SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20049
         (646 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8IGP4 Cluster: RE54276p; n=4; Endopterygota|Rep: RE542...   105   7e-22
UniRef50_Q6IDH2 Cluster: RH58004p; n=5; Diptera|Rep: RH58004p - ...   102   6e-21
UniRef50_UPI00005A0CF4 Cluster: PREDICTED: similar to NAD kinase...    64   3e-09
UniRef50_O95544 Cluster: NAD kinase (EC 2.7.1.23) (Poly(P)/ATP N...    64   3e-09
UniRef50_Q4S107 Cluster: Chromosome 15 SCAF14771, whole genome s...    64   4e-09
UniRef50_Q4SC84 Cluster: Chromosome undetermined SCAF14659, whol...    42   0.010
UniRef50_Q5QPS4 Cluster: NAD kinase; n=4; Eutheria|Rep: NAD kina...    35   1.9  
UniRef50_Q5C821 Cluster: SJCHGC05697 protein; n=1; Schistosoma j...    33   5.9  
UniRef50_A1DIC5 Cluster: Putative uncharacterized protein; n=3; ...    33   5.9  
UniRef50_Q9C0Y2 Cluster: Glycoprotein; n=3; Schizosaccharomyces ...    33   7.8  
UniRef50_Q5ADN6 Cluster: Putative uncharacterized protein; n=1; ...    33   7.8  

>UniRef50_Q8IGP4 Cluster: RE54276p; n=4; Endopterygota|Rep: RE54276p
           - Drosophila melanogaster (Fruit fly)
          Length = 490

 Score =  105 bits (253), Expect = 7e-22
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +3

Query: 366 RTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RTRSLNAPSP+QQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 96  RTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 143



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 27/43 (62%), Positives = 34/43 (79%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKKV DA +LAPFV LV WL+ +K+MVV+VE+AVL+   L E
Sbjct: 144 VIKKVSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEGVQLNE 186


>UniRef50_Q6IDH2 Cluster: RH58004p; n=5; Diptera|Rep: RH58004p -
           Drosophila melanogaster (Fruit fly)
          Length = 548

 Score =  102 bits (245), Expect = 6e-21
 Identities = 46/48 (95%), Positives = 46/48 (95%)
 Frame = +3

Query: 366 RTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RTRSLNAPSP Q FGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL
Sbjct: 109 RTRSLNAPSPFQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 156



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLAE 637
           VIKK  D+Q+L PFVQLV WLV +K MVV+VE+AVL+D LL +
Sbjct: 157 VIKK-KDSQVLPPFVQLVEWLVQEKHMVVWVESAVLEDKLLRD 198


>UniRef50_UPI00005A0CF4 Cluster: PREDICTED: similar to NAD kinase
           isoform 5; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to NAD kinase isoform 5 - Canis familiaris
          Length = 504

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 28/49 (57%), Positives = 35/49 (71%)
 Frame = +3

Query: 363 RRTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RRTRSL+ P P+  FGP   +++N   +M IQDPASQRLTW K P +VL
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVL 108



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 18/38 (47%), Positives = 28/38 (73%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDD 622
           VIKK+ DA +L PF +L  +L+ + +M+V+VE  VL+D
Sbjct: 109 VIKKMRDASLLQPFKELCTYLMEENNMIVYVEKKVLED 146


>UniRef50_O95544 Cluster: NAD kinase (EC 2.7.1.23) (Poly(P)/ATP NAD
           kinase); n=59; Eumetazoa|Rep: NAD kinase (EC 2.7.1.23)
           (Poly(P)/ATP NAD kinase) - Homo sapiens (Human)
          Length = 446

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 28/49 (57%), Positives = 35/49 (71%)
 Frame = +3

Query: 363 RRTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVL 509
           RRTRSL+ P P+  FGP   +++N   +M IQDPASQRLTW K P +VL
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVL 108



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 19/42 (45%), Positives = 30/42 (71%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLA 634
           VIKK+ DA +L PF +L   L+ +++M+V+VE  VL+D  +A
Sbjct: 109 VIKKMRDASLLQPFKELCTHLM-EENMIVYVEKKVLEDPAIA 149


>UniRef50_Q4S107 Cluster: Chromosome 15 SCAF14771, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 15
           SCAF14771, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 166

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 34/76 (44%), Positives = 42/76 (55%)
 Frame = +3

Query: 294 RRQYSHESGKTELVRAQEEYLDRRRTRSLNAPSPIQQFGPCGRIMKNSAMVMQIQDPASQ 473
           +R++S  SG         E   +RR   L+ P P   FGP   I+ N   VM IQDPASQ
Sbjct: 75  QREHSASSGSPS---EPMEISPKRRAHFLHGPYPATHFGPKACILPNPTSVMHIQDPASQ 131

Query: 474 RLTWYKPPLTVLSSRR 521
           RLTW KPP+ VL  R+
Sbjct: 132 RLTWNKPPVNVLVIRK 147


>UniRef50_Q4SC84 Cluster: Chromosome undetermined SCAF14659, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF14659,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 600

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 19/42 (45%), Positives = 29/42 (69%)
 Frame = +2

Query: 509 VIKKVHDAQILAPFVQLVHWLVHDKSMVVFVEAAVLDDTLLA 634
           VIKK+ DA +L PF +L  +L   K+M+V+VE  VL+D  ++
Sbjct: 240 VIKKIQDASLLEPFKELCIFLAKVKNMIVYVEKKVLEDPAIS 281



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = +3

Query: 453 IQDPASQRLTWYKPPLTVL 509
           IQDPASQ+LTW  PP +VL
Sbjct: 221 IQDPASQKLTWNTPPKSVL 239


>UniRef50_Q5QPS4 Cluster: NAD kinase; n=4; Eutheria|Rep: NAD kinase
           - Homo sapiens (Human)
          Length = 591

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +3

Query: 453 IQDPASQRLTWYKPPLTVL 509
           IQDPASQRLTW K P +VL
Sbjct: 194 IQDPASQRLTWNKSPKSVL 212


>UniRef50_Q5C821 Cluster: SJCHGC05697 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05697 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 337

 Score = 33.1 bits (72), Expect = 5.9
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = -3

Query: 302 LPSQHFFKQSHNSYTNHTELPKLVSRTNRSFSHIKRLKH 186
           LP QH FK S +S +N TEL  L    ++  + I+ +KH
Sbjct: 233 LPPQHPFKSSRDSKSNDTELIALRKERDQLLTTIEEMKH 271


>UniRef50_A1DIC5 Cluster: Putative uncharacterized protein; n=3;
           Trichocomaceae|Rep: Putative uncharacterized protein -
           Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 408

 Score = 33.1 bits (72), Expect = 5.9
 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 2/52 (3%)
 Frame = +3

Query: 288 MLRRQYSHESGKTELVRAQEEYLDRRRTRSLNA--PSPIQQFGPCGRIMKNS 437
           MLR     E G    V+A+   + RRR    NA  P  +    PCGR+  NS
Sbjct: 351 MLRNVQRSEVGFNIFVKAKSSLMARRRAHEFNAQPPDMLLDLVPCGRLSLNS 402


>UniRef50_Q9C0Y2 Cluster: Glycoprotein; n=3; Schizosaccharomyces
           pombe|Rep: Glycoprotein - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 1220

 Score = 32.7 bits (71), Expect = 7.8
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 21  VLPGHSLCSCPRIITLASSSRTHYIFTM 104
           V P  SL  CP+ +T+ SS  +HYI T+
Sbjct: 41  VTPNTSLAQCPKYVTVYSSGSSHYISTI 68


>UniRef50_Q5ADN6 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 943

 Score = 32.7 bits (71), Expect = 7.8
 Identities = 13/43 (30%), Positives = 26/43 (60%)
 Frame = +3

Query: 258 RVAVMALFKKMLRRQYSHESGKTELVRAQEEYLDRRRTRSLNA 386
           ++A+  +FKK L+     + GK  ++  ++ YLD  + ++LNA
Sbjct: 128 KIAIKKIFKKFLKYYPHKQQGKEFVLNLKQYYLDHSKIKNLNA 170


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 703,483,902
Number of Sequences: 1657284
Number of extensions: 15082126
Number of successful extensions: 39278
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 37821
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39258
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 48541014171
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -