD   
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKESWYLSWALDSTS 295

Query: 248 AE 253
            E
Sbjct: 296 EE 297


>UniRef50_Q259E7 Cluster: H0801D08.2 protein; n=5; Oryza sativa|Rep:
           H0801D08.2 protein - Oryza sativa (Rice)
          Length = 654

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 41/85 (48%), Positives = 61/85 (71%), Gaps = 2/85 (2%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGIT+ + +  F+T  Y+V ++D+PGH+DF+ NMI+G +Q+D A+L++ A  G FEAG+
Sbjct: 295 ERGITMTVGVAYFDTKNYHVVLLDSPGHKDFVPNMISGATQSDAAILVIDASIGSFEAGM 354

Query: 436 SKN--GQTREHALLAFTLGVKQLIV 504
             N  GQT+EH+ L  + GV  LIV
Sbjct: 355 GINGIGQTKEHSQLVRSFGVDNLIV 379



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 15/33 (45%), Positives = 24/33 (72%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 634
           YS+ RF  IK ++ ++++  GY  +AVA+VPIS
Sbjct: 389 YSKERFNFIKSQLGAFLRSCGYKDSAVAWVPIS 421


>UniRef50_Q00WU5 Cluster: EF-1 alpha-like protein; n=1; Ostreococcus
           tauri|Rep: EF-1 alpha-like protein - Ostreococcus tauri
          Length = 444

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 52/95 (54%), Positives = 62/95 (65%), Gaps = 8/95 (8%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+TI     +F T K++ TIIDAPGHRDFIKNMI+G +QAD A+L+V A  G F   I
Sbjct: 75  ERGVTISCTTKEFFTEKWHYTIIDAPGHRDFIKNMISGAAQADVALLMVPA-DGNFTVAI 133

Query: 436 SK--------NGQTREHALLAFTLGVKQLIVGETK 516
            K         GQTR+HA L   LGVKQLI+G  K
Sbjct: 134 QKGNHKAGEVQGQTRQHARLLNLLGVKQLIIGINK 168



 Score = 79.8 bits (188), Expect = 5e-14
 Identities = 34/66 (51%), Positives = 49/66 (74%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           M + K H++IV+ GHVDSGKSTTTG L+++ GGI +R +EK + EA  +GK SF +A+ +
Sbjct: 8   MSEGKEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLKAEADALGKSSFAFAFYM 67

Query: 236 DKLKAE 253
           D+ K E
Sbjct: 68  DRQKEE 73



 Score = 35.9 bits (79), Expect = 0.84
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 4/41 (9%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIG----YNPAAVAFVPISGWHG 646
           Y + R+EEI+ E+ + + K+G    Y   +V  +PISGW+G
Sbjct: 176 YKQERYEEIRNEMKNMLIKVGWKKDYVEKSVPVLPISGWNG 216


>UniRef50_O74774 Cluster: Elongation factor 1 alpha related protein;
           n=1; Schizosaccharomyces pombe|Rep: Elongation factor 1
           alpha related protein - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 592

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 50/119 (42%), Positives = 64/119 (53%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGH 339
           Q  H E    G G+          +  T+    RG+T+D+A   FE+ K    I DAPGH
Sbjct: 210 QKLHNEAANSGKGS----FSYAWLLDTTEEERARGVTMDVASTTFESDKKIYEIGDAPGH 265

Query: 340 RDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           RDFI  MI G S AD AVL+V +    FE G  +NGQTREHA L   LG+ +++V   K
Sbjct: 266 RDFISGMIAGASSADFAVLVVDSSQNNFERGFLENGQTREHAYLLRALGISEIVVSVNK 324



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 30/62 (48%), Positives = 43/62 (69%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +++VV GHVDSGKST  G ++++ G I+ R+++K   EA   GKGSF YAW+LD  +
Sbjct: 175 KPVVHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTE 234

Query: 248 AE 253
            E
Sbjct: 235 EE 236



 Score = 36.7 bits (81), Expect = 0.48
 Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSY-IKKIGYNPAAVAFVPISGWHG 646
           +SE RF+EIK  VS + IK +G+  + V FVPIS   G
Sbjct: 330 WSEDRFQEIKNIVSDFLIKMVGFKTSNVHFVPISAISG 367


>UniRef50_Q9HGI4 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=2; Zygosaccharomyces rouxii|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Zygosaccharomyces rouxii (Candida mogii)
          Length = 662

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 44/81 (54%), Positives = 56/81 (69%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 441
           G TI++    FET K   TI+DAPGH+ ++  MI G SQAD  +L+++A  GE+E G  K
Sbjct: 300 GKTIEVGRAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYETGFEK 359

Query: 442 NGQTREHALLAFTLGVKQLIV 504
            GQTREHALLA T GV +LIV
Sbjct: 360 GGQTREHALLAKTQGVNKLIV 380



 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 29/62 (46%), Positives = 47/62 (75%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H++I+ +GHVD+GKST  G+++Y  G +DKRT+EK+E+EA++ GK  +  +WV+D  +
Sbjct: 235 KDHMSIIFMGHVDAGKSTMGGNILYMTGSVDKRTVEKYEREAKDAGKQGWYLSWVMDTNR 294

Query: 248 AE 253
            E
Sbjct: 295 EE 296


>UniRef50_Q9NCN8 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Giardia intestinalis|Rep: Eukaryotic
           release factor 3 GTPase subunit - Giardia lamblia
           (Giardia intestinalis)
          Length = 465

 Score = 93.1 bits (221), Expect = 5e-18
 Identities = 42/83 (50%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           E+G T++ A   F T     +TIIDAPGH+ F+ NMI+G +QAD A+L+++A  GEFE+G
Sbjct: 77  EKGKTVECARESFLTPNGRRITIIDAPGHKGFVHNMISGAAQADTAILVISARKGEFESG 136

Query: 433 ISKNGQTREHALLAFTLGVKQLI 501
             + GQT EHALLA+  G+KQ++
Sbjct: 137 FERGGQTSEHALLAYVNGIKQIV 159



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 29/64 (45%), Positives = 48/64 (75%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           +++ ++NIV IGHVD+GKST +GHL+   G +DKR +EK E++A+ + + S+KYA+ +D 
Sbjct: 12  EKRKNLNIVFIGHVDAGKSTISGHLVSDLGKLDKRQLEKLEQQAKALNRESWKYAFAMDT 71

Query: 242 LKAE 253
            + E
Sbjct: 72  SEEE 75



 Score = 33.5 bits (73), Expect = 4.5
 Identities = 12/37 (32%), Positives = 23/37 (62%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           Y + R++ I  ++  Y++ +GY    + F+PISG+ G
Sbjct: 172 YCKKRYDSIVSQLKLYLENVGYASKNIFFLPISGFTG 208


>UniRef50_A4R2K6 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 630

 Score = 92.7 bits (220), Expect = 7e-18
 Identities = 44/85 (51%), Positives = 59/85 (69%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 441
           G+TIDIA  +FET     TI+DAPGH+DF+ NMI G SQAD A+L++ A  G +E G+  
Sbjct: 342 GVTIDIAKSRFETESTIFTILDAPGHQDFVPNMIAGASQADFAILVIDATVGAYERGL-- 399

Query: 442 NGQTREHALLAFTLGVKQLIVGETK 516
            GQT+EHA L  ++GV ++IV   K
Sbjct: 400 KGQTKEHAQLIRSIGVSRIIVAVNK 424



 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 33/63 (52%), Positives = 43/63 (68%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K + + VV+GHVD+GKST  G L+     +D RTI K++KEA+ MGKGSF  AWVLD  
Sbjct: 276 KKKNASFVVVGHVDAGKSTMMGRLLLDMNVVDDRTISKYKKEAEAMGKGSFALAWVLDST 335

Query: 245 KAE 253
             E
Sbjct: 336 SDE 338



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 12/37 (32%), Positives = 24/37 (64%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +S+ RF EI   +S ++  +G+    ++F+P+SG +G
Sbjct: 430 WSQDRFNEISDGMSGFMSALGFQMKNISFIPLSGLNG 466


>UniRef50_O13354 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=31; cellular organisms|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Candida albicans (Yeast)
          Length = 715

 Score = 92.7 bits (220), Expect = 7e-18
 Identities = 43/81 (53%), Positives = 56/81 (69%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 441
           G TI++    FET K   TI+DAPGH+ ++  MI G SQAD  +L+++A  GE+E G  K
Sbjct: 355 GKTIEVGKAYFETDKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYETGFEK 414

Query: 442 NGQTREHALLAFTLGVKQLIV 504
            GQTREHALLA T GV ++IV
Sbjct: 415 GGQTREHALLAKTQGVNKIIV 435



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 29/62 (46%), Positives = 47/62 (75%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H++I+ +GHVD+GKST  G+++Y  G +DKRT+EK+E+EA++ G+  +  +WV+D  K
Sbjct: 290 KDHVSIIFMGHVDAGKSTMGGNILYLTGSVDKRTVEKYEREAKDAGRQGWYLSWVMDTNK 349

Query: 248 AE 253
            E
Sbjct: 350 EE 351



 Score = 32.7 bits (71), Expect = 7.9
 Identities = 11/37 (29%), Positives = 25/37 (67%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +S+ R++E   ++ +++K IGY    + ++P+SG+ G
Sbjct: 447 WSKERYQECTTKLGAFLKGIGYAKDDIIYMPVSGYTG 483


>UniRef50_A2AX44 Cluster: Translation elongation factor 1 like;
           n=37; Eukaryota|Rep: Translation elongation factor 1
           like - Guillardia theta (Cryptomonas phi)
          Length = 472

 Score = 92.3 bits (219), Expect = 9e-18
 Identities = 51/95 (53%), Positives = 63/95 (66%), Gaps = 8/95 (8%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+TI     +F T K++ TIIDAPGHRDFIKNMI+G++QAD A+L+V A  G F   I
Sbjct: 67  ERGVTIACTTKEFFTDKWHYTIIDAPGHRDFIKNMISGSAQADVALLMVPA-DGNFTTAI 125

Query: 436 SK--------NGQTREHALLAFTLGVKQLIVGETK 516
            K         GQTR+HA +   LG+KQLIVG  K
Sbjct: 126 QKGDAKAGEIQGQTRQHARILNLLGIKQLIVGINK 160



 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 34/63 (53%), Positives = 49/63 (77%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           EK H++IV+ GHVDSGKSTTTG L+++ GGI +R +EK ++EA  +GK SF +A+ +D+ 
Sbjct: 3   EKEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLKEEAANLGKSSFAFAFYMDRQ 62

Query: 245 KAE 253
           K E
Sbjct: 63  KEE 65



 Score = 33.9 bits (74), Expect = 3.4
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 4/41 (9%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNP----AAVAFVPISGWHG 646
           Y E R+ EI+ E+ + + ++G+      A+V  +PISGW G
Sbjct: 168 YKEERYNEIRDEMRNMLIRVGWKKEFVAASVPVIPISGWMG 208


>UniRef50_Q2GS47 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 840

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 45/86 (52%), Positives = 60/86 (69%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGIT+DIA  +FET     TI+DAPGH ++I NMI G SQAD A+L++ A    FE+G+ 
Sbjct: 495 RGITMDIATRRFETEHTAFTILDAPGHAEYIYNMIAGASQADFAILVIDASIDAFESGL- 553

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
             GQTREH+LL  ++GV ++IV   K
Sbjct: 554 -KGQTREHSLLIRSMGVSRIIVAVNK 578



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 34/66 (51%), Positives = 44/66 (66%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           K K   + VV+GHVD+GKST  G L+     +D+RTI+K +KEA+  GKGSF  AWVLD+
Sbjct: 429 KPKKSASFVVVGHVDAGKSTMMGRLLLDLKVVDQRTIDKLQKEAKTEGKGSFGLAWVLDQ 488

Query: 242 LKAELS 259
              E S
Sbjct: 489 RPEERS 494



 Score = 35.9 bits (79), Expect = 0.84
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +S+ RF EIK ++S ++    +    +AFVP+SG +G
Sbjct: 584 WSQERFSEIKDQMSGFLSTANFQHKNMAFVPVSGLNG 620


>UniRef50_Q19AS6 Cluster: Translation elongation factor 1 alpha;
           n=7; Fungi/Metazoa group|Rep: Translation elongation
           factor 1 alpha - Fusarium sp. CBS 100485
          Length = 61

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 40/43 (93%), Positives = 42/43 (97%)
 Frame = +2

Query: 125 TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           TGHLIY+CGGIDKRTIEKFEKEA E+GKGSFKYAWVLDKLKAE
Sbjct: 1   TGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAE 43



 Score = 36.7 bits (81), Expect = 0.48
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +1

Query: 160 QTYHREVREGGPGNG*RILQICLGIGQTKG*AERGITIDIALWKFET 300
           + + +E  E G G+     +    + + K   ERGITIDIALWKFET
Sbjct: 17  EKFEKEAAELGKGS----FKYAWVLDKLKAERERGITIDIALWKFET 59


>UniRef50_P05453 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=50; Ascomycota|Rep: Eukaryotic
           peptide chain release factor GTP-binding subunit -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 685

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 42/81 (51%), Positives = 56/81 (69%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 441
           G TI++    FET K   TI+DAPGH+ ++  MI G SQAD  VL+++A  GE+E G  +
Sbjct: 323 GKTIEVGKAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGVLVISARKGEYETGFER 382

Query: 442 NGQTREHALLAFTLGVKQLIV 504
            GQTREHALLA T GV +++V
Sbjct: 383 GGQTREHALLAKTQGVNKMVV 403



 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 30/62 (48%), Positives = 47/62 (75%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++ G+  +  +WV+D  K
Sbjct: 258 KDHVSLIFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNK 317

Query: 248 AE 253
            E
Sbjct: 318 EE 319


>UniRef50_A0E926 Cluster: Chromosome undetermined scaffold_84, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_84,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 756

 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 43/87 (49%), Positives = 60/87 (68%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T++    +F T +    + DAPGH++++ NMI G  QAD A LIV+A TGEFE+G 
Sbjct: 389 QKGKTVECGKAQFVTKQKRFILADAPGHKNYVPNMIMGACQADLAGLIVSAKTGEFESGF 448

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
            K GQT+EHALLA +LGV  +I+  TK
Sbjct: 449 EKGGQTQEHALLAKSLGVDHIIIIVTK 475



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 24/59 (40%), Positives = 41/59 (69%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           +N+V IGHVD+GKST  G L+ + G + +  I+K+E+EA +  + S+  A+V+D+ + E
Sbjct: 329 VNLVFIGHVDAGKSTLCGRLLLELGEVSEADIKKYEQEAVQNNRDSWWLAYVMDQNEEE 387


>UniRef50_Q9NCN7 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Trichomonas vaginalis|Rep: Eukaryotic
           release factor 3 GTPase subunit - Trichomonas vaginalis
          Length = 587

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 40/82 (48%), Positives = 57/82 (69%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +G T ++ +  FET++   TI+DAPGHR ++  MI G  QAD AVL+++A  GEFEAG  
Sbjct: 224 KGKTEEVGVAHFETAQNKYTILDAPGHRSYVPQMIGGAVQADVAVLVISARNGEFEAGFE 283

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
             GQT EH L+A T GV+++I+
Sbjct: 284 NGGQTSEHLLIARTAGVREIII 305



 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 33/64 (51%), Positives = 49/64 (76%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H NIV IGHVD+GKST  GH++Y+ G +D+RTIE+++ E+ + G+GS+ ++WV+D  K
Sbjct: 160 KKHFNIVFIGHVDAGKSTLCGHVLYQAGCVDQRTIEQYQAESAKEGRGSWYFSWVMDLSK 219

Query: 248 AELS 259
            E S
Sbjct: 220 EERS 223


>UniRef50_UPI00006CC36B Cluster: Elongation factor Tu C-terminal
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 441

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 39/83 (46%), Positives = 58/83 (69%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +R  +ID +++ FET K+ +TIID PG   + KNM+TG   AD AVL+++A   EFE G 
Sbjct: 72  QRKQSIDTSIFHFETDKFQITIIDTPGDTQYTKNMMTGICLADAAVLMISAAADEFEKGF 131

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K+GQT++  L ++ LG+KQ+IV
Sbjct: 132 GKDGQTKDFILHSYALGIKQMIV 154



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 20/64 (31%), Positives = 40/64 (62%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           ++K  I + VIG++ SGKST  GHL  + G ++ + +++ ++  +E G+    Y++++D 
Sbjct: 7   QKKERITLAVIGNIGSGKSTMCGHLAIQLGQVNDQKLKEVKQACEEEGQDGINYSYIMDT 66

Query: 242 LKAE 253
            K E
Sbjct: 67  KKVE 70



 Score = 37.9 bits (84), Expect = 0.21
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RF EIKKEV    +KI +N   + F+PIS + G
Sbjct: 166 FCQKRFNEIKKEVKQQFEKINFNLQNIKFIPISAFLG 202


>UniRef50_Q23TC1 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 600

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 41/83 (49%), Positives = 54/83 (65%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITIDI     +T    +T +DAPGH+DF+ NMI G +QAD A+L++      FE G 
Sbjct: 239 QRGITIDIGYKVIQTKNKNITFLDAPGHKDFVPNMIQGVTQADYALLVIEGSLQAFERGF 298

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
              GQT+EHA L   LGV++LIV
Sbjct: 299 EFGGQTKEHAFLVKQLGVQRLIV 321



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 31/60 (51%), Positives = 45/60 (75%)
 Frame = +2

Query: 74  HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           ++N+V++GHVDSGKST  GHL +    ID++   K EKE++ +GK SFK+AWV D+ +AE
Sbjct: 178 NMNLVIVGHVDSGKSTLVGHLCHLKKVIDQKLAHKNEKESKNIGKESFKFAWVNDEFEAE 237



 Score = 33.1 bits (72), Expect = 6.0
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +2

Query: 548 RFEEIKKEVSSYIKKIGYNPAAVAFVPISGWH 643
           RFE IK E++ ++  IGY+   + FVPIS ++
Sbjct: 335 RFEYIKLELTRFLTSIGYSEDNLIFVPISAFY 366


>UniRef50_Q5KFJ4 Cluster: Translation release factor, putative; n=3;
           Eukaryota|Rep: Translation release factor, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 757

 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 42/94 (44%), Positives = 63/94 (67%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +G T+++    FE+ K   TI+DAPGH+ ++ +MI+G +QAD A+L+++A  GEFE G  
Sbjct: 377 KGKTVEVGRAYFESEKRRYTILDAPGHKTYVPSMISGAAQADVALLVLSARKGEFETGFE 436

Query: 439 KNGQTREHALLAFTLGVKQLIVGETKWFH*TTIQ 540
           + GQTREHA+L    G+ +LIV   K    TT+Q
Sbjct: 437 REGQTREHAMLIKNNGINKLIVVVNK-MDDTTVQ 469



 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 31/62 (50%), Positives = 45/62 (72%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K+H+NI+  GHVD+GKST  G L+Y  G +DKRT+EK+E+EA+  G+ ++  +W LD  K
Sbjct: 313 KSHLNIIFTGHVDAGKSTMGGQLLYLTGAVDKRTMEKYEQEAKAAGRETWYLSWALDSGK 372

Query: 248 AE 253
            E
Sbjct: 373 EE 374



 Score = 33.1 bits (72), Expect = 6.0
 Identities = 12/42 (28%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 524 TEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPISGWHG 646
           T   + + R++EI  +++ ++K +G+NP   + F+P+S   G
Sbjct: 466 TTVQWDKGRYDEITTKITPFLKAVGFNPKTDITFIPVSAQIG 507


>UniRef50_Q9NCN5 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Euplotes|Rep: Eukaryotic release factor 3
           GTPase subunit - Euplotes aediculatus
          Length = 805

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 39/82 (47%), Positives = 57/82 (69%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +G T+++     ET     TI DAPGH++++ +MI G + AD A L+++A  GEFEAG  
Sbjct: 371 KGKTVEVGRATMETPTKRYTIFDAPGHKNYVPDMIMGAAMADVAALVISARKGEFEAGFE 430

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
           ++GQTREHA LA +LGV +L+V
Sbjct: 431 RDGQTREHAQLARSLGVSKLVV 452



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 26/53 (49%), Positives = 41/53 (77%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 238
           ++V IGHVD+GKST  G+L++  G +D+RT EKF++EA+E  + S+  A+V+D
Sbjct: 311 SLVFIGHVDAGKSTICGNLMFMTGMVDERTTEKFKQEAKEKNRDSWWLAYVMD 363


>UniRef50_Q7YZN9 Cluster: Eukaryotic release factor 3; n=2;
           Dictyostelium discoideum|Rep: Eukaryotic release factor
           3 - Dictyostelium discoideum (Slime mold)
          Length = 557

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 40/82 (48%), Positives = 59/82 (71%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +G T+++    FET+K   TI+DAPGHR ++ NMI G +QAD  +L++++  GEFEAG+ 
Sbjct: 179 KGKTVEVGRAHFETTKKRYTILDAPGHRLYVPNMIIGAAQADVGILVISSKKGEFEAGV- 237

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
           + GQT EHA LA  +G+K L+V
Sbjct: 238 EGGQTIEHARLAKMIGIKYLVV 259



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 25/62 (40%), Positives = 43/62 (69%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           + H+NIV +GHVD+GKST +G ++   G +D  T+ K+E+EA+E  +  + YA+++D  +
Sbjct: 115 REHLNIVFLGHVDAGKSTLSGSIMVLTGQVDPHTLAKYEREAKENHREGWIYAYIMDTNE 174

Query: 248 AE 253
            E
Sbjct: 175 EE 176


>UniRef50_A2FN77 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Elongation factor Tu C-terminal domain containing
           protein - Trichomonas vaginalis G3
          Length = 607

 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 44/85 (51%), Positives = 53/85 (62%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 441
           G+TID+AL  FET    +T++DAPGHRDF+ NMI G SQAD A+L+V       E     
Sbjct: 253 GVTIDVALNNFETEDRKITVLDAPGHRDFVPNMIAGASQADSAILVVDVSNPNIE----- 307

Query: 442 NGQTREHALLAFTLGVKQLIVGETK 516
            GQ  EH LL  +LGVK LIV   K
Sbjct: 308 RGQAGEHILLCRSLGVKHLIVAINK 332



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 22/64 (34%), Positives = 43/64 (67%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H+N+V++GHVD+GKST  GH++     ++K+ ++K  ++++  G G    AW++ + +
Sbjct: 188 KKHVNLVIVGHVDAGKSTLIGHVLLLSNFVEKQRMDKIMEDSKATGHGQDYLAWIMAEDE 247

Query: 248 AELS 259
           +E S
Sbjct: 248 SERS 251


>UniRef50_Q9LM39 Cluster: T10O22.4; n=7; Magnoliophyta|Rep: T10O22.4
           - Arabidopsis thaliana (Mouse-ear cress)
          Length = 615

 Score = 85.8 bits (203), Expect = 8e-16
 Identities = 42/83 (50%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI--VAAGTGEFEAGI 435
           G T+++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+  +    GEFE G 
Sbjct: 200 GKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVSQLITRKGEFETGY 259

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            + GQTREH  LA TLGV +LIV
Sbjct: 260 ERGGQTREHVQLAKTLGVSKLIV 282



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 27/63 (42%), Positives = 45/63 (71%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K H+N+V IGHVD+GKST  G +++  G +D R I+K+EKEA++  + S+  A+++D  
Sbjct: 118 KKRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTN 177

Query: 245 KAE 253
           + E
Sbjct: 178 EEE 180


>UniRef50_Q4E4V1 Cluster: Elongation factor 1-alpha (EF-1-alpha),
           putative; n=3; Trypanosoma|Rep: Elongation factor
           1-alpha (EF-1-alpha), putative - Trypanosoma cruzi
          Length = 664

 Score = 85.0 bits (201), Expect = 1e-15
 Identities = 41/95 (43%), Positives = 60/95 (63%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + Q++    RG+TID   + FET    + I+DAPGH+D++ NMI+  +QAD A+L+V A 
Sbjct: 300 LDQSEEERRRGVTIDAGSYCFETEHRRINILDAPGHKDYVLNMISSATQADAALLVVTAA 359

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           T EFE G++    T+EH  +  TL V +LIV   K
Sbjct: 360 TSEFEVGLAHG--TKEHLFILKTLSVGRLIVAVNK 392



 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 32/62 (51%), Positives = 42/62 (67%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K     V+ GHVD+GKSTT GHL+   G + +  IEK EK A+++  GSFKYAWVLD+ +
Sbjct: 245 KRDCTFVIAGHVDAGKSTTLGHLLLLLGKVSQSEIEKNEKNARQLNSGSFKYAWVLDQSE 304

Query: 248 AE 253
            E
Sbjct: 305 EE 306


>UniRef50_Q8IFW1 Cluster: Elongation factor-1 alpha; n=1; Exoneura
           angophorae|Rep: Elongation factor-1 alpha - Exoneura
           angophorae
          Length = 139

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 37/41 (90%), Positives = 39/41 (95%)
 Frame = +2

Query: 524 TEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           T+PPYSE RFEEIKKEVSSYIKKIGYN A+VAFVPISGWHG
Sbjct: 91  TDPPYSETRFEEIKKEVSSYIKKIGYNTASVAFVPISGWHG 131



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/53 (49%), Positives = 36/53 (67%)
 Frame = +3

Query: 258 AWYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLSG*LRCAHRSCRYR 416
           A YH+RY  +EVR+ ++L  +H  + + RFHQEHDHR+ SG LR    S R+R
Sbjct: 15  ARYHDRYRVVEVRDGEILRDYHRRARSSRFHQEHDHRDESGGLRRVDSSGRHR 67



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 20/28 (71%), Positives = 23/28 (82%)
 Frame = +1

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
           +  +G+ REHALLAFTLGVKQLIVG  K
Sbjct: 60  VDSSGRHREHALLAFTLGVKQLIVGVNK 87


>UniRef50_Q9NCN6 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=1; Sterkiella histriomuscorum|Rep: Eukaryotic
           release factor 3 GTPase subunit - Oxytricha trifallax
           (Sterkiella histriomuscorum)
          Length = 937

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 37/86 (43%), Positives = 55/86 (63%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +G T+++     ET K   TI DAPGH++++ NMI G + AD   L+++A  GEFE+G  
Sbjct: 481 KGKTVEVGRANIETPKKRWTIFDAPGHKNYVPNMIMGAALADFGALVISAKKGEFESGFE 540

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
             GQTREH  LA +LG+ +++V   K
Sbjct: 541 MEGQTREHIQLAKSLGISKIVVAVNK 566



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 30/76 (39%), Positives = 52/76 (68%)
 Frame = +2

Query: 26  TQFVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG 205
           TQ V  +   + + +   ++V IGHVD+GKST +G+L+Y  G +D+RTI+K+++EA+E  
Sbjct: 403 TQVVDEEVIDVDETRQPASLVFIGHVDAGKSTISGNLMYLMGAVDQRTIQKYKEEAKEKN 462

Query: 206 KGSFKYAWVLDKLKAE 253
           + S+  A+V+D  + E
Sbjct: 463 RESWWLAYVMDVSEEE 478


>UniRef50_Q6JIY6 Cluster: Translation elongation factor 1 alpha;
           n=3; Microsporidia|Rep: Translation elongation factor 1
           alpha - Antonospora locustae (Nosema locustae)
          Length = 478

 Score = 83.0 bits (196), Expect = 6e-15
 Identities = 38/83 (45%), Positives = 56/83 (67%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITIDI L +F+  K+   IID PGH+DFIKN +TG +QAD AV +V A   +F A  
Sbjct: 68  KRGITIDITLKEFKLKKFNANIIDCPGHKDFIKNTVTGAAQADVAVALVPA--SDFAAAT 125

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
           S     ++H +++  +G+K+LI+
Sbjct: 126 SPKATLKDHIMISGVMGIKRLII 148



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 32/66 (48%), Positives = 44/66 (66%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           M  +K ++N+ +IGHVDSGKSTT G+L Y+ G  D+R + K + EA   GKG+F YA+  
Sbjct: 1   MEGKKPNLNVCIIGHVDSGKSTTMGNLAYQLGVFDQRQLTKLKAEADSHGKGTFAYAYFF 60

Query: 236 DKLKAE 253
           D   AE
Sbjct: 61  DNTAAE 66


>UniRef50_Q6CFF3 Cluster: Similar to tr|Q9WTY5 Mus musculus ERFS;
           n=1; Yarrowia lipolytica|Rep: Similar to tr|Q9WTY5 Mus
           musculus ERFS - Yarrowia lipolytica (Candida lipolytica)
          Length = 518

 Score = 83.0 bits (196), Expect = 6e-15
 Identities = 39/93 (41%), Positives = 57/93 (61%)
 Frame = +1

Query: 238 QTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           QT    E G+T+DI++ +F        I+DAPGH +F+ NMI G SQAD A++++ +   
Sbjct: 131 QTDEERENGVTVDISVREFSYESREYFILDAPGHYNFVPNMIAGASQADVAIVVLDSLAD 190

Query: 418 EFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
            FE G   +GQT+EHALL   +GV  +I+   K
Sbjct: 191 AFERGFFADGQTKEHALLCRAMGVNHVIIAVNK 223



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 27/59 (45%), Positives = 38/59 (64%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           +N V +GHVD+GKST  G L++  G +    +EK  K A E+GK SF YAW++D+   E
Sbjct: 77  LNAVAVGHVDAGKSTLLGRLLHDTGVVSSHQVEKLAKSASEIGKKSFSYAWLMDQTDEE 135



 Score = 33.9 bits (74), Expect = 3.4
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + + RF+EI  ++  ++ KIGY+   V FVP SG+ G
Sbjct: 229 FDQTRFDEISDQMGLFLSKIGYSD--VQFVPCSGFTG 263


>UniRef50_Q46516 Cluster: ORFC 179; n=1; Desulfurococcus
           mobilis|Rep: ORFC 179 - Desulfurococcus mobilis
          Length = 179

 Score = 83.0 bits (196), Expect = 6e-15
 Identities = 49/88 (55%), Positives = 52/88 (59%)
 Frame = -1

Query: 503 TMSCLTPRVKASKACSRV*PFLEIPASNSPVPAATMSTAQSA*EVPVIMFLMKSLCPGAS 324
           T++   P V AS ACSRV P   IPASNSP  A T   A SA   PVIMFL KSL PGAS
Sbjct: 9   TINWFIPMVLASIACSRVWPSALIPASNSPFLALTTRIAASAWLAPVIMFLTKSLWPGAS 68

Query: 323 MMVT*YLLVSNFQRAISIVIPRSAQPLV 240
           MMV  Y  VSNF     IV PRS    +
Sbjct: 69  MMVKKYFFVSNFMYDSDIVTPRSRSSFI 96



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 25/57 (43%), Positives = 31/57 (54%)
 Frame = -3

Query: 252 SAFSLSNTQAYLKDPLPISWASFSNFSMVRLSIPPHL*IK*PVVVDLPESTCPMTTM 82
           S+F LS++ A LK  LPI   S S    V  S  P      PV+V LP STCP+ T+
Sbjct: 93  SSFILSSSHANLKLSLPIFLDSSSIIFTVFSSKYPRRYSMCPVIVLLPWSTCPIITI 149


>UniRef50_UPI000150A7E9 Cluster: Elongation factor Tu C-terminal
           domain containing protein; n=2; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 646

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 38/81 (46%), Positives = 55/81 (67%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +GIT++     F+ +     ++DAPGH++++ NMI G  QAD A LI++A  GEFEAG  
Sbjct: 283 KGITVECGKAHFQLANKRFVLLDAPGHKNYVPNMIAGACQADVAALIISARQGEFEAGF- 341

Query: 439 KNGQTREHALLAFTLGVKQLI 501
           + GQT+EHA LA  LGV+ +I
Sbjct: 342 EGGQTQEHAHLAKALGVQHMI 362



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 30/69 (43%), Positives = 47/69 (68%)
 Frame = +2

Query: 53  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 232
           K+ +E+  +NIV IGHVD+GKST +G ++  CG +D+  I KFE EA+E  + S+  A++
Sbjct: 214 KVDRERDSVNIVFIGHVDAGKSTLSGRILKNCGEVDETEIRKFELEAKEKNRESWVLAYI 273

Query: 233 LDKLKAELS 259
           +D  + E S
Sbjct: 274 MDINEEERS 282


>UniRef50_UPI0000E47BF2 Cluster: PREDICTED: similar to elongation
           factor 1 alpha; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to elongation factor 1 alpha -
           Strongylocentrotus purpuratus
          Length = 570

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 38/47 (80%), Positives = 42/47 (89%)
 Frame = +1

Query: 376 QADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           +ADCAVL+VAAG GEFEAGISK+GQTREHALL +TLGVKQLIV   K
Sbjct: 333 KADCAVLVVAAGIGEFEAGISKDGQTREHALLCYTLGVKQLIVAVNK 379



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 26/37 (70%), Positives = 31/37 (83%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           Y+E RF+EI +EVS YIKK+GYNP AV F+PISGW G
Sbjct: 385 YNEARFKEIVREVSGYIKKVGYNPKAVPFIPISGWVG 421


>UniRef50_Q4FW53 Cluster: Hsp70 subfamily B suppressor 1; n=3;
           Leishmania|Rep: Hsp70 subfamily B suppressor 1 -
           Leishmania major strain Friedlin
          Length = 647

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 40/86 (46%), Positives = 54/86 (62%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RG+TID   + FET    V I+DAPGH+DF+ NMI+  +QAD A+L+V A   EFE G+ 
Sbjct: 289 RGVTIDSGSFCFETEHRRVHILDAPGHKDFVLNMISSATQADAALLVVTATNSEFETGLH 348

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
               T+ H L+  TLGV  ++V   K
Sbjct: 349 HG--TKSHLLVLKTLGVGSIVVAVNK 372



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 30/64 (46%), Positives = 41/64 (64%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           KEK     V+ GHVD+GKSTT GHL+   G +  + +E+ EK  +   K SFKYAW+LD+
Sbjct: 223 KEKPDCTFVIAGHVDAGKSTTLGHLLLLLGRVSIQDVERNEKADRTHHKDSFKYAWLLDQ 282

Query: 242 LKAE 253
            + E
Sbjct: 283 CEEE 286


>UniRef50_Q96TK8 Cluster: Translation elongation factor 1 alpha;
           n=1; Phellopilus nigrolimitatus|Rep: Translation
           elongation factor 1 alpha - Phellopilus nigrolimitatus
          Length = 134

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 37/45 (82%), Positives = 41/45 (91%)
 Frame = +1

Query: 382 DCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           DCA+LI+A GTGEFEAGISK+GQTREHALLAFTLGV+QLIV   K
Sbjct: 1   DCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNK 45


>UniRef50_Q95UT7 Cluster: Elongation factor 1 alpha short form; n=1;
           Monosiga brevicollis|Rep: Elongation factor 1 alpha
           short form - Monosiga brevicollis
          Length = 208

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 33/62 (53%), Positives = 49/62 (79%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H++IV+ GHVD+GKSTTTG LI++ GGI +R ++K + EA+ +GKGSF +A+ +D+ K
Sbjct: 5   KQHVSIVICGHVDAGKSTTTGRLIFELGGIPEREMQKLKDEAERLGKGSFAFAFYMDRQK 64

Query: 248 AE 253
            E
Sbjct: 65  EE 66



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 26/41 (63%), Positives = 31/41 (75%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 378
           ERG+TI     +F T+  + T+IDAPGHRDFIKNMITG SQ
Sbjct: 68  ERGVTIACTTKEFFTATKHYTVIDAPGHRDFIKNMITGASQ 108


>UniRef50_Q8SRN3 Cluster: TRANSLATION ELONGATION FACTOR 1-ALPHA;
           n=1; Encephalitozoon cuniculi|Rep: TRANSLATION
           ELONGATION FACTOR 1-ALPHA - Encephalitozoon cuniculi
          Length = 424

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 39/83 (46%), Positives = 50/83 (60%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG T ++    FE     V I+DAPGH  F+  MI G ++AD  +L+V+A   EFEAG 
Sbjct: 74  ERGKTTEVGTASFELPHRRVNILDAPGHNQFVFEMINGANRADVGILVVSARINEFEAGF 133

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            K GQTREH  L     V++LIV
Sbjct: 134 EKGGQTREHIFLLKAGSVQRLIV 156



 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 25/57 (43%), Positives = 39/57 (68%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 238
           K  INIV +GHVD+GKST  G ++ + G +D RT+EK+ + ++E  + S+  +W LD
Sbjct: 11  KKVINIVFVGHVDAGKSTICGQILVQMGLVDPRTLEKYRQMSREQNRESWYLSWCLD 67


>UniRef50_Q8SS29 Cluster: TRANSLATION ELONGATION FACTOR 1 ALPHA;
           n=2; Apansporoblastina|Rep: TRANSLATION ELONGATION
           FACTOR 1 ALPHA - Encephalitozoon cuniculi
          Length = 505

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 38/83 (45%), Positives = 54/83 (65%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITI   L    T K+ + I+D PGH+DF+KNM+TG SQAD AV+IV A    FE+ +
Sbjct: 107 KRGITITTTLVNLPTEKFNINILDCPGHKDFVKNMVTGASQADVAVVIVPA--SGFESCV 164

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
              G  + H +++  LG ++LIV
Sbjct: 165 GVGGMLKTHIMISGILGCEKLIV 187



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 33/62 (53%), Positives = 41/62 (66%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  +N   IGHVDSGKSTT G L Y+ G +DKR +EK+EKEA    K +F  A++ DK  
Sbjct: 44  KPRLNACFIGHVDSGKSTTVGMLSYQLGAVDKREMEKYEKEAALNNKETFYLAYLTDKTD 103

Query: 248 AE 253
           AE
Sbjct: 104 AE 105


>UniRef50_A4RWT6 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 481

 Score = 79.0 bits (186), Expect = 9e-14
 Identities = 40/88 (45%), Positives = 56/88 (63%), Gaps = 5/88 (5%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKY-YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           ERG+TID+++ +     +  + ++DAPGH+DF+ N I+G SQAD  VL++    G FE G
Sbjct: 105 ERGVTIDVSMKRCVLDGHRQLVVLDAPGHKDFVPNAISGASQADAGVLVIDGAMGGFENG 164

Query: 433 IS----KNGQTREHALLAFTLGVKQLIV 504
            +      GQTREHA LA  LG+  LIV
Sbjct: 165 FAATPGHTGQTREHARLARALGLHSLIV 192



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 28/78 (35%), Positives = 46/78 (58%)
 Frame = +2

Query: 5   TSYLGYYTQFVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFE 184
           T++ GY      R       E   +++V++GHVD+GKST +G L+Y    +D R + K  
Sbjct: 22  TAFAGYEASSAERA-AYTSPEGGDVHVVILGHVDAGKSTLSGRLMYALKAVDDRAMHKNV 80

Query: 185 KEAQEMGKGSFKYAWVLD 238
           ++++  GK SF +AWV+D
Sbjct: 81  RDSKASGKSSFAWAWVMD 98


>UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial
           precursor; n=1895; cellular organisms|Rep: Elongation
           factor Tu, mitochondrial precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 437

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 39/82 (47%), Positives = 55/82 (67%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI  A  ++ET+K + + +D PGH D+IKNMITG +Q D A+++VAA  G+      
Sbjct: 95  RGITISTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMP---- 150

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +GV+ ++V
Sbjct: 151 ---QTREHLLLARQVGVQHIVV 169



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHL---IYKCGGIDKRTIEKFEKEAQEMGKG 211
           + K H+NI  IGHVD GK+T T  +   +   GG +       +K  +E  +G
Sbjct: 44  RSKPHVNIGTIGHVDHGKTTLTAAITKTLAAKGGANFLDYAAIDKAPEERARG 96


>UniRef50_Q9UVK1 Cluster: SUP35 homolog; n=1; Pichia pastoris|Rep:
           SUP35 homolog - Pichia pastoris (Yeast)
          Length = 315

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 32/62 (51%), Positives = 47/62 (75%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K HI+I+ +GHVD+GKST  G+L+Y  G +DKRTI+K+EKEA++ G+  +  +WV+D  K
Sbjct: 238 KDHISILFMGHVDAGKSTMGGNLLYLTGSVDKRTIDKYEKEAKDAGRQGWYLSWVMDTNK 297

Query: 248 AE 253
            E
Sbjct: 298 EE 299


>UniRef50_A2WJZ4 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 806

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 31/61 (50%), Positives = 44/61 (72%)
 Frame = +2

Query: 71  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 250
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   
Sbjct: 427 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSE 486

Query: 251 E 253
           E
Sbjct: 487 E 487


>UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9;
           Aconoidasida|Rep: Elongation factor tu, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 505

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 40/91 (43%), Positives = 59/91 (64%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           I +T    +RGITI+    ++ET K + + ID PGH D+IKNMITGTSQ D ++L+V+A 
Sbjct: 159 IDKTPEEQKRGITINATHVEYETEKRHYSHIDCPGHLDYIKNMITGTSQMDGSILVVSAY 218

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLIV 504
            G          QT+EH LL+  +G++++IV
Sbjct: 219 DGLMP-------QTKEHVLLSRQIGIEKMIV 242



 Score = 40.3 bits (90), Expect = 0.039
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDK---RTIEKFEKEAQEMGKG 211
           ++K H+NI  IGHVD GK+T T  +   C  +++   ++ E+ +K  +E  +G
Sbjct: 117 RKKPHMNIGTIGHVDHGKTTLTAAITKVCSDLNRGVFKSYEEIDKTPEEQKRG 169


>UniRef50_Q2ABX8 Cluster: Elongation factor 1-alpha; n=1; Megacopta
           punctatissima|Rep: Elongation factor 1-alpha - Megacopta
           punctatissima
          Length = 187

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 542 EPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           + RFEEIKKEVSSYIKKIGYNPA+VAFVPISGWHG
Sbjct: 31  QSRFEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 65


>UniRef50_Q0EDG4 Cluster: Mitochondrial EF-Tu2; n=1; Trichinella
           britovi|Rep: Mitochondrial EF-Tu2 - Trichinella britovi
          Length = 428

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 39/83 (46%), Positives = 52/83 (62%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITI IA   +ET K   +  D PGH+DFIKNMI G +Q D A+L+V A  G      
Sbjct: 74  QRGITISIAHVGYETKKRKYSHTDCPGHKDFIKNMICGATQMDAAILVVDAAEGTMP--- 130

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QTREH +LA  +GV++++V
Sbjct: 131 ----QTREHVMLAKQVGVQRIVV 149


>UniRef50_A4VDD2 Cluster: Elongation factor 1-alpha; n=1;
           Tetrahymena thermophila SB210|Rep: Elongation factor
           1-alpha - Tetrahymena thermophila SB210
          Length = 356

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 31/64 (48%), Positives = 48/64 (75%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K H+++ V G VDSGKSTT GHL++K G +++R I++ +  A++ GK SF +A+V+D+ K
Sbjct: 4   KQHLSVAVFGDVDSGKSTTCGHLVFKLGEVNQRKIDELKALAEKEGKSSFGFAYVMDRTK 63

Query: 248 AELS 259
           AE S
Sbjct: 64  AERS 67



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/36 (58%), Positives = 28/36 (77%)
 Frame = +2

Query: 539 SEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +E RFE IK EVS Y++KIG+N   V+F+PISG+ G
Sbjct: 83  NEERFENIKSEVSLYLQKIGFNLKNVSFIPISGYIG 118


>UniRef50_Q89UE2 Cluster: NodQ bifunctional enzyme; n=12;
           Rhizobiales|Rep: NodQ bifunctional enzyme -
           Bradyrhizobium japonicum
          Length = 638

 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 39/83 (46%), Positives = 51/83 (61%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++GITID    +F T+   + +IDAPGH +F++NMITG SQAD AVLI+ A  G      
Sbjct: 80  DQGITIDTTQIRFRTNSRDIVLIDAPGHAEFLRNMITGASQADGAVLIIDALEG------ 133

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QTR H  L   LGVKQ+ +
Sbjct: 134 -VRDQTRRHGYLLHLLGVKQVAI 155



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/65 (32%), Positives = 38/65 (58%)
 Frame = +2

Query: 59  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 238
           G  +  + IV++GHVD GKST  G L+++ G +    +E  +  +   G   F+++++LD
Sbjct: 15  GTTRPQVRIVIVGHVDHGKSTLVGRLLHETGSLPDGKLEMLKAVSARRGM-PFEWSFLLD 73

Query: 239 KLKAE 253
            L+ E
Sbjct: 74  ALQTE 78


>UniRef50_UPI0000499770 Cluster: elongation factor-1alpha; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: elongation
           factor-1alpha - Entamoeba histolytica HM-1:IMSS
          Length = 544

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 30/57 (52%), Positives = 41/57 (71%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 238
           +T + ++  GHVDSGKSTT GH++ + GG+    IEK +KE  E GK SF+YAWV+D
Sbjct: 130 QTPLTVIFCGHVDSGKSTTVGHILQELGGVTHSQIEKNKKECGEKGKKSFEYAWVMD 186



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           RGITI +   +F+ +   + I+DAPGH DF+   I   ++AD AV++V
Sbjct: 194 RGITISVGAVEFQYNHKNIRILDAPGHTDFLMKTIDAMNEADVAVVVV 241


>UniRef50_Q5BEE6 Cluster: Elongation factor Tu; n=1; Emericella
           nidulans|Rep: Elongation factor Tu - Emericella nidulans
           (Aspergillus nidulans)
          Length = 461

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 37/83 (44%), Positives = 52/83 (62%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITI  A  +F T   +   +D PGH D+IKNMITG +  D A+++VAA  G+     
Sbjct: 98  KRGITISTAHIEFSTDNRHYAHVDCPGHADYIKNMITGAANMDGAIVVVAASDGQMP--- 154

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QTREH LLA  +GV++++V
Sbjct: 155 ----QTREHLLLARQVGVQKIVV 173



 Score = 32.7 bits (71), Expect = 7.9
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTT 127
           + K H+NI  IGHVD GK+T T
Sbjct: 48  RTKPHVNIGTIGHVDHGKTTLT 69


>UniRef50_Q7R087 Cluster: GLP_56_7099_8961; n=2; Giardia
           intestinalis|Rep: GLP_56_7099_8961 - Giardia lamblia
           ATCC 50803
          Length = 620

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 33/68 (48%), Positives = 43/68 (63%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 492
           V + D PGHRDF+ ++I   SQ D AVL++ A   EFE G+S +GQTREH  L    GVK
Sbjct: 233 VFLQDCPGHRDFVPSLIRAVSQPDAAVLVLDASPKEFEKGLSDDGQTREHLQLLMIFGVK 292

Query: 493 QLIVGETK 516
            ++V   K
Sbjct: 293 HIMVAVNK 300



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 24/59 (40%), Positives = 35/59 (59%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 238
           K +  IN++V+GHVD+GKST  GHL    G +  R   + +  A    K +F YA++LD
Sbjct: 139 KSRNTINVLVVGHVDAGKSTIFGHLAVLSGSVSMRERTRTQALADTYNKSTFSYAFLLD 197


>UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu),
           mitochondrial protein 2; n=5; Chromadorea|Rep: Tu
           elongation factor (Ef-tu), mitochondrial protein 2 -
           Caenorhabditis elegans
          Length = 439

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 39/83 (46%), Positives = 52/83 (62%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITI++A   +E+     +  D PGH DFIKNMI GTSQ D AVL++AA  G  E   
Sbjct: 91  KRGITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME--- 147

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QT+EH +LA  +GVK + +
Sbjct: 148 ----QTKEHLILAKQVGVKNMAI 166


>UniRef50_P56893 Cluster: Sulfate adenylyltransferase subunit 1;
           n=7; Rhizobiaceae|Rep: Sulfate adenylyltransferase
           subunit 1 - Rhizobium meliloti (Sinorhizobium meliloti)
          Length = 498

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 37/87 (42%), Positives = 49/87 (56%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T K    + D PGH  + +NM TG S AD AVL+V A  G  E   
Sbjct: 95  EQGITIDVAYRYFATDKRSFIVADTPGHEQYTRNMATGASTADLAVLLVDARVGLLE--- 151

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR HA +A  +G++Q ++   K
Sbjct: 152 ----QTRRHATIATLMGIRQFVLAVNK 174


>UniRef50_Q74CF6 Cluster: Elongation factor Tu GTP binding domain
           protein; n=1; Geobacter sulfurreducens|Rep: Elongation
           factor Tu GTP binding domain protein - Geobacter
           sulfurreducens
          Length = 516

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 38/86 (44%), Positives = 51/86 (59%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           + ITID A   F TS+    IIDAPGH+ F+KNMITG + AD A+L+V    G  E    
Sbjct: 67  QNITIDTASSFFSTSRRRYVIIDAPGHKQFLKNMITGAASADAAILLVDGTEGVRE---- 122

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
              QT+ HA +   LG++Q++V   K
Sbjct: 123 ---QTKRHAHVLSLLGIRQVVVAVNK 145



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 29/94 (30%), Positives = 51/94 (54%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           M + +T + IV++GHVD GKST  G L Y  G I +   ++     +  G+  F++A+++
Sbjct: 1   MSQSET-LKIVIVGHVDHGKSTLIGRLFYDTGSIPEARRQEIAATCKAQGR-PFEFAYLM 58

Query: 236 DKLKAELSVVSQSILLSGSSKLASTMLPSLMLLD 337
           D L+ E     Q+I +  +S   ST     +++D
Sbjct: 59  DALEEER---VQNITIDTASSFFSTSRRRYVIID 89


>UniRef50_Q8WT68 Cluster: Elongation factor-1 alpha; n=3;
           Endopterygota|Rep: Elongation factor-1 alpha -
           Xiphocentron sp. UMSP000029372-Costa Rica
          Length = 366

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 39/86 (45%), Positives = 54/86 (62%)
 Frame = +3

Query: 258 AWYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLSG*LRCAHRSCRYR*IRSWYL 437
           A +H+R+ ++EVR+ QVL  HH  +  Q  HQEHDH +++G LR A R  R+R +R  +L
Sbjct: 23  ARHHHRHRAVEVRDGQVLRDHHRRARPQGLHQEHDHGHVAGGLRRADRGRRHRRVRGGHL 82

Query: 438 *ERSNP*ACLARFHPRCQTAHRRRNK 515
            ER +  A LA  H R Q A RRR +
Sbjct: 83  QERPDARARLAGLHARRQAARRRRQQ 108



 Score = 39.5 bits (88), Expect = 0.069
 Identities = 18/37 (48%), Positives = 25/37 (67%)
 Frame = +1

Query: 535 IQ*AQI*GNQEGSILIHQEDWLQPSCCRFRAHFWMAR 645
           +Q A + G+QEG +++HQED LQP     RAH  +AR
Sbjct: 116 LQRAALRGDQEGGVVVHQEDRLQPGRRGVRAHLGLAR 152


>UniRef50_Q19072 Cluster: Elongation factor Tu homologue precursor
           (Tu elongation factor (Ef- tu), mitochondrial protein
           1); n=7; Nematoda|Rep: Elongation factor Tu homologue
           precursor (Tu elongation factor (Ef- tu), mitochondrial
           protein 1) - Caenorhabditis elegans
          Length = 496

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 38/77 (49%), Positives = 49/77 (63%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+    ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G       
Sbjct: 97  RGITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP---- 152

Query: 439 KNGQTREHALLAFTLGV 489
              QTREH LLA  +GV
Sbjct: 153 ---QTREHLLLARQVGV 166



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARG 98


>UniRef50_UPI0000DD78A4 Cluster: PREDICTED: similar to statin-like;
           n=1; Homo sapiens|Rep: PREDICTED: similar to statin-like
           - Homo sapiens
          Length = 254

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 34/49 (69%), Positives = 38/49 (77%)
 Frame = +1

Query: 370 TSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           + Q DCAVLIVA+G GE EAGISKN Q  EH LLA+TLG+KQLIV   K
Sbjct: 44  SGQEDCAVLIVASGVGECEAGISKNKQICEHTLLAYTLGMKQLIVTVNK 92



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 29/41 (70%), Positives = 31/41 (75%)
 Frame = +2

Query: 524 TEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           TEPPYS   FEEI KEV +YIKKI YN   + FVPISGWHG
Sbjct: 96  TEPPYSSTCFEEISKEVKAYIKKISYNSQTLPFVPISGWHG 136


>UniRef50_Q97MT1 Cluster: GTPase, sulfate adenylate transferase
           subunit 1; n=2; Clostridium|Rep: GTPase, sulfate
           adenylate transferase subunit 1 - Clostridium
           acetobutylicum
          Length = 522

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 36/86 (41%), Positives = 53/86 (61%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +GITIDI + +F T K    IIDAPGH++F+KNMI+G + A+ A+L+V A  G  E    
Sbjct: 67  QGITIDITMIQFFTKKRDYVIIDAPGHKEFLKNMISGAASAEAAILVVDAKEGIQE---- 122

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
              Q++ H  +   LG+K++ V   K
Sbjct: 123 ---QSKRHGYILSLLGIKKVYVAVNK 145



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 26/62 (41%), Positives = 39/62 (62%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           + ++N+V +GHVD GKST  G L+Y    +    IEK +K + E GK  F+YA++LD  +
Sbjct: 4   RENLNVVFVGHVDHGKSTLIGRLLYDTNSLPDGAIEKVKKISAEEGK-KFEYAFLLDAFE 62

Query: 248 AE 253
            E
Sbjct: 63  EE 64


>UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial
           precursor; n=73; cellular organisms|Rep: Elongation
           factor Tu, mitochondrial precursor - Homo sapiens
           (Human)
          Length = 452

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 36/82 (43%), Positives = 50/82 (60%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G       
Sbjct: 104 RGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP---- 159

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +GV+ ++V
Sbjct: 160 ---QTREHLLLARQIGVEHVVV 178



 Score = 37.9 bits (84), Expect = 0.21
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 105


>UniRef50_Q8ZBP2 Cluster: Sulfate adenylyltransferase subunit 1;
           n=20; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit 1 - Yersinia pestis
          Length = 478

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 37/101 (36%), Positives = 53/101 (52%)
 Frame = +1

Query: 214 LQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAV 393
           L + L +   +   E+GITID+A   F T K    I D PGH  + +NM TG S  D A+
Sbjct: 79  LDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCDLAI 138

Query: 394 LIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           L++ A  G  +       QTR H+ +A  LG++ L+V   K
Sbjct: 139 LLIDARKGVLD-------QTRRHSFIATLLGIRHLVVAVNK 172



 Score = 33.5 bits (73), Expect = 4.5
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 2/95 (2%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVL 235
           + KT +  +  G VD GKST  G L++    I +  +     +++ +G    K   A ++
Sbjct: 26  QHKTMLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSTLHTDSKRIGTQGEKLDLALLV 85

Query: 236 DKLKAELSVVSQSILLSGSSKLASTMLPSLMLLDT 340
           D L+AE     Q I +  + +  ST     ++ DT
Sbjct: 86  DGLQAER---EQGITIDVAYRYFSTEKRKFIIADT 117


>UniRef50_A0EFI6 Cluster: Elongation factor Tu; n=3; Paramecium
           tetraurelia|Rep: Elongation factor Tu - Paramecium
           tetraurelia
          Length = 471

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 36/82 (43%), Positives = 51/82 (62%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ A  +++T   +   +D PGH D++KNMITG ++ D A+L+VAA  G       
Sbjct: 78  RGITINSATVEYQTKTRHYGHVDCPGHIDYVKNMITGAAKMDAAILVVAATDGCM----- 132

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LL   +GV+ +IV
Sbjct: 133 --AQTREHVLLCRQVGVETIIV 152



 Score = 33.5 bits (73), Expect = 4.5
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +2

Query: 53  KMGKEKTHINIVVIGHVDSGKSTTT 127
           K  ++K H+N+  IGH+D GK+T T
Sbjct: 24  KFVRDKPHLNVGTIGHIDHGKTTLT 48


>UniRef50_Q45W23 Cluster: Tuf1; n=1; uncultured Pseudonocardia
           sp.|Rep: Tuf1 - uncultured Pseudonocardia sp
          Length = 230

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 36/82 (43%), Positives = 49/82 (59%)
 Frame = +1

Query: 271 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 450
           I IA  +++T K +   +D PGH D++KNMITG +Q D A+L+VAA  G          Q
Sbjct: 1   ISIAHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMP-------Q 53

Query: 451 TREHALLAFTLGVKQLIVGETK 516
           TREH LLA  +GV  ++V   K
Sbjct: 54  TREHVLLARQVGVPYIVVALNK 75


>UniRef50_Q24TA2 Cluster: Adenylylsulfate kinase/sulfate
           adenylyltransferase subunit 1; n=5; Bacteria|Rep:
           Adenylylsulfate kinase/sulfate adenylyltransferase
           subunit 1 - Desulfitobacterium hafniense (strain Y51)
          Length = 614

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 36/82 (43%), Positives = 55/82 (67%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +GITID A   F+T K    IIDAPGH +F+KNM+TG S+A+ A+L++ A     + GI 
Sbjct: 83  QGITIDTARSFFKTGKRDYIIIDAPGHIEFLKNMVTGASRAEAALLVIDA-----KEGIR 137

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
           +N  ++ H  +A  LG++Q++V
Sbjct: 138 EN--SKRHGHIAAMLGIRQVVV 157



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 23/62 (37%), Positives = 39/62 (62%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           +  +NIV++GHVD GKST  G L+   G + +  +E  ++  ++  +  F+YA++LD LK
Sbjct: 20  REQMNIVIVGHVDHGKSTVIGRLLADTGSLPEGKLEAVQEYCRKNAR-PFEYAFLLDALK 78

Query: 248 AE 253
            E
Sbjct: 79  DE 80


>UniRef50_Q7K3V6 Cluster: Elongation factor Tu; n=7; Coelomata|Rep:
           Elongation factor Tu - Drosophila melanogaster (Fruit
           fly)
          Length = 456

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 37/82 (45%), Positives = 51/82 (62%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+     + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+      
Sbjct: 104 RGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP---- 159

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LLA  +G++++IV
Sbjct: 160 ---QTREHLLLAKQVGIQRIIV 178


>UniRef50_Q0YG57 Cluster: Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit; n=2; Geobacter|Rep:
           Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit - Geobacter sp.
           FRC-32
          Length = 619

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 35/83 (42%), Positives = 51/83 (61%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID A   F     +  IIDAPGH++F+KNMI+G ++A+ AVLI+ A  G  E   
Sbjct: 95  EQGITIDTARTFFNWGNRHYIIIDAPGHKEFLKNMISGAARAEAAVLIIDAAEGVAE--- 151

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               Q++ H  +   LG++Q+ V
Sbjct: 152 ----QSKRHGYMLSLLGIRQIAV 170



 Score = 39.9 bits (89), Expect = 0.052
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           + +V +GHVD GKST  G +      +    +EK     ++ GK +F+YA++ D    E
Sbjct: 36  LQVVFVGHVDHGKSTLLGRIYADTDSLPVGQLEKVRAICEQQGK-TFEYAFLFDAFLEE 93


>UniRef50_Q5FSE8 Cluster: Sulfate adenylyltransferase subunit 1 /
           adenylylsulfate kinase; n=1; Gluconobacter oxydans|Rep:
           Sulfate adenylyltransferase subunit 1 / adenylylsulfate
           kinase - Gluconobacter oxydans (Gluconobacter
           suboxydans)
          Length = 626

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 34/83 (40%), Positives = 49/83 (59%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G+T+D     F        I+DAPGHR F++NMITG + A+ AVL+V A  G  E   
Sbjct: 78  DQGVTVDSTRIPFRLGSREFVIVDAPGHRQFLRNMITGAADAEAAVLVVDAKEGAQE--- 134

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QTR HA+L   +G++ +IV
Sbjct: 135 ----QTRRHAMLLRLIGIRHVIV 153



 Score = 40.3 bits (90), Expect = 0.039
 Identities = 18/57 (31%), Positives = 35/57 (61%)
 Frame = +2

Query: 83  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           IV++GHVD GKST  G L+Y    +    + +  + +++ G  + +++++LD L+ E
Sbjct: 21  IVIVGHVDHGKSTLIGRLLYDTDSLQDGKLAQIVESSRKRGL-AVEWSFLLDSLQIE 76


>UniRef50_A4LX06 Cluster: Sulfate adenylyltransferase; n=1;
           Geobacter bemidjiensis Bem|Rep: Sulfate
           adenylyltransferase - Geobacter bemidjiensis Bem
          Length = 408

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 39/86 (45%), Positives = 49/86 (56%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITID +   F +      IID PGHR+FI+NM+TG S A  AVLIV A  G  E    
Sbjct: 69  RGITIDTSQIYFNSKLRPYLIIDTPGHREFIRNMVTGASYAKAAVLIVDAVEGVME---- 124

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
              QTR HA L   +G++++ V   K
Sbjct: 125 ---QTRRHAWLLSIVGIQEICVAVNK 147



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 27/91 (29%), Positives = 47/91 (51%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K+   I + GHVD GKST  G L+Y  G +     ++  + + E G+G  ++A+VLD  +
Sbjct: 6   KSAFPIAITGHVDHGKSTLIGRLLYDTGTLQSGRYQEMLQSSLETGRGD-EFAFVLDAFE 64

Query: 248 AELSVVSQSILLSGSSKLASTMLPSLMLLDT 340
            E     + I +  S    ++ L   +++DT
Sbjct: 65  EER---RRGITIDTSQIYFNSKLRPYLIIDT 92


>UniRef50_Q8ZMF5 Cluster: Sulfate adenylyltransferase subunit 1;
           n=38; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit 1 - Salmonella typhimurium
          Length = 479

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 36/101 (35%), Positives = 53/101 (52%)
 Frame = +1

Query: 214 LQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAV 393
           L + L +   +   E+GITID+A   F T +    I D PGH  + +NM TG S  D A+
Sbjct: 76  LDLALLVDGLQAEREQGITIDVAYRYFSTERRKFIIADTPGHEQYTRNMATGASTCDLAI 135

Query: 394 LIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           L++ A  G  +       QTR H+ ++  LG+K L+V   K
Sbjct: 136 LLIDARKGVLD-------QTRRHSFISTLLGIKHLVVAINK 169


>UniRef50_UPI00006CBD5B Cluster: Elongation factor Tu, mitochondrial
           precursor, putative; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu, mitochondrial
           precursor, putative - Tetrahymena thermophila SB210
          Length = 375

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 35/82 (42%), Positives = 49/82 (59%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ A  ++ET   +   +D PGH D++KNMITG ++ D  +L+ +A  G       
Sbjct: 80  RGITINTATVEYETETRHYGHVDCPGHIDYVKNMITGAAKMDAGILVCSATDGVMP---- 135

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QTREH LL   +GVK +IV
Sbjct: 136 ---QTREHILLCRQVGVKTIIV 154



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +2

Query: 53  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIE 175
           K  + K H+N+  IGH+D GK+T T  +   C   DK+  E
Sbjct: 26  KFQRNKPHLNVGTIGHIDHGKTTLTAAITKICA--DKKLAE 64


>UniRef50_Q5CWA0 Cluster: HBS1 eRFS. GTpase; n=2;
           Cryptosporidium|Rep: HBS1 eRFS. GTpase - Cryptosporidium
           parvum Iowa II
          Length = 530

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 28/51 (54%), Positives = 37/51 (72%)
 Frame = +2

Query: 86  VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 238
           VV+GHVDSGKST  GHL    G I +  + K++KE++ +GKGSF YAW+ D
Sbjct: 85  VVLGHVDSGKSTLMGHLFVSLGLISEGVMRKYKKESEIIGKGSFAYAWIFD 135



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 33/87 (37%), Positives = 49/87 (56%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGITI+I+       K  VTI+DAPGH +FI N  + +  +D  +++V   +G F++G 
Sbjct: 142 ERGITINISAKSMMIEKKLVTILDAPGHSEFIPNSFSISMFSD-NIIVVIDSSG-FDSGF 199

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
            K GQT EH + +    V  +I    K
Sbjct: 200 QK-GQTIEHIIYSLLADVSNIIFAVNK 225


>UniRef50_Q83JX8 Cluster: Sulfate adenylyltransferase subunit 1;
           n=26; Bacteria|Rep: Sulfate adenylyltransferase subunit
           1 - Shigella flexneri
          Length = 475

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 36/101 (35%), Positives = 53/101 (52%)
 Frame = +1

Query: 214 LQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAV 393
           L + L +   +   E+GITID+A   F T K    I D PGH  + +NM TG S  + A+
Sbjct: 76  LDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAI 135

Query: 394 LIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           L++ A  G  +       QTR H+ ++  LG+K L+V   K
Sbjct: 136 LLIDARKGVLD-------QTRRHSFISTLLGIKHLVVAINK 169


>UniRef50_Q8AAP9 Cluster: Sulfate adenylyltransferase subunit 1;
           n=17; Bacteria|Rep: Sulfate adenylyltransferase subunit
           1 - Bacteroides thetaiotaomicron
          Length = 485

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 39/107 (36%), Positives = 54/107 (50%)
 Frame = +1

Query: 196 GNG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS 375
           GN    +   L +   K   E+GITID+A   F T+     I D PGH  + +NMITG S
Sbjct: 62  GNAGEHIDYALLLDGLKAEREQGITIDVAYRYFSTNGRKFIIADTPGHEQYTRNMITGGS 121

Query: 376 QADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
            A+ A+++V A TG          QTR H  L   LG+K +++   K
Sbjct: 122 TANLAIILVDARTGVIT-------QTRRHTFLVSLLGIKHVVLAVNK 161



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 2/95 (2%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGS--FKYAWVL 235
           ++K  + ++  G VD GKST  G L++    + +  ++  E++++ +G       YA +L
Sbjct: 15  EQKDLLRLLTAGSVDDGKSTLIGRLLFDSKKLYEDQLDALERDSKRVGNAGEHIDYALLL 74

Query: 236 DKLKAELSVVSQSILLSGSSKLASTMLPSLMLLDT 340
           D LKAE     Q I +  + +  ST     ++ DT
Sbjct: 75  DGLKAER---EQGITIDVAYRYFSTNGRKFIIADT 106


>UniRef50_UPI00006A2885 Cluster: UPI00006A2885 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2885 UniRef100 entry -
           Xenopus tropicalis
          Length = 315

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 35/81 (43%), Positives = 48/81 (59%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ +  ++ T+  +    D PGH D++KNMITGTSQ D  +L+VAA  G+      
Sbjct: 28  RGITINASHVEYATANRHYAHTDCPGHADYVKNMITGTSQMDGCILVVAATDGQMP---- 83

Query: 439 KNGQTREHALLAFTLGVKQLI 501
              QTREH LLA    +  L+
Sbjct: 84  ---QTREHLLLAKQANIHTLV 101


>UniRef50_A4XJZ8 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Caldicellulosiruptor saccharolyticus DSM
           8903|Rep: Sulfate adenylyltransferase, large subunit -
           Caldicellulosiruptor saccharolyticus (strain ATCC 43494
           / DSM 8903)
          Length = 564

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 33/83 (39%), Positives = 52/83 (62%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++GITID    KF T K    IIDAPGH++F+KNM++G + A+ A+L++ A  G  E   
Sbjct: 66  KQGITIDTTQIKFSTPKRDYLIIDAPGHKEFLKNMVSGAANAEAALLVIDAAEGVQE--- 122

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               Q++ HA +   LG++++ V
Sbjct: 123 ----QSKRHAYILSLLGIQKVYV 141



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 25/59 (42%), Positives = 40/59 (67%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           + IVV+GHVD GKST  G L+Y    + +  IE+ ++ ++E G+  F+YA++LD L+ E
Sbjct: 7   LKIVVVGHVDHGKSTIIGRLLYDTKSVPEAAIERVKRISKEKGR-PFEYAYLLDALEEE 64



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 14/37 (37%), Positives = 26/37 (70%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +SE +F+EIK E+S+++ K+   P    ++P+SG+ G
Sbjct: 151 FSEKKFKEIKYEISTFLSKLNVYPQ--KYIPVSGFLG 185


>UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkaliphilus metalliredigens QYMF|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkaliphilus metalliredigens QYMF
          Length = 615

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 34/82 (41%), Positives = 54/82 (65%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +GITID A   F+T +    IIDAPGH +F+KNM+TG ++A+ A+L++ A     + G+ 
Sbjct: 81  QGITIDSARVFFKTQERKYIIIDAPGHIEFLKNMVTGAARAEVALLVIDA-----KEGVK 135

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
           +N  ++ H  L   LG+KQ++V
Sbjct: 136 EN--SKRHGYLLSMLGIKQVVV 155



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 29/91 (31%), Positives = 53/91 (58%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +++++NIV++GHVD GKST  G L+   G + +  +E+ ++  ++  K  F+YA++LD L
Sbjct: 17  QQSNMNIVIVGHVDHGKSTIIGRLLADTGSLPEGKLEQVKETCRKNAK-PFEYAFLLDAL 75

Query: 245 KAELSVVSQSILLSGSSKLASTMLPSLMLLD 337
           K E    SQ I +  +     T     +++D
Sbjct: 76  KDE---QSQGITIDSARVFFKTQERKYIIID 103


>UniRef50_A4SYY3 Cluster: Sulfate adenylyltransferase, large
           subunit; n=13; Proteobacteria|Rep: Sulfate
           adenylyltransferase, large subunit - Polynucleobacter
           sp. QLW-P1DMWA-1
          Length = 447

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 32/88 (36%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE-AG 432
           E+GITID+A   F T K    + DAPGH  + +N++TG SQ+D AV++V A   +     
Sbjct: 73  EQGITIDVAYRYFSTPKRKFIVADAPGHEQYTRNLVTGASQSDVAVILVDATRVDLSTTP 132

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
            +   QT+ HA +   LG++ ++    K
Sbjct: 133 ATLLAQTKRHAAIVHLLGLRHVVFAINK 160


>UniRef50_Q8TYZ3 Cluster: GTPase-translation elongation factor; n=1;
           Methanopyrus kandleri|Rep: GTPase-translation elongation
           factor - Methanopyrus kandleri
          Length = 459

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 34/87 (39%), Positives = 48/87 (55%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGITID+    FE   Y VT++DAPGH D I+ ++ G    D A+L+VAA  G      
Sbjct: 40  ERGITIDLGFSSFELGDYTVTLVDAPGHADLIRTVVAGAEIIDAAILVVAADEG------ 93

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QT EH ++   LG+ + ++   K
Sbjct: 94  -PQVQTGEHLVVLNHLGIDRGVIALNK 119


>UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular
           organisms|Rep: Elongation factor Tu - Treponema pallidum
          Length = 395

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 34/82 (41%), Positives = 50/82 (60%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+    ++++ + +   ID PGH D++KNMITG +Q D  +L+V+A  G       
Sbjct: 59  RGITINTRHLEYQSDRRHYAHIDCPGHADYVKNMITGAAQMDGGILVVSAPDGVMP---- 114

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QT+EH LLA  +GV  +IV
Sbjct: 115 ---QTKEHLLLARQVGVPSIIV 133



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 3/56 (5%)
 Frame = +2

Query: 53  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG---GIDKRTIEKFEKEAQEMGKG 211
           K  + K H+N+  IGHVD GK+T +  +   C    G  +   ++ +   +E  +G
Sbjct: 5   KFARTKVHMNVGTIGHVDHGKTTLSAAITSYCAKKFGDKQLKYDEIDNAPEEKARG 60


>UniRef50_Q7UMW2 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=24; Bacteria|Rep:
           Bifunctional enzyme cysN/cysC [Includes: Sulfate
           adenylyltransferase subunit 1 (EC 2.7.7.4) (Sulfate
           adenylate transferase) (SAT) (ATP- sulfurylase large
           subunit); Adenylyl-sulfate kinase (EC 2.7.1.25) (APS
           kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)] - Rhodopirellula baltica
          Length = 647

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 33/87 (37%), Positives = 48/87 (55%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T+K    I D PGH  + +NM TG S AD A++++ A  G      
Sbjct: 87  EQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRNMATGASSADLAIILIDARHGVLT--- 143

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR H+ +   LG++ ++V   K
Sbjct: 144 ----QTRRHSFIVSLLGIRHVVVAVNK 166



 Score = 37.9 bits (84), Expect = 0.21
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 2/98 (2%)
 Frame = +2

Query: 53  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYA 226
           K  ++K  +  +  G VD GKST  G L+Y    + +  + K + ++   G   G F  +
Sbjct: 17  KQHEQKQLLRFITCGSVDDGKSTLIGRLLYDSKLVYEDELAKVQSDSVRQGSVAGGFDPS 76

Query: 227 WVLDKLKAELSVVSQSILLSGSSKLASTMLPSLMLLDT 340
             +D LK E     Q I +  + +  ST     ++ DT
Sbjct: 77  LFMDGLKEER---EQGITIDVAYRYFSTAKRKFIIADT 111


>UniRef50_Q9UVK0 Cluster: SUP35 homolog; n=1; Saccharomycodes
           ludwigii|Rep: SUP35 homolog - Saccharomycodes ludwigii
          Length = 305

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 26/50 (52%), Positives = 40/50 (80%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSF 217
           K H++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++ G+  F
Sbjct: 256 KDHMSLLFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRFCF 305


>UniRef50_UPI0000F308E4 Cluster: UPI0000F308E4 related cluster; n=3;
           Laurasiatheria|Rep: UPI0000F308E4 UniRef100 entry - Bos
           Taurus
          Length = 428

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 34/64 (53%), Positives = 38/64 (59%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           K KT    ++ GHVD GKS TTGH IYKC GIDK   EK      E GKGSF+     D 
Sbjct: 3   KNKTRCVSIINGHVDLGKSPTTGHRIYKCDGIDKTATEK-RTRLPETGKGSFESISGSDT 61

Query: 242 LKAE 253
           L+AE
Sbjct: 62  LRAE 65



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 38/85 (44%), Positives = 46/85 (54%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 441
           GIT  I+L +F+TS+ YVTI DA  HRD         +Q    +    AG   FE  I +
Sbjct: 69  GITTGISLRQFKTSRGYVTITDASRHRD-------SHTQDGRRI----AG---FETQIRR 114

Query: 442 NGQTREHALLAFTLGVKQLIVGETK 516
            G+ RE AL   TLGVKQL V  TK
Sbjct: 115 AGRPRERALHTHTLGVKQLSVSATK 139



 Score = 37.9 bits (84), Expect = 0.21
 Identities = 17/41 (41%), Positives = 27/41 (65%)
 Frame = +2

Query: 524 TEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           ++PP S+ +  +  KEVS+++KK G+NP      P SGW+G
Sbjct: 142 SQPPCSQKKTRK-SKEVSTHVKKTGFNPDTACVSP-SGWNG 180


>UniRef50_A6GJE6 Cluster: Sulfate adenylyltransferase, large
           subunit; n=6; Bacteria|Rep: Sulfate adenylyltransferase,
           large subunit - Plesiocystis pacifica SIR-1
          Length = 653

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 34/87 (39%), Positives = 48/87 (55%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T K    I D PGH  + +NM TG S AD A++++ A  G  +   
Sbjct: 111 EQGITIDVAYRYFATKKRKFIIADTPGHVQYTRNMATGASTADAAIILIDARLGVLQ--- 167

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               Q+R HA +A  +G+  L+V   K
Sbjct: 168 ----QSRRHATIANLIGIPHLLVAVNK 190



 Score = 40.7 bits (91), Expect = 0.030
 Identities = 27/93 (29%), Positives = 45/93 (48%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           + ++ +  V IG VD GKST  G L+Y+ GG+ +  +        E G+ S  +A + D 
Sbjct: 47  ERRSLLRFVTIGSVDDGKSTLIGRLLYETGGVFEDQLAAVTSTDGE-GEASINFANLTDG 105

Query: 242 LKAELSVVSQSILLSGSSKLASTMLPSLMLLDT 340
           L AE     Q I +  + +  +T     ++ DT
Sbjct: 106 LVAER---EQGITIDVAYRYFATKKRKFIIADT 135


>UniRef50_A1W6V4 Cluster: Sulfate adenylyltransferase, large
           subunit; n=9; Burkholderiales|Rep: Sulfate
           adenylyltransferase, large subunit - Acidovorax sp.
           (strain JS42)
          Length = 462

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 36/88 (40%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE-AG 432
           E+GITID+A   F T      I DAPGH  + +NM+T  SQAD AV++V A   +++   
Sbjct: 82  EQGITIDVAYRYFATEARKFIIGDAPGHEQYTRNMVTAASQADAAVVLVDATKLDWQNPQ 141

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
           ++   QTR H+LL   L V  L+    K
Sbjct: 142 LTLLPQTRRHSLLVHLLRVHSLVFAVNK 169


>UniRef50_Q10600 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=24; Bacteria|Rep:
           Bifunctional enzyme cysN/cysC [Includes: Sulfate
           adenylyltransferase subunit 1 (EC 2.7.7.4) (Sulfate
           adenylate transferase) (SAT) (ATP- sulfurylase large
           subunit); Adenylyl-sulfate kinase (EC 2.7.1.25) (APS
           kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)] - Mycobacterium tuberculosis
          Length = 614

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 35/87 (40%), Positives = 48/87 (55%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T K    I D PGH  + +NM+TG S A   +++V A  G  E   
Sbjct: 65  EQGITIDVAYRYFATPKRKFIIADTPGHIQYTRNMVTGASTAQLVIVLVDARHGLLE--- 121

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               Q+R HA LA  LG++ L++   K
Sbjct: 122 ----QSRRHAFLASLLGIRHLVLAVNK 144



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 24/90 (26%), Positives = 40/90 (44%)
 Frame = +2

Query: 71  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 250
           T + +   G VD GKST  G L+Y    + +      E+ +++ G      A V D L+A
Sbjct: 3   TLLRLATAGSVDDGKSTLIGRLLYDSKAVMEDQWASVEQTSKDRGHDYTDLALVTDGLRA 62

Query: 251 ELSVVSQSILLSGSSKLASTMLPSLMLLDT 340
           E     Q I +  + +  +T     ++ DT
Sbjct: 63  ER---EQGITIDVAYRYFATPKRKFIIADT 89


>UniRef50_UPI000050FE96 Cluster: COG2895: GTPases - Sulfate
           adenylate transferase subunit 1; n=1; Brevibacterium
           linens BL2|Rep: COG2895: GTPases - Sulfate adenylate
           transferase subunit 1 - Brevibacterium linens BL2
          Length = 448

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 33/87 (37%), Positives = 48/87 (55%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T K    + D PGH  + +NM+TG + AD  V+++ A TG  E   
Sbjct: 79  EQGITIDVAYRYFATDKRSFILADCPGHVQYTRNMVTGATTADAVVVLIDARTGATE--- 135

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR H  +   LG++ +I+   K
Sbjct: 136 ----QTRRHLTVVHRLGIRHVILAINK 158



 Score = 39.5 bits (88), Expect = 0.069
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 2/92 (2%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG--KGSFKYAWVLDK 241
           KT +     G VD GKST  G L++    I    +E   + ++E G   G F +A + D 
Sbjct: 14  KTLLRFATAGSVDDGKSTLVGRLLHDAKAILADQLEAVTRTSEERGFVGGEFDFALLTDG 73

Query: 242 LKAELSVVSQSILLSGSSKLASTMLPSLMLLD 337
           L+AE     Q I +  + +  +T   S +L D
Sbjct: 74  LRAER---EQGITIDVAYRYFATDKRSFILAD 102


>UniRef50_Q08RF5 Cluster: CysN/CysC bifunctional enzyme; n=2;
           Cystobacterineae|Rep: CysN/CysC bifunctional enzyme -
           Stigmatella aurantiaca DW4/3-1
          Length = 574

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 36/87 (41%), Positives = 46/87 (52%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T +  V + D PGH  + +NM TG S AD AV++  A  G      
Sbjct: 110 EQGITIDVAYRYFSTPRRKVIVADTPGHIQYTRNMATGASTADAAVILADARLGVLP--- 166

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR HA +A  LG+  L V   K
Sbjct: 167 ----QTRRHAYIASLLGIPYLAVAVNK 189



 Score = 39.1 bits (87), Expect = 0.091
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGI 157
           +K  + +VV+G VD GKST  G L+Y+C G+
Sbjct: 20  DKELLRLVVVGSVDDGKSTLIGRLLYECDGL 50


>UniRef50_Q9PD78 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=138; root|Rep: Bifunctional
           enzyme cysN/cysC [Includes: Sulfate adenylyltransferase
           subunit 1 (EC 2.7.7.4) (Sulfate adenylate transferase)
           (SAT) (ATP- sulfurylase large subunit); Adenylyl-sulfate
           kinase (EC 2.7.1.25) (APS kinase) (ATP
           adenosine-5'-phosphosulfate 3'-phosphotransferase)] -
           Xylella fastidiosa
          Length = 623

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 33/87 (37%), Positives = 48/87 (55%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F+T K    + D PGH  + +NM TG S AD AV++V A  G      
Sbjct: 79  EQGITIDVAYRYFDTEKRKFIVADCPGHAQYTRNMATGASTADAAVVLVDARKGLLT--- 135

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR H+ +   LG++ +++   K
Sbjct: 136 ----QTRRHSYIVALLGIRHVVLAVNK 158



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 29  QFVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG- 205
           Q VI D  K  + K  +  +  G VD GKST  GHL+Y    + +  +     ++Q  G 
Sbjct: 2   QSVIAD-LKQQEIKPLLRFITCGSVDDGKSTLIGHLLYDSQCLAEDQLADLMVDSQRYGT 60

Query: 206 KGS-FKYAWVLDKLKAE 253
           +G    YA +LD L AE
Sbjct: 61  QGEHIDYALLLDGLAAE 77


>UniRef50_Q82L80 Cluster: Putative sulfate adenylyltransferase large
           subunit; n=1; Streptomyces avermitilis|Rep: Putative
           sulfate adenylyltransferase large subunit - Streptomyces
           avermitilis
          Length = 487

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 35/87 (40%), Positives = 49/87 (56%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T++    + D PGH  + +NM+TG S AD AV++V A  G  E   
Sbjct: 82  EQGITIDVAYRYFATARRRFILADTPGHVQYTRNMVTGASTADLAVVLVDARNGVIE--- 138

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR HA +A  L V  +++   K
Sbjct: 139 ----QTRRHAAVAALLRVPHVVLAVNK 161



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 24/90 (26%), Positives = 41/90 (45%)
 Frame = +2

Query: 71  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 250
           T +     G VD GKST  G L++    +    +E  E+ ++  G+ +   A + D L+A
Sbjct: 20  TLLRFATAGSVDDGKSTLVGRLLHDSKSVLTDQLEAVEQVSRSRGQDAPDLALLTDGLRA 79

Query: 251 ELSVVSQSILLSGSSKLASTMLPSLMLLDT 340
           E     Q I +  + +  +T     +L DT
Sbjct: 80  ER---EQGITIDVAYRYFATARRRFILADT 106


>UniRef50_Q39DS0 Cluster: Sulfate adenylyltransferase, large
           subunit; n=29; Burkholderiaceae|Rep: Sulfate
           adenylyltransferase, large subunit - Burkholderia sp.
           (strain 383) (Burkholderia cepacia (strain ATCC 17760/
           NCIB 9086 / R18194))
          Length = 438

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 32/88 (36%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T+K    I D PGH  + +NM+TG S A  A++++ A     E G+
Sbjct: 74  EQGITIDVAYRYFATAKRKFIIADTPGHEQYTRNMVTGASTAHAAIILIDATRVTIENGV 133

Query: 436 SK-NGQTREHALLAFTLGVKQLIVGETK 516
           +    QT+ H+ +   L ++ +IV   K
Sbjct: 134 ADLLPQTKRHSAIVKLLALQHVIVAINK 161


>UniRef50_Q0A978 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkalilimnicola ehrlichei MLHE-1|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkalilimnicola ehrlichei (strain MLHE-1)
          Length = 558

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 33/87 (37%), Positives = 47/87 (54%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T +    I D PGH  + +NM TG S AD A+L+V A  G      
Sbjct: 82  EQGITIDVAYRYFATERRKFIIADTPGHEQYTRNMATGASTADVAILLVDAAKGLLP--- 138

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR H+ +   LG++ +++   K
Sbjct: 139 ----QTRRHSAICALLGIRSVVLAVNK 161



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 2/90 (2%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 250
           + ++  G VD GKST  G L+Y  G I    +   E+ +   G    S   A ++D L+A
Sbjct: 20  LRLLTCGSVDDGKSTLIGRLLYDAGAIPDDQLAAVERASARYGTTGDSPDLALLVDGLEA 79

Query: 251 ELSVVSQSILLSGSSKLASTMLPSLMLLDT 340
           E     Q I +  + +  +T     ++ DT
Sbjct: 80  ER---EQGITIDVAYRYFATERRKFIIADT 106


>UniRef50_A6GM01 Cluster: Bifunctional sulfate adenylyltransferase
           subunit 1/adenylylsulfate kinase protein; n=1;
           Limnobacter sp. MED105|Rep: Bifunctional sulfate
           adenylyltransferase subunit 1/adenylylsulfate kinase
           protein - Limnobacter sp. MED105
          Length = 575

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 33/87 (37%), Positives = 47/87 (54%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F+T      + D PGH  + +NM+TG S A  AVL++ A  G      
Sbjct: 82  EQGITIDVAYRYFQTDARKFIVADTPGHEQYTRNMVTGASTAHLAVLLIDARKGVLT--- 138

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR HA L   +G++ L++   K
Sbjct: 139 ----QTRRHAFLTQLVGIRHLVLAVNK 161


>UniRef50_Q9RGE9 Cluster: Sulfate adenylyltransferase subunit CysN;
           n=7; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit CysN - Campylobacter jejuni
          Length = 472

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 32/87 (36%), Positives = 48/87 (55%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F ++K    I D PGH  + +NM TG S AD A++++ A  G  +   
Sbjct: 80  EQGITIDVAYRFFTSNKRKFIIADTPGHEQYTRNMATGASTADIAIILIDARKGVLK--- 136

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QT+ H+ +   LG+K  I+   K
Sbjct: 137 ----QTKRHSYIVSLLGIKNFIIAINK 159



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVL 235
           + K     +  G VD GKST  G L+Y    +    +   EK++++MG    K  +A ++
Sbjct: 13  ENKELCRFITCGSVDDGKSTLIGRLLYDTKALFSDQLSTLEKDSKKMGNAGDKLDFALLV 72

Query: 236 DKLKAE 253
           D L +E
Sbjct: 73  DGLASE 78


>UniRef50_Q4QDW8 Cluster: Elongation factor TU, putative; n=5;
           Trypanosomatidae|Rep: Elongation factor TU, putative -
           Leishmania major
          Length = 466

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 33/81 (40%), Positives = 47/81 (58%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           R ITI+    ++E+ K +   ID PGH DF+KNMITG +Q D  +++VAA  G       
Sbjct: 70  RKITINATHVEYESEKRHYGHIDCPGHMDFVKNMITGAAQMDGGIIVVAATDGVMP---- 125

Query: 439 KNGQTREHALLAFTLGVKQLI 501
              QTREH L+   +G+  L+
Sbjct: 126 ---QTREHLLICSQIGLPALV 143


>UniRef50_Q0G239 Cluster: Binfunctional sulfate adenylyltransferase
           subunit 1/adenylylsulfate kinase protein; n=2;
           Aurantimonadaceae|Rep: Binfunctional sulfate
           adenylyltransferase subunit 1/adenylylsulfate kinase
           protein - Fulvimarina pelagi HTCC2506
          Length = 578

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 32/87 (36%), Positives = 47/87 (54%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F +      I D PGH  + +NM TG SQA+ AV++V A  G      
Sbjct: 121 EQGITIDVAYRYFSSENRAFIIADTPGHEQYTRNMATGASQAELAVILVDARKGILP--- 177

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR H+ +   +G+K +++   K
Sbjct: 178 ----QTRRHSFITSLVGIKSVVIAINK 200



 Score = 41.5 bits (93), Expect = 0.017
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 250
           +  +  G VD GKST  G L+Y+   +    +E  EK++++ G   G   +A ++D L A
Sbjct: 59  LRFITCGSVDDGKSTLIGRLLYETNAVFDDQMEALEKDSKKFGTTGGDLDFALLVDGLSA 118

Query: 251 E 253
           E
Sbjct: 119 E 119


>UniRef50_Q25820 Cluster: Elongation factor Tu; n=99; cellular
           organisms|Rep: Elongation factor Tu - Plasmodium
           falciparum
          Length = 410

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 33/82 (40%), Positives = 47/82 (57%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+    ++ET   +   ID PGH D+IKNMI G +Q D A+L+++   G       
Sbjct: 59  RGITINTTHIEYETLTKHCAHIDCPGHSDYIKNMIIGATQMDIAILVISIIDGIMP---- 114

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QT EH LL   +G+K +I+
Sbjct: 115 ---QTYEHLLLIKQIGIKNIII 133



 Score = 33.9 bits (74), Expect = 3.4
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTGHLIY 142
           + K HIN+  IGHVD GK+T T  + Y
Sbjct: 8   RNKQHINLGTIGHVDHGKTTLTTAISY 34


>UniRef50_Q9L9U8 Cluster: Putative ATP sulfurylase large subunit;
           n=2; Proteobacteria|Rep: Putative ATP sulfurylase large
           subunit - Chromatium vinosum (Allochromatium vinosum)
          Length = 434

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 34/87 (39%), Positives = 46/87 (52%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T      I DAPGH  + +NM+T  S A  A+++V A  G      
Sbjct: 75  EQGITIDVAYRYFSTGTRKYIIADAPGHEQYTRNMVTAASTAHLAIILVDARRG------ 128

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR H+ LA  +G+  L+V   K
Sbjct: 129 -VQTQTRRHSYLAHLVGLPHLVVAVNK 154



 Score = 33.9 bits (74), Expect = 3.4
 Identities = 18/59 (30%), Positives = 26/59 (44%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           +  +  G VD GKST  G L+Y    I   T+      +Q  G      + + D L+AE
Sbjct: 15  LRFLTCGSVDDGKSTLIGRLLYDTKAILADTLHAIAATSQRRGLSELDLSLLTDGLQAE 73


>UniRef50_Q0SH95 Cluster: CysN/CysC bifunctional enzyme; n=14;
           Actinomycetales|Rep: CysN/CysC bifunctional enzyme -
           Rhodococcus sp. (strain RHA1)
          Length = 627

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 36/82 (43%), Positives = 46/82 (56%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T      + D PGH  + +NM TG S A  AVL+V A      AG+
Sbjct: 66  EQGITIDVAYRFFSTPTRSFVLADTPGHERYTRNMFTGASNAHVAVLLVDA-----RAGV 120

Query: 436 SKNGQTREHALLAFTLGVKQLI 501
            +  QTR HA +A  LGV  L+
Sbjct: 121 LR--QTRRHARIADLLGVPHLV 140


>UniRef50_Q7M9D1 Cluster: GTPASE, SULFATE ADENYLATE TRANSFERASE
           SUBUNIT 1; n=1; Wolinella succinogenes|Rep: GTPASE,
           SULFATE ADENYLATE TRANSFERASE SUBUNIT 1 - Wolinella
           succinogenes
          Length = 459

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 33/83 (39%), Positives = 53/83 (63%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++GITID A   F++      IIDAPGH +F++NM++G S+A  AVL++ A       G+
Sbjct: 67  KQGITIDSARIFFKSQAREYVIIDAPGHIEFLRNMLSGASRAVAAVLVIDA-----IEGV 121

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
           ++N  ++ H LL   LG+ Q++V
Sbjct: 122 AEN--SKRHGLLLSLLGISQVVV 142



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 22/66 (33%), Positives = 35/66 (53%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           M      +NIV+ GHVD GKST  G L+   G + +  +E   +   +  +  F+Y+ +L
Sbjct: 1   MSAHLERMNIVITGHVDHGKSTLVGRLLADTGSLPQGKLESVRESCAKNAR-PFEYSMLL 59

Query: 236 DKLKAE 253
           D L+ E
Sbjct: 60  DALEDE 65


>UniRef50_A0BL72 Cluster: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 609

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 32/92 (34%), Positives = 50/92 (54%)
 Frame = +1

Query: 241 TKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 420
           TK   E+G+T+D+A            ++D+PGH+DF   +I G +QAD A+L+V      
Sbjct: 230 TKEEKEKGVTMDMAYKTVVIGGRQYNLLDSPGHQDFAPYLIAGAAQADYAILVVDTTKNA 289

Query: 421 FEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           FE  I K+G  RE   L   + +K+++V   K
Sbjct: 290 FENSI-KSGMLREKLQLISAMLIKEIVVALNK 320



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 24/58 (41%), Positives = 37/58 (63%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           +IV++GHVD+GKST TG L+     +D + + K +K+A+ +GK S   A+  D  K E
Sbjct: 176 SIVILGHVDTGKSTLTGRLLQVFKALDDKELRKNQKDAKNLGKESSALAYATDMTKEE 233


>UniRef50_P18905 Cluster: Elongation factor Tu; n=2;
           Coleochaetales|Rep: Elongation factor Tu - Coleochaete
           orbicularis
          Length = 415

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 32/82 (39%), Positives = 50/82 (60%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           R ++I +   ++ET+  + + +D PGH ++I NMITG SQ D A+L+V+A  G       
Sbjct: 62  RNMSIYVHHVEYETAARHYSHLDCPGHVNYINNMITGVSQMDGAILVVSAVDGPM----- 116

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QT+EH LLA  LG+  ++V
Sbjct: 117 --AQTKEHILLAKLLGISSILV 136


>UniRef50_Q2S507 Cluster: Sulfate adenylyltransferase, large subunit
           subfamily, putative; n=5; cellular organisms|Rep:
           Sulfate adenylyltransferase, large subunit subfamily,
           putative - Salinibacter ruber (strain DSM 13855)
          Length = 639

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 33/87 (37%), Positives = 45/87 (51%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T +    I D PGH  + +NM+TG S A+ AV ++ A  G  E   
Sbjct: 73  EQGITIDVAYRYFSTPERKFIIADTPGHEQYTRNMVTGASTAELAVELIDARNGVLE--- 129

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTR H  +   L +  +IV   K
Sbjct: 130 ----QTRRHGFITSLLQIPHVIVAVNK 152



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 25/88 (28%), Positives = 40/88 (45%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAEL 256
           +     G VD GKST  G L+Y    I +  +E+ E+  Q   +   + A + D L+AE 
Sbjct: 14  LRFTTAGSVDDGKSTLIGRLMYDTQEIFEEKMEEIERNTQRDDE-ELELALLTDGLRAER 72

Query: 257 SVVSQSILLSGSSKLASTMLPSLMLLDT 340
               Q I +  + +  ST     ++ DT
Sbjct: 73  ---EQGITIDVAYRYFSTPERKFIIADT 97


>UniRef50_Q4JIN1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; uncultured bacterium
           BAC10-10|Rep: Selenocysteine-specific translation
           elongation factor - uncultured bacterium BAC10-10
          Length = 634

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 35/92 (38%), Positives = 47/92 (51%), Gaps = 6/92 (6%)
 Frame = +1

Query: 259 RGITIDIALWKFE------TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 420
           RGITID+     E      ++ + + I+D PGH DF+KNM+ G    D A+LIVAA  G 
Sbjct: 40  RGITIDLGFAHLEIPSPDPSASFLLGIVDVPGHEDFVKNMVAGVGSIDLALLIVAADDGW 99

Query: 421 FEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
                    QT EH  +    GV+  +V  TK
Sbjct: 100 MP-------QTEEHLQILTYFGVRHAVVALTK 124


>UniRef50_A7H0F4 Cluster: Selenocysteine-specific translation
           elongation factor; n=13; Campylobacter|Rep:
           Selenocysteine-specific translation elongation factor -
           Campylobacter curvus 525.92
          Length = 605

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 33/87 (37%), Positives = 44/87 (50%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGITID++    +     +  ID PGH   +K MI+G    D  +L+VAA  G      
Sbjct: 35  ERGITIDLSFSNLKRGDENIAFIDVPGHESLVKTMISGAFGFDACLLVVAANEGIMP--- 91

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QT+EH  +   LGV  +IV  TK
Sbjct: 92  ----QTKEHINILSLLGVNSIIVAITK 114


>UniRef50_A7PCT1 Cluster: Chromosome chr17 scaffold_12, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr17 scaffold_12, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 304

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 31/73 (42%), Positives = 45/73 (61%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITI +A  ++ET+K +   +D PGH D+ KNMITG +Q D ++ +V A  G      
Sbjct: 204 KRGITIAMAHVEYETAKRHYAHVDCPGHADYEKNMITGAAQMDVSIQVVFAPNGPMP--- 260

Query: 436 SKNGQTREHALLA 474
               +T+EH LLA
Sbjct: 261 ----RTKEHILLA 269


>UniRef50_Q1ITG6 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Acidobacteria bacterium Ellin345|Rep:
           Sulfate adenylyltransferase, large subunit -
           Acidobacteria bacterium (strain Ellin345)
          Length = 543

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 30/82 (36%), Positives = 46/82 (56%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T+K    I D PGH  + +NM TG S +D A++++ A  G      
Sbjct: 89  EQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRNMATGASTSDLAIVLIDARKGVLV--- 145

Query: 436 SKNGQTREHALLAFTLGVKQLI 501
               Q+R H  +A  LG+ +++
Sbjct: 146 ----QSRRHLYIAALLGIPRVV 163



 Score = 36.3 bits (80), Expect = 0.64
 Identities = 24/91 (26%), Positives = 39/91 (42%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 247
           K  + I   G VD GKST  G L+Y    + +  +    +    +G     +A + D L+
Sbjct: 26  KDILRISTAGSVDDGKSTLIGRLLYDSRNVYEDHVRSVTRHDVSLGTSVVDFAQLTDGLR 85

Query: 248 AELSVVSQSILLSGSSKLASTMLPSLMLLDT 340
           AE     Q I +  + +  ST     ++ DT
Sbjct: 86  AER---EQGITIDVAYRYFSTAKRKFIIADT 113


>UniRef50_A0JZN0 Cluster: Sulfate adenylyltransferase, large
           subunit; n=2; Arthrobacter|Rep: Sulfate
           adenylyltransferase, large subunit - Arthrobacter sp.
           (strain FB24)
          Length = 477

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 38/111 (34%), Positives = 53/111 (47%), Gaps = 1/111 (0%)
 Frame = +1

Query: 187 GGPG-NG*RILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMI 363
           GG G  G + + + L     +   E+GITID+A   F T +    + D PGH  + KN +
Sbjct: 69  GGAGATGTKAIDLALLTDGLRAEREQGITIDVAYRYFATDRRSFILADCPGHVQYTKNTV 128

Query: 364 TGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           TG S AD  V+++ A  G  E       QTR H  +   L V  +IV   K
Sbjct: 129 TGASTADAVVVLIDARKGVLE-------QTRRHLSVLQLLRVAHVIVAVNK 172


>UniRef50_Q8NLX2 Cluster: GTPases-Sulfate adenylate transferase
           subunit 1; n=5; Actinomycetales|Rep: GTPases-Sulfate
           adenylate transferase subunit 1 - Corynebacterium
           glutamicum (Brevibacterium flavum)
          Length = 433

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 35/101 (34%), Positives = 51/101 (50%)
 Frame = +1

Query: 214 LQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAV 393
           L + L +   +   E+GITID+A   F T K    + D PGH  + +N +TG S +   V
Sbjct: 65  LDLSLLVDGLRAEREQGITIDVAYRYFATDKRTFILADTPGHVQYTRNTVTGVSTSQVVV 124

Query: 394 LIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           L+V A  G  E       QTR H  ++  LGV+ +I+   K
Sbjct: 125 LLVDARHGVVE-------QTRRHLSVSALLGVRTVILAVNK 158


>UniRef50_Q1MPY9 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Lawsonia intracellularis
           PHE/MN1-00|Rep: Selenocysteine-specific translation
           elongation factor - Lawsonia intracellularis (strain
           PHE/MN1-00)
          Length = 641

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 3/105 (2%)
 Frame = +1

Query: 211 ILQICLGIGQTKG*AE--RGITIDIAL-WKFETSKYYVTIIDAPGHRDFIKNMITGTSQA 381
           ++QI  GI   K   E  RGITID+   +    +   ++IID PGH  FIKNM+ G S  
Sbjct: 18  LVQILTGINCDKLSEEKRRGITIDLGFAYYVSPTGEKLSIIDVPGHEKFIKNMVAGASGI 77

Query: 382 DCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           D  +L++AA  G          QT+EH  +   LG+K   +  TK
Sbjct: 78  DVVMLVIAADEGVMP-------QTKEHIEICSLLGIKHGFIVLTK 115


>UniRef50_A3HVR6 Cluster: Sulfate adenylyltransferase subunit 1;
           n=8; Bacteroidetes|Rep: Sulfate adenylyltransferase
           subunit 1 - Algoriphagus sp. PR1
          Length = 418

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 30/87 (34%), Positives = 46/87 (52%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T K    + D PGH ++ +NM+TG S +  A++++ A  G  E   
Sbjct: 68  EQGITIDVAHIYFNTDKTNFIVADTPGHVEYTRNMVTGASTSQVAIILIDARKGVIE--- 124

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QT  H  +A  L +  ++V   K
Sbjct: 125 ----QTYRHFFIANLLRISHVVVAINK 147



 Score = 40.3 bits (90), Expect = 0.039
 Identities = 21/66 (31%), Positives = 31/66 (46%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           M + +  I I   G VD GKST  G L+Y    +    IE  E+ +++ G     ++   
Sbjct: 1   MSENRKLIKIATAGSVDDGKSTLIGRLLYDTKSLTTDKIEAIERSSKQRGYDYLDFSLAT 60

Query: 236 DKLKAE 253
           D L AE
Sbjct: 61  DGLVAE 66


>UniRef50_Q46497 Cluster: Selenocysteine-specific elongation factor;
           n=4; Desulfovibrionales|Rep: Selenocysteine-specific
           elongation factor - Desulfovibrio baculatus
           (Desulfomicrobium baculatus)
          Length = 634

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFE-TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +RGITI++     + T +  + IID PGH  F+KNM++G +  D  +L++AA  G     
Sbjct: 35  KRGITIELGFAYLDLTPEVRLGIIDVPGHERFVKNMVSGAAGIDFVLLVIAADEGIMP-- 92

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
                QTREH  +   LG++  +V  TK
Sbjct: 93  -----QTREHLEICSLLGIRAGLVALTK 115


>UniRef50_Q30SC0 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Thiomicrospira
           denitrificans ATCC 33889|Rep: Translation elongation
           factor, selenocysteine-specific - Thiomicrospira
           denitrificans (strain ATCC 33889 / DSM 1351)
          Length = 611

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 33/92 (35%), Positives = 44/92 (47%)
 Frame = +1

Query: 241 TKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 420
           TK   ERGITID++          +  ID PGH   +KNMI G    DC +++V+   G 
Sbjct: 31  TKEEQERGITIDLSFSNITKDGKNIAFIDVPGHEKLVKNMIAGAFSFDCVLIVVSVIDG- 89

Query: 421 FEAGISKNGQTREHALLAFTLGVKQLIVGETK 516
                    QT EH  +   LGVK  ++  TK
Sbjct: 90  ------IKPQTIEHLEILNLLGVKNAVLVVTK 115


>UniRef50_Q67QI5 Cluster: Selenocysteine-specific elongation factor;
           n=1; Symbiobacterium thermophilum|Rep:
           Selenocysteine-specific elongation factor -
           Symbiobacterium thermophilum
          Length = 629

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           ERGI+IDI   +F   S     +ID PGH  F++NM+ G +  D  +L+VAA  G     
Sbjct: 36  ERGISIDIGFARFPLPSGRRAAVIDVPGHEKFVRNMLAGITGIDLVILVVAADEGVMP-- 93

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
                QTREH  +   L + + +V  TK
Sbjct: 94  -----QTREHLDILRLLEISKGLVAITK 116


>UniRef50_A3SGF9 Cluster: Translation elongation factor,
           selenocysteine-specific; n=2; Sulfitobacter|Rep:
           Translation elongation factor, selenocysteine-specific -
           Sulfitobacter sp. EE-36
          Length = 623

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 34/86 (39%), Positives = 49/86 (56%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RG++I +     E +   + +IDAPGH DFI+ M++G S A  A+L+V+A       GI+
Sbjct: 37  RGLSIALGFAHCEMAGGTLDLIDAPGHEDFIRTMVSGASGAQGAMLVVSA-----VEGIA 91

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
              QTREH  +A  L V   +V  TK
Sbjct: 92  --AQTREHVQIARLLQVPVAVVAVTK 115


>UniRef50_A1HSM1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Thermosinus carboxydivorans
           Nor1|Rep: Selenocysteine-specific translation elongation
           factor - Thermosinus carboxydivorans Nor1
          Length = 623

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 31/83 (37%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVT-IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           RGI+ID+       +   V  ++D PGH  F+KNM+ GT   D A+L+VAA  G      
Sbjct: 37  RGISIDLGFASLPLADDIVAGVVDVPGHERFLKNMLAGTGGIDMAMLVVAADEGVMP--- 93

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QTREH  +    G+ Q +V
Sbjct: 94  ----QTREHLAMLHLYGISQGVV 112


>UniRef50_Q0ATV7 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Syntrophomonas wolfei subsp.
           wolfei str. Goettingen|Rep: Selenocysteine-specific
           translation elongation factor - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 631

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +RGI+I++    F   S +   I+D PGH  FI++M+ G    D  V ++AA  G     
Sbjct: 36  QRGISIELGFAPFMLPSGHKAAIVDVPGHERFIRHMLAGAFGIDMVVFVIAADEGIMP-- 93

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
                QTREH  +   LGVKQ +V  TK
Sbjct: 94  -----QTREHLDIIELLGVKQGVVAITK 116


>UniRef50_A6CK31 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Bacillus sp. SG-1|Rep:
           Selenocysteine-specific translation elongation factor -
           Bacillus sp. SG-1
          Length = 630

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKF-ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           ERGI+I++      ET    ++++D PGH  FIK MI G +  D  +L+VAA  G     
Sbjct: 38  ERGISIELGFAPLMETEDMDISVVDVPGHEKFIKQMIAGVAGIDLVILVVAADEGVMP-- 95

Query: 433 ISKNGQTREHALLAFTLGVKQLIV 504
                QT+EH  +   LGV   IV
Sbjct: 96  -----QTKEHLEILSFLGVDHGIV 114


>UniRef50_Q57918 Cluster: Selenocysteine-specific elongation factor;
           n=7; Methanococcales|Rep: Selenocysteine-specific
           elongation factor - Methanococcus jannaschii
          Length = 469

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 29/83 (34%), Positives = 44/83 (53%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITID+    F   +Y +T++DAPGH + I+  I   +  D A+L+V A  G      
Sbjct: 46  KRGITIDLGFSSFTLDRYRITLVDAPGHSELIRTAIGAGNIIDAALLVVDAKEG------ 99

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QT EH L+   L +  ++V
Sbjct: 100 -PKTQTGEHLLVLDLLNIPTIVV 121


>UniRef50_Q7VI67 Cluster: Selenocysteine-specific elongation factor
           SelB; n=2; Helicobacteraceae|Rep:
           Selenocysteine-specific elongation factor SelB -
           Helicobacter hepaticus
          Length = 632

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGIT+D++          V  ID PGH   +KNMI G    D  +L++AA  G      
Sbjct: 40  QRGITLDLSFSHLHLPSRNVAFIDVPGHNKLVKNMIAGAFGIDVLLLVIAANEGIMP--- 96

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               Q+ EH L+A  LG+   I   TK
Sbjct: 97  ----QSIEHLLIADMLGISSCICVITK 119


>UniRef50_Q22GX7 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 432

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 31/75 (41%), Positives = 47/75 (62%)
 Frame = +1

Query: 292 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 471
           FE + +   I+D  GH++F+KN+I+G S+A   VLIVAA   E +    +  Q ++  +L
Sbjct: 80  FEMNNHNYEIVDIIGHKNFVKNIISGQSKAH-VVLIVAALQQERDEYDFQFEQIKQQLIL 138

Query: 472 AFTLGVKQLIVGETK 516
           A +LGVKQ+IV   K
Sbjct: 139 AQSLGVKQIIVALNK 153



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 23/67 (34%), Positives = 36/67 (53%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           M K+K  INI+V+G  +SG+STT GH +YK      + ++ F   +Q   +    +   L
Sbjct: 1   MFKKKEIINIIVLGSTNSGRSTTVGHFLYKLSKECPQLLQYFNTTSQITEEKDIDFTIPL 60

Query: 236 DKLKAEL 256
             L+ EL
Sbjct: 61  KNLQFEL 67



 Score = 36.3 bits (80), Expect = 0.64
 Identities = 12/37 (32%), Positives = 25/37 (67%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +SE  F  +K ++ +Y+ +I +NP ++ ++P+SG  G
Sbjct: 159 FSENEFTLMKNQIDNYLHEIKFNPESIFYIPVSGVKG 195


>UniRef50_Q8XIK3 Cluster: Selenocysteine-specific elongation factor;
           n=8; Clostridia|Rep: Selenocysteine-specific elongation
           factor - Clostridium perfringens
          Length = 635

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 35/88 (39%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +RGI+I++    F+  S     IID PGH  FIKNM+ G +  D  +LI+A      + G
Sbjct: 36  KRGISINLGFTFFDLPSGKRAGIIDVPGHEKFIKNMLAGATSLDVVLLIIA-----LDEG 90

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
           I    QT+EH  +   L VK+ IV  TK
Sbjct: 91  IMP--QTKEHLEILELLEVKKCIVALTK 116


>UniRef50_Q2LU53 Cluster: Selenocysteine-specific protein
           translation Elongation Factor; n=1; Syntrophus
           aciditrophicus SB|Rep: Selenocysteine-specific protein
           translation Elongation Factor - Syntrophus
           aciditrophicus (strain SB)
          Length = 636

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVT-IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           ERGITI++           +  ++D PGH  F+KNM+ G +  D  ++++AA  G     
Sbjct: 36  ERGITIELGFASLRLRNGQICGVVDVPGHERFVKNMVAGAAGIDMVLMVIAADEGVMP-- 93

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
                QTREH  +   L +++ +V  TK
Sbjct: 94  -----QTREHLQICSLLNIRKGLVALTK 116


>UniRef50_A7QN79 Cluster: Chromosome undetermined scaffold_131,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_131, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 355

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 23/63 (36%), Positives = 39/63 (61%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +G T+++    FE      TI+DA GH++++ NMI+G SQ D  +L++ A   +FE G  
Sbjct: 62  KGKTVEVGRAHFEPETTRFTILDAWGHKNYVPNMISGASQVDIGMLVIYAQKVKFETGGE 121

Query: 439 KNG 447
           ++G
Sbjct: 122 RSG 124


>UniRef50_A7Q762 Cluster: Chromosome chr5 scaffold_58, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_58, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 177

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 22/49 (44%), Positives = 34/49 (69%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           +RGITI     ++ET+K +   +D PGH D++KNMITG +Q D ++ +V
Sbjct: 100 KRGITIATTHVEYETAKRHCDHVDCPGHADYVKNMITGAAQMDGSIQVV 148


>UniRef50_Q8TVI5 Cluster: Translation elongation factor, GTPase;
           n=1; Methanopyrus kandleri|Rep: Translation elongation
           factor, GTPase - Methanopyrus kandleri
          Length = 358

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/54 (44%), Positives = 33/54 (61%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           E G+TI+ A    E     V+ +D PGHRD+I+NM+     AD A+L+VAA  G
Sbjct: 44  EMGVTIEPARAFLELGDTTVSFVDVPGHRDYIRNMLASAWSADYAILVVAADEG 97


>UniRef50_Q74GZ1 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Proteobacteria|Rep:
           Selenocysteine-specific translation elongation factor -
           Geobacter sulfurreducens
          Length = 636

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 31/87 (35%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +1

Query: 259 RGITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           RGITI++     E        I+D PGH  F++ M+ G    D  +L++AA  G      
Sbjct: 37  RGITIELGFAHLELPGGLQFGIVDVPGHERFVRTMVAGVGGMDLVMLVIAADEGVMP--- 93

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTREH  +   LGVK+ +V  TK
Sbjct: 94  ----QTREHLEICQLLGVKKGLVALTK 116


>UniRef50_A6DB59 Cluster: Putative selenocysteine-specific
           elongation factor; n=1; Caminibacter mediatlanticus
           TB-2|Rep: Putative selenocysteine-specific elongation
           factor - Caminibacter mediatlanticus TB-2
          Length = 607

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 35/87 (40%), Positives = 43/87 (49%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGITID++    +     V  ID PGH   +KNMI+G    D    + A  T E   GI
Sbjct: 36  ERGITIDLSFTNMKKGDVNVAFIDVPGHEKLVKNMISGAFGFDAT--LFAIDTNE---GI 90

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QT EH  +   L VK +IV  TK
Sbjct: 91  MP--QTIEHLEVLDILKVKNIIVALTK 115


>UniRef50_A7PSI5 Cluster: Chromosome chr6 scaffold_28, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_28, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 154

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 28/61 (45%), Positives = 37/61 (60%)
 Frame = -3

Query: 462 MLTGLTVLRDTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLASFELPE 283
           MLTGLT+L +T               ISLRG+ DHVLDE+++SRSIND  +  +  +LP 
Sbjct: 75  MLTGLTILGNTKSMIR---------TISLRGTSDHVLDEVTMSRSINDSAVTFSGLKLPR 125

Query: 282 S 280
           S
Sbjct: 126 S 126


>UniRef50_A0YH51 Cluster: Selenocysteine-specific elongation factor;
           n=1; marine gamma proteobacterium HTCC2143|Rep:
           Selenocysteine-specific elongation factor - marine gamma
           proteobacterium HTCC2143
          Length = 642

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 29/87 (33%), Positives = 43/87 (49%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RG+TI++           V  ID PGH+ FI NM+TG +  D A+L++AA  G      
Sbjct: 33  KRGLTIELGFAYHHNEDIAVGFIDVPGHQKFIANMLTGIAALDLALLVIAADDGPMP--- 89

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QT EH      +G+ +  +  TK
Sbjct: 90  ----QTYEHLAALNLMGLTRAAIVITK 112


>UniRef50_Q931D5 Cluster: SelB selenocysteine-specific elongation
           factor; n=4; Alphaproteobacteria|Rep: SelB
           selenocysteine-specific elongation factor - Rhizobium
           meliloti (Sinorhizobium meliloti)
          Length = 666

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 35/87 (40%), Positives = 45/87 (51%), Gaps = 1/87 (1%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVT-IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           RGITID+       +K  VT  +D PGH  FI  M+ G    D A+L+VAA     + GI
Sbjct: 34  RGITIDLGFAYARFAKDAVTGFVDVPGHERFIHTMLAGAGGIDYAMLVVAA-----DDGI 88

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QT EH  +   LGV + +V  TK
Sbjct: 89  KP--QTLEHLAILDLLGVSRGLVAITK 113


>UniRef50_Q1ETS8 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=6; Clostridiales|Rep: Translation elongation
           factor, selenocysteine-specific:Small GTP- binding
           protein domain - Clostridium oremlandii OhILAs
          Length = 631

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +RGI+I++    F+  S     IID PGH  FI+NM+ G S  D  +L+VAA  G     
Sbjct: 36  KRGISIELGFTYFDLPSGKRAGIIDVPGHEKFIRNMLAGVSGMDIVLLVVAADEGVMP-- 93

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
                QT+EH  +   L +++ I+  TK
Sbjct: 94  -----QTKEHLDILSLLKIEKGIIVITK 116


>UniRef50_A6BIM9 Cluster: Putative uncharacterized protein; n=1;
           Dorea longicatena DSM 13814|Rep: Putative
           uncharacterized protein - Dorea longicatena DSM 13814
          Length = 637

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +1

Query: 259 RGITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           RGITID+    F+        I+D PGH  FI NM+ G    D  +L++AA  G      
Sbjct: 37  RGITIDLGFTYFDLPGGDRAGIVDVPGHEKFINNMVAGVVGMDLVLLVIAADEGIMP--- 93

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QTREH  +   LG+++ I+
Sbjct: 94  ----QTREHMDILNLLGIEKSII 112


>UniRef50_Q73LA2 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Treponema denticola|Rep:
           Selenocysteine-specific translation elongation factor -
           Treponema denticola
          Length = 590

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 1/55 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKY-YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RG+TI++     E   +  V I+D PGH  FI+NM+ GT   D A+LIVAA  G
Sbjct: 35  KRGMTIELGFASLEDPVHGTVGIVDVPGHERFIRNMVAGTWGLDAALLIVAADDG 89


>UniRef50_Q1AUJ9 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Rubrobacter xylanophilus DSM
           9941|Rep: Selenocysteine-specific translation elongation
           factor - Rubrobacter xylanophilus (strain DSM 9941 /
           NBRC 16129)
          Length = 612

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 25/67 (37%), Positives = 39/67 (58%)
 Frame = +1

Query: 316 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 495
           +++D PGH  F+KNM+ G++  D  +L++AA  G          QTREH  +   LGV++
Sbjct: 61  SLVDVPGHERFVKNMVAGSTGVDAFLLVIAADDGVMP-------QTREHLDVLRVLGVER 113

Query: 496 LIVGETK 516
            +V  TK
Sbjct: 114 GVVALTK 120


>UniRef50_Q47F25 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Dechloromonas aromatica
           RCB|Rep: Translation elongation factor,
           selenocysteine-specific - Dechloromonas aromatica
           (strain RCB)
          Length = 627

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 32/86 (37%), Positives = 43/86 (50%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGIT+D+      T  +    ID PGH   I NM+ G +  D A+L++AA  G       
Sbjct: 34  RGITVDLGYAYTPTLGF----IDVPGHEKLIHNMLAGATGIDFALLVIAADDGPMP---- 85

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
              QTREH  +   LG+K+  V  TK
Sbjct: 86  ---QTREHLEIIELLGIKRGAVALTK 108


>UniRef50_A0LHL0 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Syntrophobacter fumaroxidans
           MPOB|Rep: Selenocysteine-specific translation elongation
           factor - Syntrophobacter fumaroxidans (strain DSM 10017
           / MPOB)
          Length = 642

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 31/87 (35%), Positives = 44/87 (50%), Gaps = 1/87 (1%)
 Frame = +1

Query: 259 RGITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           RGITI++     +      + I+D PGH  F+K+M+ G +  D   L++AA  G      
Sbjct: 37  RGITIELGFAHMDLPDGNRLGIVDVPGHERFVKHMVAGATGIDLVALVIAADEGVMP--- 93

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTREH  +   L VKQ +V  TK
Sbjct: 94  ----QTREHMEICELLRVKQGLVVLTK 116


>UniRef50_Q74NG5 Cluster: NEQ270; n=1; Nanoarchaeum equitans|Rep:
           NEQ270 - Nanoarchaeum equitans
          Length = 396

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/68 (38%), Positives = 37/68 (54%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 492
           ++++DAPGH   I  M++G +  D AVL+VAA  G          QT EH   A  +G+K
Sbjct: 79  ISLVDAPGHESLIMVMLSGAALVDAAVLVVAANEGIMP-------QTIEHLKAAEIMGIK 131

Query: 493 QLIVGETK 516
             IV + K
Sbjct: 132 HFIVAQNK 139


>UniRef50_Q3E0L1 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=1; Chloroflexus aurantiacus J-10-fl|Rep:
           Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain - Chloroflexus aurantiacus J-10-fl
          Length = 622

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 31/84 (36%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 ERGITIDIAL-WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +R +TID+   W        V++ID PGH  FIKNM+ G    D  +L++AA     EA 
Sbjct: 40  QREMTIDLGFAWLTLPGGREVSLIDVPGHERFIKNMLAGVGGIDAVLLVIAAD----EAV 95

Query: 433 ISKNGQTREHALLAFTLGVKQLIV 504
           +    QTREH  +   L ++  IV
Sbjct: 96  MP---QTREHLAIIDLLAIRHGIV 116


>UniRef50_Q1NKM4 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=3; Deltaproteobacteria|Rep: Translation
           elongation factor, selenocysteine-specific:Small GTP-
           binding protein domain - delta proteobacterium MLMS-1
          Length = 639

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 28/88 (31%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFETS-KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +RGITI++     +    + + I+D PGH  F++NM+ G +  D    +VAA  G     
Sbjct: 36  KRGITIELGFAHLDLPCGHRLGIVDVPGHERFVRNMVAGAAGIDLVAFVVAADEGIMP-- 93

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
                QTREH  +   LG+++ ++  TK
Sbjct: 94  -----QTREHFEICRLLGIQRGLIVITK 116


>UniRef50_Q1IHM2 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Acidobacteria|Rep:
           Selenocysteine-specific translation elongation factor -
           Acidobacteria bacterium (strain Ellin345)
          Length = 628

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 33/91 (36%), Positives = 46/91 (50%), Gaps = 5/91 (5%)
 Frame = +1

Query: 259 RGITIDIALWKFETS-----KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 423
           RGITIDI     E +     K  +  +D PGH  FI+NM+ G    D  +LI++A     
Sbjct: 37  RGITIDIGFANLELAAASGEKLRIGFVDVPGHERFIRNMLAGVGGIDLVMLIISA----- 91

Query: 424 EAGISKNGQTREHALLAFTLGVKQLIVGETK 516
           E  I    QTREH  +   LG+++ +   TK
Sbjct: 92  EESIKP--QTREHFDICRMLGIERGLTVLTK 120


>UniRef50_Q1FK57 Cluster: Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit; n=3;
           Clostridiales|Rep: Small GTP-binding protein
           domain:Sulfate adenylyltransferase, large subunit -
           Clostridium phytofermentans ISDg
          Length = 563

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 25/87 (28%), Positives = 41/87 (47%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITID+A   F T      + D PGH ++ +NM  G S A   ++++ A  G      
Sbjct: 66  EQGITIDVAYRYFTTKNRSFIVADTPGHEEYTRNMAVGASFAQLTIILIDAKQGVLL--- 122

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QT+ H+ +   +G+   +    K
Sbjct: 123 ----QTKRHSRICSFMGIHHFVFAVNK 145



 Score = 36.3 bits (80), Expect = 0.64
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 2/90 (2%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIY--KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 250
           +  +  G VD GKST  GH++Y  K    D+      + +    G G   Y+ +LD L+A
Sbjct: 5   LKFITCGSVDDGKSTLIGHILYDSKLLYTDQENALMLDSKVGSRG-GEIDYSLLLDGLEA 63

Query: 251 ELSVVSQSILLSGSSKLASTMLPSLMLLDT 340
           E     Q I +  + +  +T   S ++ DT
Sbjct: 64  ER---EQGITIDVAYRYFTTKNRSFIVADT 90


>UniRef50_Q18YZ1 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Desulfitobacterium
           hafniense|Rep: Selenocysteine-specific translation
           elongation factor - Desulfitobacterium hafniense (strain
           DCB-2)
          Length = 634

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +1

Query: 259 RGITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           RG+TI++        S   V+IID PGH  F+K M+ G +  D  +L++AA  G      
Sbjct: 37  RGMTIELGFASLTLPSGQIVSIIDVPGHEKFVKTMVAGVTGIDLVMLVIAADEGIMP--- 93

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTREH  +   L V   ++  TK
Sbjct: 94  ----QTREHLDILNLLNVTTGVIALTK 116


>UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS
           (Tet(S)); n=345; root|Rep: Tetracycline resistance
           protein tetS (Tet(S)) - Listeria monocytogenes
          Length = 641

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  A+  F+     V I+D PGH DF+ ++    S  D A+L+++A  G
Sbjct: 51  QRGITIQTAITSFQRENVKVNIVDTPGHMDFLADVYRSLSVLDGAILLISAKDG 104



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGI 157
           INI ++ HVD+GK+T T  L+Y  G I
Sbjct: 4   INIGILAHVDAGKTTLTESLLYSSGAI 30


>UniRef50_Q663U2 Cluster: Selenocysteine-specific elongation factor
           EF; n=11; Yersinia|Rep: Selenocysteine-specific
           elongation factor EF - Yersinia pseudotuberculosis
          Length = 657

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 32/89 (35%), Positives = 42/89 (47%), Gaps = 2/89 (2%)
 Frame = +1

Query: 256 ERGITIDI--ALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 429
           +RG+TID+  A W     +  +  ID PGH  F+ NM+ G    D A+L+VA   G    
Sbjct: 33  QRGMTIDLGYAYWPLPDGRI-MGFIDVPGHEKFLANMLAGVGGIDHALLVVACDDGVM-- 89

Query: 430 GISKNGQTREHALLAFTLGVKQLIVGETK 516
                 QTREH  +    G   L V  TK
Sbjct: 90  -----AQTREHLAILRLSGRPALTVALTK 113


>UniRef50_A5KED2 Cluster: Elongation factor, putative; n=1;
           Plasmodium vivax|Rep: Elongation factor, putative -
           Plasmodium vivax
          Length = 833

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/55 (38%), Positives = 37/55 (67%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           +NI+V+GH+D+GKST  G L+Y    + ++T++K+E   +     S KY ++LD+
Sbjct: 118 LNILVLGHIDAGKSTLIGALLYNLSYVSEQTVKKYEHVRE-----SSKYTFILDE 167



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 492
           V I D PGH + + N+ T +  AD A+L+V A          KN +T  +  +   +G+ 
Sbjct: 257 VNIFDTPGHNELVTNLHTWSFFADTAILVVDAN----NIYSKKNDETYRNVSILKAVGIS 312

Query: 493 QLIVGETK 516
            +IV   K
Sbjct: 313 NVIVAVNK 320


>UniRef50_Q2B7L6 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Bacillus sp. NRRL B-14911|Rep:
           Selenocysteine-specific translation elongation factor -
           Bacillus sp. NRRL B-14911
          Length = 618

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 ERGITIDIALWK-FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           ER I+I+      +E     V++ID PGH  FI+ MI G +  D  +L+VAA  G     
Sbjct: 29  ERQISIEPGFAPLYEDEDLEVSVIDVPGHERFIRQMIAGVAGIDLVILVVAADEGVMP-- 86

Query: 433 ISKNGQTREHALLAFTLGVKQLIV 504
                QT+EH  +   LG+++ IV
Sbjct: 87  -----QTKEHLQILGFLGIEKGIV 105


>UniRef50_A6P2V2 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 629

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 27/69 (39%), Positives = 38/69 (55%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +  ++D PGH  FI+NM++G + A   +L V AG G          QTREH  L   LG+
Sbjct: 55  WADLVDVPGHEKFIRNMLSGAAGAGGVLLTVDAGKGIMP-------QTREHLALCALLGM 107

Query: 490 KQLIVGETK 516
           ++ IV  TK
Sbjct: 108 ERGIVALTK 116


>UniRef50_A4E707 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 655

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = +1

Query: 259 RGITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           RG+T+++   +    S   V ++D PGH  +++ M+ G +  D AVL+V+A  G      
Sbjct: 45  RGMTVELGFGELALPSGKIVGLVDVPGHSHYLRAMVQGATGIDVAVLVVSAVEGVMP--- 101

Query: 436 SKNGQTREHALLAFTLGVKQLIVGET 513
               QTREH  +   LGV  ++V  T
Sbjct: 102 ----QTREHVHVLELLGVTHMVVALT 123


>UniRef50_A1JVG8 Cluster: Elongation factor 1-alpha; n=2; Gibberella
           fujikuroi|Rep: Elongation factor 1-alpha - Gibberella
           fujikuroi var. intermedia
          Length = 87

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 33/83 (39%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = +2

Query: 83  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW--VLDKLKAEL 256
           ++VIGHVDSGKSTT   L        ++   +  +E + +       +    L   +  +
Sbjct: 1   VLVIGHVDSGKSTTDRSLDLPVRWY-RQANHREVREGKPLSSVRVPSSTPGFLTSSRPSV 59

Query: 257 SVVSQSILLSGSSKLASTMLPSL 325
           SVVS SILLSGSS+L +TM PSL
Sbjct: 60  SVVSPSILLSGSSRLLATMSPSL 82


>UniRef50_P43927 Cluster: Selenocysteine-specific elongation factor;
           n=21; Pasteurellaceae|Rep: Selenocysteine-specific
           elongation factor - Haemophilus influenzae
          Length = 619

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 30/87 (34%), Positives = 44/87 (50%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RG+TID+           +  ID PGH  F+ NM+ G      A+LIVAA     + G+
Sbjct: 33  KRGMTIDLGYAYLPLENKVLGFIDVPGHEKFLSNMLAGLGGVHYAMLIVAA-----DEGV 87

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
           +   QT+EH  +   L   ++IV  TK
Sbjct: 88  AV--QTKEHLAILRQLQFHEIIVVITK 112


>UniRef50_Q6MAV2 Cluster: Probable peptide chain release factor 3;
           n=2; Chlamydiae/Verrucomicrobia group|Rep: Probable
           peptide chain release factor 3 - Protochlamydia
           amoebophila (strain UWE25)
          Length = 533

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGI+I  +  +F  +   + ++D PGH DF ++     + ADCA++++ A  G
Sbjct: 67  ERGISITASAMQFTYNNTIINVLDTPGHEDFSEDTYRTLTAADCAIMVIDAAKG 120


>UniRef50_Q46455 Cluster: Selenocysteine-specific elongation factor;
           n=5; Clostridia|Rep: Selenocysteine-specific elongation
           factor - Moorella thermoacetica (Clostridium
           thermoaceticum)
          Length = 634

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 30/88 (34%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           ERGI+I++        S   + ++D PGH  FI+ M+ G    D  +L+VAA  G     
Sbjct: 36  ERGISIELGFAPLTLPSGRQLGLVDVPGHERFIRQMLAGVGGMDLVMLVVAADEGVMP-- 93

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
                QTREH  +   L +K+ I+  TK
Sbjct: 94  -----QTREHLAIIDLLQIKKGIIVITK 116


>UniRef50_A7HHY2 Cluster: Selenocysteine-specific translation
           elongation factor precursor; n=5; Cystobacterineae|Rep:
           Selenocysteine-specific translation elongation factor
           precursor - Anaeromyxobacter sp. Fw109-5
          Length = 649

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 30/87 (34%), Positives = 41/87 (47%), Gaps = 1/87 (1%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVT-IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           RGITI++           V  ++D PGH  F++ M  G    D  VL++AA  G      
Sbjct: 37  RGITIELGFAHLPLPDGTVAGVVDVPGHERFVRAMAAGAGGIDLVVLVIAADEGVMP--- 93

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QTREH  +   LGV + +V  TK
Sbjct: 94  ----QTREHLDICRLLGVPRGLVAVTK 116


>UniRef50_P14081 Cluster: Selenocysteine-specific elongation factor;
           n=33; Enterobacteriaceae|Rep: Selenocysteine-specific
           elongation factor - Escherichia coli (strain K12)
          Length = 614

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 32/89 (35%), Positives = 41/89 (46%), Gaps = 2/89 (2%)
 Frame = +1

Query: 256 ERGITIDI--ALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 429
           +RG+TID+  A W     +     ID PGH  F+ NM+ G    D A+L+VA   G    
Sbjct: 33  KRGMTIDLGYAYWPQPDGRV-PGFIDVPGHEKFLSNMLAGVGGIDHALLVVACDDGVM-- 89

Query: 430 GISKNGQTREHALLAFTLGVKQLIVGETK 516
                 QTREH  +    G   L V  TK
Sbjct: 90  -----AQTREHLAILQLTGNPMLTVALTK 113


>UniRef50_Q8F2N6 Cluster: Peptide chain release factor 3; n=8;
           Bacteria|Rep: Peptide chain release factor 3 -
           Leptospira interrogans
          Length = 590

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           E+GI+I  A  +FE S + + ++D PGH DF ++       AD AV+++ AG G
Sbjct: 127 EKGISITSAALQFEYSGHVLNLLDTPGHEDFSEDTYRTLIAADTAVMVLDAGKG 180


>UniRef50_A1FN34 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Pseudomonas|Rep:
           Selenocysteine-specific translation elongation factor -
           Pseudomonas putida W619
          Length = 640

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 31/89 (34%), Positives = 42/89 (47%), Gaps = 2/89 (2%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKY--YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 429
           ERG+TID+       ++       ID PGH  FI NM+ G    D  +L+VAA  G    
Sbjct: 33  ERGMTIDLGYRYAALAEGAPLTGFIDVPGHERFIHNMLAGAHGIDLVLLVVAADDGVMP- 91

Query: 430 GISKNGQTREHALLAFTLGVKQLIVGETK 516
                 QTREH  +   LG+   +V  +K
Sbjct: 92  ------QTREHLAIIELLGIPLALVAISK 114


>UniRef50_A0Z3R3 Cluster: Selenocysteine-specific elongation factor;
           n=1; marine gamma proteobacterium HTCC2080|Rep:
           Selenocysteine-specific elongation factor - marine gamma
           proteobacterium HTCC2080
          Length = 641

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 31/84 (36%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 ERGITIDIAL-WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           ERG++I++   +  + S   +  ID PGHR FI  MI+G S  D  +L+VAA  G     
Sbjct: 33  ERGLSINLGYAFLPQGSDETLGFIDVPGHRKFINTMISGISGVDMGLLVVAADDGPMP-- 90

Query: 433 ISKNGQTREHALLAFTLGVKQLIV 504
                QT EH  +   LGV+ + V
Sbjct: 91  -----QTLEHIDVLEILGVESVCV 109


>UniRef50_A7QC01 Cluster: Chromosome chr10 scaffold_76, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr10 scaffold_76, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 112

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 19/50 (38%), Positives = 32/50 (64%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 408
           +G T+++    FE      TI+DA GH++ + NMI+  SQAD  +L+++A
Sbjct: 54  KGKTVEVGRAHFEPEMTRFTILDASGHKNHVPNMISSASQADMGMLVISA 103


>UniRef50_UPI0000EB403C Cluster: UPI0000EB403C related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB403C UniRef100
           entry - Canis familiaris
          Length = 300

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/41 (56%), Positives = 29/41 (70%)
 Frame = +2

Query: 524 TEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           TE  YS+ R +E  +E S+YIKKIGY+P  VAF  IS W+G
Sbjct: 15  TESSYSQKRDKEPVRE-STYIKKIGYHPDTVAFASISIWNG 54


>UniRef50_Q0BZB1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Hyphomonas neptunium ATCC
           15444|Rep: Selenocysteine-specific translation
           elongation factor - Hyphomonas neptunium (strain ATCC
           15444)
          Length = 623

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/82 (35%), Positives = 44/82 (53%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RG++I       +     + ++DAPGH++FI+ M+ G + A  A L+V+A  G  EA   
Sbjct: 37  RGLSITSGFAYLKGGDANIDLVDAPGHQNFIRAMVGGAAGARSAALVVSAAEG-VEA--- 92

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QT EH  +  TLG+   IV
Sbjct: 93  ---QTLEHIAVIETLGIHAGIV 111


>UniRef50_Q7URR0 Cluster: Translation initiation factor IF-2; n=1;
           Pirellula sp.|Rep: Translation initiation factor IF-2 -
           Rhodopirellula baltica
          Length = 1038

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/69 (39%), Positives = 35/69 (50%)
 Frame = +1

Query: 211 ILQICLGIGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCA 390
           +L   +GI   KG A  GIT  I  +K +     VT +D PGH  F +    G +  D A
Sbjct: 547 LLDHLVGINVVKGEAG-GITQHIRAYKIDKDGRAVTFVDTPGHEAFTEMRARGANVTDIA 605

Query: 391 VLIVAAGTG 417
           VL+VAA  G
Sbjct: 606 VLVVAADDG 614


>UniRef50_A7CTC1 Cluster: Peptide chain release factor 3; n=2;
           Bacteria|Rep: Peptide chain release factor 3 -
           Opitutaceae bacterium TAV2
          Length = 544

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGI++   + +F+   Y V ++D PGH+DF ++     +  D A++++ AG G
Sbjct: 62  QRGISVSSTVLQFDYQGYAVNLLDTPGHKDFSEDTYRVLTAVDAALMVIDAGKG 115


>UniRef50_A7PFT2 Cluster: Chromosome chr11 scaffold_14, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr11 scaffold_14, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 247

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 20/26 (76%), Positives = 24/26 (92%)
 Frame = +1

Query: 424 EAGISKNGQTREHALLAFTLGVKQLI 501
           +AGISK+GQTREHALLA  LGV+Q+I
Sbjct: 90  QAGISKDGQTREHALLALILGVRQMI 115


>UniRef50_Q7R7M3 Cluster: Elongation factor Tu family, putative;
           n=6; Plasmodium|Rep: Elongation factor Tu family,
           putative - Plasmodium yoelii yoelii
          Length = 597

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 20/55 (36%), Positives = 36/55 (65%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 241
           +NI+V+GH+D+GKST  G L+Y    ++ + ++K+E   +     S KY ++LD+
Sbjct: 107 LNILVLGHIDAGKSTLIGALLYNLNYVNDQMLKKYENIRE-----SSKYTYILDE 156



 Score = 39.9 bits (89), Expect = 0.052
 Identities = 20/64 (31%), Positives = 33/64 (51%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 492
           V I D PGH + + N+ T +  ADCA+L+V A          KN +T  +  +   +G+ 
Sbjct: 226 VNIFDTPGHNELVNNLHTCSFFADCAILVVDAN----NVYNKKNDETYRNVCILKYVGIS 281

Query: 493 QLIV 504
            +I+
Sbjct: 282 NIII 285


>UniRef50_UPI000050FBE9 Cluster: COG3276: Selenocysteine-specific
           translation elongation factor; n=1; Brevibacterium
           linens BL2|Rep: COG3276: Selenocysteine-specific
           translation elongation factor - Brevibacterium linens
           BL2
          Length = 607

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +1

Query: 256 ERGITIDIAL-WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RG+TID+   W    S   +  +D PGH  F+ NM+ G   A    L+VAA  G
Sbjct: 37  KRGLTIDLGFAWTTLPSGRELAFVDVPGHEKFLANMLAGVGPAPIVCLVVAADKG 91


>UniRef50_O67141 Cluster: Elongation factor SelB; n=1; Aquifex
           aeolicus|Rep: Elongation factor SelB - Aquifex aeolicus
          Length = 582

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 33/89 (37%), Positives = 42/89 (47%), Gaps = 2/89 (2%)
 Frame = +1

Query: 256 ERGITIDI--ALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 429
           +RG++IDI  A   F      + IID PGH  FIKN I G   A   +L+V    G    
Sbjct: 36  KRGLSIDIGFAYIDFPDINTRLEIIDVPGHERFIKNAIAGICSASGLILVVDPNEGIMP- 94

Query: 430 GISKNGQTREHALLAFTLGVKQLIVGETK 516
                 QT EH  +A + G+K  I   TK
Sbjct: 95  ------QTIEHLRVAKSFGIKHGIAVLTK 117


>UniRef50_A0YGX4 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; marine gamma
           proteobacterium HTCC2143|Rep: Translation elongation
           factor, selenocysteine-specific - marine gamma
           proteobacterium HTCC2143
          Length = 627

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 31/87 (35%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +1

Query: 259 RGITIDIAL-WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           RG++I++   +K       +  ID PGH  FI +MI G    D A+L+VAA  G      
Sbjct: 34  RGLSINLGYAFKKLDDGQVIGFIDVPGHTRFINSMIAGVGGIDMAMLVVAADDGVMP--- 90

Query: 436 SKNGQTREHALLAFTLGVKQLIVGETK 516
               QT EH  +   LG +Q +V  TK
Sbjct: 91  ----QTTEHLDVLRLLGQQQFVVVITK 113


>UniRef50_Q4G4A5 Cluster: Elongation factor 1A; n=86; Eukaryota|Rep:
           Elongation factor 1A - Echinostelium minutum
          Length = 237

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/20 (85%), Positives = 18/20 (90%)
 Frame = +2

Query: 587 KKIGYNPAAVAFVPISGWHG 646
           KKIGYNP  +AFVPISGWHG
Sbjct: 1   KKIGYNPEKIAFVPISGWHG 20


>UniRef50_A5Z9F8 Cluster: Putative uncharacterized protein; n=1;
           Eubacterium ventriosum ATCC 27560|Rep: Putative
           uncharacterized protein - Eubacterium ventriosum ATCC
           27560
          Length = 535

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGI++  +  +F    Y + I+D PGH+DF ++       AD AV+++ A  G
Sbjct: 68  ERGISVTSSALQFNYEGYCINILDTPGHQDFSEDTYRTLMAADSAVMVIDASKG 121


>UniRef50_A4X2G5 Cluster: Selenocysteine-specific translation
           elongation factor; n=3; Actinomycetales|Rep:
           Selenocysteine-specific translation elongation factor -
           Salinispora tropica CNB-440
          Length = 604

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = +1

Query: 259 RGITIDIAL-WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           RG+TID+   W    +++    +D PGH+ F+ NM+ G       + +VAA  G
Sbjct: 35  RGMTIDLGFAWTTLDNEHMTAFVDVPGHQRFVSNMLAGVGPVTAVLFVVAADEG 88


>UniRef50_Q5WBK2 Cluster: Translation elongation factor G; n=1;
           Bacillus clausii KSM-K16|Rep: Translation elongation
           factor G - Bacillus clausii (strain KSM-K16)
          Length = 647

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGIT+  A   F  +   V IID PGH DFI  +    +  D A+LIV+A  G
Sbjct: 51  ERGITVKAAAVSFFWNDVKVNIIDTPGHADFISEVEHALTILDGAILIVSAVEG 104



 Score = 33.9 bits (74), Expect = 3.4
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGI 157
           INI V+ HVD+GK+T T  ++Y+ G I
Sbjct: 4   INIGVLAHVDAGKTTLTEQMLYQAGVI 30


>UniRef50_Q67MT5 Cluster: Peptide chain release factor 3; n=13;
           Bacteria|Rep: Peptide chain release factor 3 -
           Symbiobacterium thermophilum
          Length = 528

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGI++  ++ +FE     V I+D PGH+DF ++       AD AV+++ A  G
Sbjct: 63  QRGISVTTSVMQFEYGGCMVNILDTPGHQDFSEDTYRTLEAADSAVMLIDAAKG 116


>UniRef50_A5KIG4 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus torques ATCC 27756|Rep: Putative
           uncharacterized protein - Ruminococcus torques ATCC
           27756
          Length = 883

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI     +F  +   +TI+D PGH DF   M       DCAVL+V+A  G
Sbjct: 29  ERGITIFSKQAEFIWNDTSITILDTPGHVDFSAEMERVLQVLDCAVLVVSAVDG 82


>UniRef50_A0X1J6 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Shewanella pealeana ATCC
           700345|Rep: Selenocysteine-specific translation
           elongation factor - Shewanella pealeana ATCC 700345
          Length = 635

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 30/88 (34%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           +RG+TI++     + S    +  +D PGH  FI  M+ G S A  A+LI+A   G     
Sbjct: 33  QRGMTIELGYAFMDLSDGERLAFVDVPGHSKFINTMLAGVSCAKHALLIIACDDGVMP-- 90

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
                QT EH  +   L ++ LIV  TK
Sbjct: 91  -----QTYEHLAILQLLNLEHLIVVLTK 113


>UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog;
           n=93; Bacteria|Rep: GTP-binding protein TypA/BipA
           homolog - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 611

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 30/83 (36%), Positives = 39/83 (46%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGITI       +  KY + IID PGH DF   +    S  D  +L+V A  G      
Sbjct: 55  ERGITILAKNTAIQWKKYRINIIDTPGHADFGGEVERILSMVDSVLLVVDALEGPMP--- 111

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QTR     AF+ G+K ++V
Sbjct: 112 ----QTRFVTQKAFSYGIKPIVV 130


>UniRef50_Q8TJT7 Cluster: Translation initiation factor 2 subunit
           gamma; n=48; Archaea|Rep: Translation initiation factor
           2 subunit gamma - Methanosarcina acetivorans
          Length = 443

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/68 (30%), Positives = 37/68 (54%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 492
           V+ +DAPGH   +  M++G +  D AVL++AA             QT+EH +    +G+K
Sbjct: 118 VSFVDAPGHETLMATMLSGAAIMDGAVLVIAANEE------CPQPQTKEHLMALDIIGIK 171

Query: 493 QLIVGETK 516
            +++ + K
Sbjct: 172 NIVIVQNK 179


>UniRef50_A6G2B2 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Plesiocystis pacifica
           SIR-1|Rep: Translation elongation factor,
           selenocysteine-specific - Plesiocystis pacifica SIR-1
          Length = 696

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 23/76 (30%), Positives = 39/76 (51%)
 Frame = +1

Query: 289 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 468
           K   +  ++ I+D PGH   ++ M+ G    D  +L+++A     E G+    QTREH  
Sbjct: 64  KKRAAPLHLGIVDVPGHEALVRTMVAGAGGMDAVLLVISA-----EDGVMP--QTREHLH 116

Query: 469 LAFTLGVKQLIVGETK 516
           +   LG++  +V  TK
Sbjct: 117 VCELLGLRHAVVALTK 132


>UniRef50_A3Q882 Cluster: Selenocysteine-specific translation
           elongation factor; n=6; Mycobacterium|Rep:
           Selenocysteine-specific translation elongation factor -
           Mycobacterium sp. (strain JLS)
          Length = 570

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 25/86 (29%), Positives = 38/86 (44%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RG+TID+     +     +  +D PGH  F+ NM+ G       + +VAA  G       
Sbjct: 35  RGLTIDLGFAWADIGGREMAFVDVPGHERFVANMLAGVGPVPAVMFVVAATEGWMP---- 90

Query: 439 KNGQTREHALLAFTLGVKQLIVGETK 516
              Q+ EH      LGV+  ++  TK
Sbjct: 91  ---QSEEHLAALDALGVRHALLIVTK 113


>UniRef50_Q8I592 Cluster: Elongation factor g, putative; n=1;
           Plasmodium falciparum 3D7|Rep: Elongation factor g,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 803

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
 Frame = +1

Query: 256 ERGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 423
           E+GITI  A    +W+    KY + IID PGH DF   +       D A+L++   +G  
Sbjct: 95  EKGITIQSATTNCVWEINNKKYNINIIDTPGHVDFTIEVERSLRVLDSAILVICGVSGVQ 154

Query: 424 EAGISKNGQ 450
              ++ N Q
Sbjct: 155 SQTLTVNRQ 163


>UniRef50_Q7Q3I6 Cluster: ENSANGP00000010178; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000010178 - Anopheles gambiae
           str. PEST
          Length = 682

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 23/71 (32%), Positives = 32/71 (45%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGITI  A   F   +Y + ++D PGH DF   +       D  V+I+    G     +
Sbjct: 51  ERGITICSAAVSFNWKEYRINLLDTPGHIDFTMEVEQSLGAVDGTVIILDGSAGVEAQTV 110

Query: 436 SKNGQTREHAL 468
           +  GQ   H L
Sbjct: 111 TVWGQADRHRL 121



 Score = 33.1 bits (72), Expect = 6.0
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGID 160
           NI ++ H+D+GK+TTT  ++Y  G  D
Sbjct: 5   NIGILAHIDAGKTTTTERMLYYSGRTD 31


>UniRef50_Q4Y6S3 Cluster: Elongation factor g, putative; n=4;
           Plasmodium|Rep: Elongation factor g, putative -
           Plasmodium chabaudi
          Length = 776

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
 Frame = +1

Query: 256 ERGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 423
           E+GITI  A    +W    +KY + IID PGH DF   +       D AVL++   +G  
Sbjct: 93  EKGITIQSAATHCVWNVNNNKYDINIIDTPGHVDFTIEVERSLRVLDAAVLVICGVSGVQ 152

Query: 424 EAGISKNGQ 450
              ++ N Q
Sbjct: 153 SQTLTVNRQ 161


>UniRef50_A4YIX9 Cluster: Protein synthesis factor, GTP-binding;
           n=1; Metallosphaera sedula DSM 5348|Rep: Protein
           synthesis factor, GTP-binding - Metallosphaera sedula
           DSM 5348
          Length = 415

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 24/68 (35%), Positives = 37/68 (54%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 492
           V+ +DAPGH   +  M++GT+  D A+L+VAA             QTREH +     G+ 
Sbjct: 89  VSFVDAPGHEVLMATMLSGTAILDGAILVVAANEP------FPQPQTREHFVALGIAGIN 142

Query: 493 QLIVGETK 516
           +LI+ + K
Sbjct: 143 KLIIVQNK 150


>UniRef50_Q0LF89 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Herpetosiphon aurantiacus ATCC
           23779|Rep: Selenocysteine-specific translation
           elongation factor - Herpetosiphon aurantiacus ATCC 23779
          Length = 627

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +1

Query: 259 RGITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           R +T+D+    F T + + V ++D PGH   IKNM+ G +  D  + +VAA  G      
Sbjct: 36  RQMTLDLGFAWFSTPAGHSVNLVDVPGHERLIKNMLAGVTGFDGVLFVVAADEG------ 89

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               Q+ EH  +   LG++  ++
Sbjct: 90  -MQPQSHEHLQILNQLGIEHGLI 111


>UniRef50_A0KL71 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Aeromonas|Rep:
           Selenocysteine-specific translation elongation factor -
           Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966
           / NCIB 9240)
          Length = 627

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +1

Query: 262 GITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           G+T D+    F+  +   + +ID PGH  +I+NM+ G    D  +L++AA  G       
Sbjct: 39  GMTQDLGFAHFDDGQGNTIGVIDVPGHERYIRNMVAGLWSLDLVLLVIAADEGWMP---- 94

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
               T +H  L   +GV +L+V
Sbjct: 95  ---MTGDHLRLLKAMGVPRLLV 113


>UniRef50_Q55002 Cluster: Oxytetracycline resistance protein; n=2;
           Streptomyces|Rep: Oxytetracycline resistance protein -
           Streptomyces rimosus
          Length = 663

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 23/54 (42%), Positives = 29/54 (53%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  A+  F      V +ID PGH DFI  +       D AVL+V+A  G
Sbjct: 51  QRGITIRSAVATFVLDDLKVNLIDTPGHSDFISEVERALGVLDGAVLVVSAVEG 104


>UniRef50_O36041 Cluster: Eukaryotic translation initiation factor 2
           subunit gamma; n=1; Spironucleus vortens|Rep: Eukaryotic
           translation initiation factor 2 subunit gamma -
           Spironucleus vortens
          Length = 210

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 22/69 (31%), Positives = 39/69 (56%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +++IID PGH D++  M++G +  D  +L+++A     E    +  QTREH       G 
Sbjct: 80  HISIIDCPGHHDYMTTMLSGVAAMDGTLLLISA-----EQRCPQE-QTREHFQAIQATGQ 133

Query: 490 KQLIVGETK 516
           K++I+ + K
Sbjct: 134 KKIIIAQNK 142


>UniRef50_Q8TXJ4 Cluster: Elongation factor 2 (EF-2) [Contains: Mka
           fusA intein]; n=192; Archaea|Rep: Elongation factor 2
           (EF-2) [Contains: Mka fusA intein] - Methanopyrus
           kandleri
          Length = 1257

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 4/58 (6%)
 Frame = +1

Query: 256 ERGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITID A    + ++E  +Y + +ID PGH DF  ++       D A+++V A  G
Sbjct: 589 ERGITIDAANVSMVHEYEGEEYLINLIDTPGHVDFSGDVTRAMRAVDGAIVVVCAVEG 646


>UniRef50_A4FHF5 Cluster: Tetracycline resistance protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: Tetracycline
           resistance protein - Saccharopolyspora erythraea (strain
           NRRL 23338)
          Length = 594

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 22/54 (40%), Positives = 29/54 (53%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  A+  F      V +ID PGH DFI  +       D AVL+++A  G
Sbjct: 51  QRGITIRSAVVSFVVGDVAVNLIDTPGHPDFIAEVERALGVLDGAVLVISAVEG 104


>UniRef50_Q6AJD2 Cluster: Peptide chain release factor 3; n=41;
           Bacteria|Rep: Peptide chain release factor 3 -
           Desulfotalea psychrophila
          Length = 528

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 15/54 (27%), Positives = 33/54 (61%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGI++  ++ KF   ++ + ++D PGH+DF ++     +  D A++++ +  G
Sbjct: 64  ERGISVTTSVMKFTYREHEINLLDTPGHQDFSEDTYRVLTAVDSAIMVIDSAKG 117


>UniRef50_Q8UFQ0 Cluster: Tetracycline resistance protein, tetM/tetO
           subfamily; n=2; Rhizobium/Agrobacterium group|Rep:
           Tetracycline resistance protein, tetM/tetO subfamily -
           Agrobacterium tumefaciens (strain C58 / ATCC 33970)
          Length = 649

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 22/54 (40%), Positives = 29/54 (53%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  A+  F      V +ID PGH DFI  +       D AV++V+A  G
Sbjct: 51  QRGITIRAAVVSFTIGDTVVNLIDTPGHPDFIAEVERVLGLLDAAVVVVSAVEG 104



 Score = 32.7 bits (71), Expect = 7.9
 Identities = 12/29 (41%), Positives = 21/29 (72%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDK 163
           +N+ ++ HVD+GK++ T  L++  G IDK
Sbjct: 4   LNLGILAHVDAGKTSLTERLLFDVGVIDK 32


>UniRef50_Q1Z854 Cluster: Hypothetical selenocysteine-specific
           translation elongation factor; n=4; Vibrionaceae|Rep:
           Hypothetical selenocysteine-specific translation
           elongation factor - Photobacterium profundum 3TCK
          Length = 616

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +1

Query: 262 GITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           G+T D+    F+      + +ID PGH  +++NM+ G    +  +L+VAA  G       
Sbjct: 46  GMTQDLGFAHFQDDHGNTIGVIDVPGHERYLRNMVAGVWHLNALILVVAADEGWMP---- 101

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
               T  H  +A  +G++++I+
Sbjct: 102 ---MTTSHVQVAHAMGIEEIIL 120


>UniRef50_Q4U972 Cluster: Translation elongation factor 1-alpha,
           putative; n=3; Theileria|Rep: Translation elongation
           factor 1-alpha, putative - Theileria annulata
          Length = 577

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 21/64 (32%), Positives = 35/64 (54%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 492
           V +ID PGH D I+N++ G   A+ A++IV   + +            EH LL + LG++
Sbjct: 188 VNVIDTPGHHDLIQNLVMGAVFANSAIIIV--DSNDVLKSDFFGVYFSEHMLLLYLLGIR 245

Query: 493 QLIV 504
            +I+
Sbjct: 246 YIII 249



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDKR 166
           +N+VV+G VD+GKST  GH +     +DK+
Sbjct: 98  LNVVVLGAVDAGKSTLLGHFLTLTNCVDKK 127


>UniRef50_Q8EWU0 Cluster: Translation initiation factor IF-2; n=2;
           Mycoplasmataceae|Rep: Translation initiation factor IF-2
           - Mycoplasma penetrans
          Length = 620

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 265 ITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           IT  I  ++ E  K+ +T  D PGH  F K    G    D  VL+VAA  G
Sbjct: 161 ITQSIGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDG 211


>UniRef50_Q1IY97 Cluster: Peptide chain release factor 3; n=1;
           Deinococcus geothermalis DSM 11300|Rep: Peptide chain
           release factor 3 - Deinococcus geothermalis (strain DSM
           11300)
          Length = 567

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGI+I  +   FE +  ++ ++D PGH+DF ++     + AD A++++ A  G
Sbjct: 105 QRGISISSSALTFEYAGRHINLLDTPGHQDFSEDTYRTLTAADSALMVLDAARG 158


>UniRef50_Q0HP29 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Shewanella|Rep:
           Selenocysteine-specific translation elongation factor -
           Shewanella sp. (strain MR-4)
          Length = 673

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 30/88 (34%), Positives = 42/88 (47%), Gaps = 2/88 (2%)
 Frame = +1

Query: 259 RGITIDIALWKFETSK--YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 432
           RG+TID+  + F   +    +  ID PGH  FI NM+ G S    A+L++A   G     
Sbjct: 34  RGMTIDLG-YAFMPLRDGTRLAFIDVPGHEKFINNMLVGVSHVRHALLVLACDDGVMP-- 90

Query: 433 ISKNGQTREHALLAFTLGVKQLIVGETK 516
                QTREH  +   L +  L +  TK
Sbjct: 91  -----QTREHLQILALLPLNSLTLVLTK 113


>UniRef50_Q9WZN3 Cluster: Translation initiation factor IF-2; n=5;
           Thermotogaceae|Rep: Translation initiation factor IF-2 -
           Thermotoga maritima
          Length = 690

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 21/54 (38%), Positives = 27/54 (50%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           E GIT  I  ++ E +   +T ID PGH  F +    G    D  VL+VAA  G
Sbjct: 210 EGGITQSIGAYQVEVNGKKITFIDTPGHELFTEMRARGAQATDIVVLVVAADDG 263


>UniRef50_Q7WHG2 Cluster: Translation initiation factor IF-2; n=225;
           Proteobacteria|Rep: Translation initiation factor IF-2 -
           Bordetella bronchiseptica (Alcaligenes bronchisepticus)
          Length = 997

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 20/52 (38%), Positives = 25/52 (48%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           GIT  I  +  ET +  VT +D PGH  F      G    D  +L+VAA  G
Sbjct: 532 GITQHIGAYHVETGRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDG 583


>UniRef50_Q5PAJ5 Cluster: Translation initiation factor IF-2; n=3;
           Anaplasma|Rep: Translation initiation factor IF-2 -
           Anaplasma marginale (strain St. Maries)
          Length = 832

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 20/53 (37%), Positives = 27/53 (50%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           RGIT  I  ++ +     +T +D PGH  F      GT+  D  VL+VAA  G
Sbjct: 364 RGITQHIGAYQIDVDGKKITFLDTPGHEAFSDMRARGTNVTDIVVLVVAADDG 416


>UniRef50_UPI0000E87FA9 Cluster: translation initiation factor IF-2;
           n=1; Methylophilales bacterium HTCC2181|Rep: translation
           initiation factor IF-2 - Methylophilales bacterium
           HTCC2181
          Length = 816

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 21/52 (40%), Positives = 25/52 (48%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           GIT  I  +  ETSK  +T +D PGH  F      G    D  VL VA+  G
Sbjct: 350 GITQHIGAYHVETSKGMITFLDTPGHEAFSAMRARGAKATDIVVLAVASDDG 401


>UniRef50_Q5GBH8 Cluster: TetT; n=2; Lactobacillales|Rep: TetT -
           Enterococcus faecalis (Streptococcus faecalis)
          Length = 651

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 21/54 (38%), Positives = 29/54 (53%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  +   F  +   V IID PGH DFI  +       D A+L+++A  G
Sbjct: 51  DRGITIRASTVSFNYNDTKVNIIDTPGHMDFIAEVERTLKVLDGAILVISAKEG 104



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 77  INIVVIGHVDSGKSTTTGHLIYKCGGIDK 163
           INI ++ HVD+GK+T T  L+YK G I+K
Sbjct: 4   INIGILAHVDAGKTTVTEGLLYKSGAINK 32


>UniRef50_Q4HK10 Cluster: Selenocysteine-specific translation
           elongation factor, putative; n=3; Campylobacter|Rep:
           Selenocysteine-specific translation elongation factor,
           putative - Campylobacter lari RM2100
          Length = 601

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 23/83 (27%), Positives = 39/83 (46%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITI+++    ++    +  ID PGH   IK MI+G       + ++    G      
Sbjct: 36  EKGITINLSFSNLKSENLNIAFIDVPGHESLIKTMISGAFGFRVCMFVIDINEG------ 89

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               Q+ EH  +   LGVK +++
Sbjct: 90  -LKAQSIEHLRVLEFLGVKDVVL 111


>UniRef50_Q1Q1G5 Cluster: Strongly similar to translation initiation
           factor IF-2; n=1; Candidatus Kuenenia
           stuttgartiensis|Rep: Strongly similar to translation
           initiation factor IF-2 - Candidatus Kuenenia
           stuttgartiensis
          Length = 742

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 21/52 (40%), Positives = 26/52 (50%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           GIT  I   K ET+  +V  +D PGH  F      G +  D  VL+VAA  G
Sbjct: 274 GITQHIGAHKVETNGKHVVFLDTPGHEAFTAMRARGANVTDVVVLVVAADDG 325


>UniRef50_A6CF43 Cluster: Translation initiation factor IF-2; n=1;
           Planctomyces maris DSM 8797|Rep: Translation initiation
           factor IF-2 - Planctomyces maris DSM 8797
          Length = 687

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           GIT  IA ++ E + + +T +D PGH  F +    G +  D  VL+VAA  G
Sbjct: 215 GITQHIAAYQIEYNGHKLTFVDTPGHAAFSEMRSRGANVTDMVVLVVAADDG 266


>UniRef50_A5DTX8 Cluster: Putative uncharacterized protein; n=3;
           Saccharomycetales|Rep: Putative uncharacterized protein
           - Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 826

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 22/54 (40%), Positives = 28/54 (51%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI +A      + + + IID PGH DF   +I      D AV I+ A  G
Sbjct: 103 ERGITIQLAAITIPWNNHKINIIDTPGHADFTFEVIRSLRVLDGAVTILDAVAG 156



 Score = 33.5 bits (73), Expect = 4.5
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           NI +I H+D+GK+TTT  +IY  G
Sbjct: 57  NIGIIAHIDAGKTTTTERMIYYSG 80


>UniRef50_Q46306 Cluster: Tetracycline resistance protein tetP
           (TetB(P)); n=4; Clostridium|Rep: Tetracycline resistance
           protein tetP (TetB(P)) - Clostridium perfringens
          Length = 652

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 20/54 (37%), Positives = 29/54 (53%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  +   F  +   V IID PGH DFI  +    +  D A+L+++   G
Sbjct: 52  KRGITIKSSTISFNWNNVKVNIIDTPGHVDFISEVERSLNSLDGAILVISGVEG 105



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCGGI 157
           K  INI ++ HVD+GK+T T +L+Y  G I
Sbjct: 2   KKIINIGIVAHVDAGKTTITENLLYYSGAI 31


>UniRef50_Q81NX9 Cluster: GTP-binding elongation factor protein,
           TetM/TetO family; n=9; Bacillus cereus group|Rep:
           GTP-binding elongation factor protein, TetM/TetO family
           - Bacillus anthracis
          Length = 647

 Score = 40.7 bits (91), Expect = 0.030
 Identities = 20/54 (37%), Positives = 29/54 (53%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  ++  F      V +ID PGH DFI  +       D A+L+++A  G
Sbjct: 51  QRGITIKASVVSFFIDDIKVNVIDTPGHADFIAEVERSFRVLDGAILVISAVEG 104


>UniRef50_Q1VQ31 Cluster: Tetracycline resistance protein; n=1;
           Psychroflexus torquis ATCC 700755|Rep: Tetracycline
           resistance protein - Psychroflexus torquis ATCC 700755
          Length = 660

 Score = 40.7 bits (91), Expect = 0.030
 Identities = 22/54 (40%), Positives = 28/54 (51%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGI+I  A   FE     + +ID PGH DF   +       D AVL+V+A  G
Sbjct: 53  ERGISIKAATTSFEWKGVKINLIDTPGHVDFSSEVERVLCIVDTAVLVVSAVEG 106



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGI 157
           +K  INI ++ HVD+GK+T T   +Y  G I
Sbjct: 2   KKPTINIGILAHVDAGKTTLTEQFLYNSGAI 32


>UniRef50_A7ANX2 Cluster: Elongation factor Tu GTP binding domain
           containing protein; n=1; Babesia bovis|Rep: Elongation
           factor Tu GTP binding domain containing protein -
           Babesia bovis
          Length = 601

 Score = 40.7 bits (91), Expect = 0.030
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = +2

Query: 71  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 178
           T +N+VV G VD GKST  GHL+   G +D R + +
Sbjct: 113 TSLNVVVCGRVDVGKSTLLGHLLTLLGAVDSRLLRE 148



 Score = 40.7 bits (91), Expect = 0.030
 Identities = 21/64 (32%), Positives = 33/64 (51%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 492
           +  ID PGH D I N++ G S A  A+++V       E    K G   +H  + + LGV+
Sbjct: 204 IDFIDTPGHHDLIANLVKGASFARAAIVVVDILDFLKE---DKYGYFEQHLFILWALGVR 260

Query: 493 QLIV 504
           + I+
Sbjct: 261 EFII 264


>UniRef50_Q8F7K1 Cluster: Translation initiation factor IF-2; n=4;
           Leptospira|Rep: Translation initiation factor IF-2 -
           Leptospira interrogans
          Length = 880

 Score = 40.7 bits (91), Expect = 0.030
 Identities = 19/52 (36%), Positives = 26/52 (50%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           GIT  I  ++  T++  +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 409 GITQHIGAYQVRTARGLITFLDTPGHEAFTSMRARGAKVTDIVVLVVAADDG 460


>UniRef50_UPI0000519D80 Cluster: PREDICTED: similar to mitochondrial
           elongation factor G2 isoform 1; n=1; Apis mellifera|Rep:
           PREDICTED: similar to mitochondrial elongation factor G2
           isoform 1 - Apis mellifera
          Length = 740

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 21/54 (38%), Positives = 27/54 (50%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGITI  A   FE   Y + +ID PGH DF   +       D AV+I+    G
Sbjct: 86  QRGITITSAAVTFEWKNYCINLIDTPGHIDFTMEVEQTLRVLDGAVVILDGSAG 139


>UniRef50_Q6LH28 Cluster: Hypothetical selenocysteine-specific
           translation elongation factor; n=2; Photobacterium
           profundum|Rep: Hypothetical selenocysteine-specific
           translation elongation factor - Photobacterium profundum
           (Photobacterium sp. (strain SS9))
          Length = 574

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +1

Query: 265 ITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +TID+    F+ +    V +ID PGH  FI+NM+ G    D  + +VAA  G
Sbjct: 1   MTIDLGFAFFKHNNGEAVGVIDVPGHERFIRNMVAGVWSLDMVLFVVAADEG 52


>UniRef50_Q1ZC67 Cluster: Selenocysteine synthase; n=1; Psychromonas
           sp. CNPT3|Rep: Selenocysteine synthase - Psychromonas
           sp. CNPT3
          Length = 523

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +1

Query: 262 GITIDIALWKF-ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           G+T D+    F +     + I+D PGH  +I+NM++G +  +  +L+++A  G       
Sbjct: 44  GMTQDLGFAYFCDPQGNNIGIVDVPGHERYIRNMVSGIANLNAVILVISATEGWMP---- 99

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
               T +H  +A  LG   +I+
Sbjct: 100 ---MTTDHVQIAQALGQTNIII 118


>UniRef50_A0UWB2 Cluster: Small GTP-binding protein; n=14;
           Bacteria|Rep: Small GTP-binding protein - Clostridium
           cellulolyticum H10
          Length = 918

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 21/53 (39%), Positives = 27/53 (50%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           RGITI      FET    +T++D PGH DF   M       D AVL+++   G
Sbjct: 90  RGITIFSKQAVFETGGINITLLDTPGHIDFSAEMERTLQVLDYAVLVISGADG 142


>UniRef50_Q6CBI0 Cluster: Yarrowia lipolytica chromosome C of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome C of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 802

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 22/54 (40%), Positives = 27/54 (50%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI  A   F  + + V +ID PGH DF   +I      D AV I+    G
Sbjct: 63  ERGITIASAATSFNWNNHTVNLIDTPGHADFTFEVIRSIRVLDGAVCILDGVAG 116



 Score = 33.5 bits (73), Expect = 4.5
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGI 157
           NI +I H+D+GK+TTT  ++Y  G I
Sbjct: 17  NIGIIAHIDAGKTTTTERILYLSGTI 42


>UniRef50_P0A3B4 Cluster: GTP-binding protein typA/bipA; n=97;
           Bacteria|Rep: GTP-binding protein typA/bipA - Shigella
           flexneri
          Length = 607

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 28/83 (33%), Positives = 38/83 (45%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGITI       + + Y + I+D PGH DF   +    S  D  +L+V A  G      
Sbjct: 51  ERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMP--- 107

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
               QTR     AF  G+K ++V
Sbjct: 108 ----QTRFVTKKAFAYGLKPIVV 126


>UniRef50_Q5QTY8 Cluster: Translation initiation factor IF-2; n=104;
           Gammaproteobacteria|Rep: Translation initiation factor
           IF-2 - Idiomarina loihiensis
          Length = 896

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 20/52 (38%), Positives = 24/52 (46%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           GIT  I  +  ET    VT +D PGH  F      G    D  +L+VAA  G
Sbjct: 430 GITQHIGAYHVETGHGMVTFLDTPGHAAFTSMRARGAGATDVVILVVAADDG 481


>UniRef50_Q9RTG5 Cluster: Translation initiation factor IF-2; n=4;
           Deinococci|Rep: Translation initiation factor IF-2 -
           Deinococcus radiodurans
          Length = 597

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 18/49 (36%), Positives = 28/49 (57%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 408
           GIT  +  ++ +TSK  +  ID PGH  F      G + AD A++++AA
Sbjct: 132 GITQHVGAFEAKTSKGKIVFIDTPGHEAFTTIRARGANVADIAIIVIAA 180


>UniRef50_Q8F983 Cluster: Elongation factor G; n=98; cellular
           organisms|Rep: Elongation factor G - Leptospira
           interrogans
          Length = 706

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 22/69 (31%), Positives = 32/69 (46%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGITI  A    +   + + IID PGH DF   +       D A+L++    G     I
Sbjct: 68  ERGITIQSAATYCQWKNHTINIIDTPGHVDFTVEVERSLRVLDSAILVLCGVAGVQSQSI 127

Query: 436 SKNGQTREH 462
           + + Q R +
Sbjct: 128 TVDRQMRRY 136


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 658,691,971
Number of Sequences: 1657284
Number of extensions: 13085150
Number of successful extensions: 41845
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 39215
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41728
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 48955894634
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -