SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20048
         (771 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q60F93 Cluster: Molting fluid carboxypeptidase A; n=3; ...   144   2e-33
UniRef50_UPI00015B5378 Cluster: PREDICTED: similar to ENSANGP000...    75   2e-12
UniRef50_Q9W475 Cluster: CG3108-PA; n=4; Diptera|Rep: CG3108-PA ...    74   5e-12
UniRef50_Q7QFQ6 Cluster: ENSANGP00000007330; n=2; Nematocera|Rep...    67   5e-10
UniRef50_UPI00015B5376 Cluster: PREDICTED: similar to molting fl...    65   2e-09
UniRef50_UPI0000D56BDF Cluster: PREDICTED: similar to CG3108-PA;...    55   2e-06
UniRef50_Q29JB8 Cluster: GA15990-PA; n=1; Drosophila pseudoobscu...    51   3e-05
UniRef50_Q7QFK5 Cluster: ENSANGP00000017304; n=1; Anopheles gamb...    45   0.002
UniRef50_A0EZX9 Cluster: Carboxypeptidase A1; n=1; Scophthalmus ...    42   0.022
UniRef50_Q9UI42 Cluster: Carboxypeptidase A4 precursor; n=10; Eu...    40   0.068
UniRef50_UPI00015B41FE Cluster: PREDICTED: similar to carboxypep...    39   0.16 
UniRef50_UPI0000DB7726 Cluster: PREDICTED: similar to CG3108-PA;...    38   0.21 
UniRef50_Q4QXK9 Cluster: Carboxypeptidase; n=8; Amniota|Rep: Car...    37   0.48 
UniRef50_UPI000051ABA1 Cluster: PREDICTED: similar to CG17633-PA...    36   0.84 
UniRef50_P15085 Cluster: Carboxypeptidase A1 precursor; n=25; Eu...    36   1.1  
UniRef50_A3M038 Cluster: Predicted protein; n=1; Pichia stipitis...    36   1.5  
UniRef50_Q4PK67 Cluster: Predicted long chain fatty acid CoA lig...    35   2.6  
UniRef50_Q8EX00 Cluster: Methionyl-tRNA formyltransferase; n=1; ...    35   2.6  
UniRef50_Q9ZUE1 Cluster: F5O8.9 protein; n=2; Arabidopsis thalia...    34   3.4  
UniRef50_Q9VRZ3 Cluster: CG14820-PA; n=2; Sophophora|Rep: CG1482...    34   4.5  
UniRef50_A2TRH0 Cluster: Fructose-1,6-bisphosphatase; n=1; Dokdo...    33   5.9  
UniRef50_Q9W477 Cluster: CG15769-PA; n=1; Drosophila melanogaste...    33   5.9  
UniRef50_A7TMC5 Cluster: Putative uncharacterized protein; n=1; ...    33   5.9  
UniRef50_Q1Z4Y7 Cluster: Putative uncharacterized protein; n=1; ...    33   7.9  
UniRef50_Q6H962 Cluster: Carboxypeptidase precursor; n=2; Noctui...    33   7.9  

>UniRef50_Q60F93 Cluster: Molting fluid carboxypeptidase A; n=3;
           Endopterygota|Rep: Molting fluid carboxypeptidase A -
           Bombyx mori (Silk moth)
          Length = 479

 Score =  144 bits (349), Expect = 2e-33
 Identities = 68/72 (94%), Positives = 69/72 (95%)
 Frame = +3

Query: 306 KTIERDHEPKKIDYSGSQVWQVSTTKSGARQVIGRLRRRNLISTWGGNQSSVDILIKPNV 485
           KTIERDHEPKKIDYSGSQVWQVSTTKSGARQVIGRLRRRNLISTWGGNQSSVDILIKPNV
Sbjct: 75  KTIERDHEPKKIDYSGSQVWQVSTTKSGARQVIGRLRRRNLISTWGGNQSSVDILIKPNV 134

Query: 486 VENITRVLKERA 521
           VENITRV K  +
Sbjct: 135 VENITRVFKRES 146



 Score =  136 bits (330), Expect = 4e-31
 Identities = 61/61 (100%), Positives = 61/61 (100%)
 Frame = +2

Query: 506 FKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA 685
           FKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA
Sbjct: 142 FKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA 201

Query: 686 K 688
           K
Sbjct: 202 K 202



 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 47/64 (73%), Positives = 47/64 (73%)
 Frame = +1

Query: 85  MGSKRQXXXXXXXXXXXXXSSPLINELQPGEEWPQRNSVRQPVADDQTEQTLTEDFSLTI 264
           MGSKRQ             SSPLINELQPGEEWPQRNSVRQPVADDQTEQTLTEDFS T 
Sbjct: 1   MGSKRQTVVLFLAALTVVLSSPLINELQPGEEWPQRNSVRQPVADDQTEQTLTEDFS-TD 59

Query: 265 RPQP 276
            P P
Sbjct: 60  DPAP 63



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 23/46 (50%), Positives = 27/46 (58%), Gaps = 6/46 (13%)
 Frame = +1

Query: 637 TVSQIRRHLRLYGL---LGKTYPSIISVKSIGNHLK---VEILRYS 756
           T  Q  R   +YG    L KTYPSIISVKSIG   +   ++ILR S
Sbjct: 183 TWKQYHRLEDIYGFMDYLAKTYPSIISVKSIGKSFEGRDLKILRIS 228


>UniRef50_UPI00015B5378 Cluster: PREDICTED: similar to
           ENSANGP00000007330; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000007330 - Nasonia
           vitripennis
          Length = 444

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 34/56 (60%), Positives = 42/56 (75%), Gaps = 1/56 (1%)
 Frame = +2

Query: 521 IDYNVVIEDLQKRINEENPPLDNDEIE-LQDRRGHRMTWKQYHRLEDIYGFMDYLA 685
           ++Y+VVI DLQ+ IN ENP     EIE L+ R GHRM W  YHRLEDI+G++DYLA
Sbjct: 111 VEYDVVIPDLQQAINHENPIKTPAEIEELEGRHGHRMEWTSYHRLEDIHGYLDYLA 166



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 20/61 (32%), Positives = 38/61 (62%)
 Frame = +3

Query: 336 KIDYSGSQVWQVSTTKSGARQVIGRLRRRNLISTWGGNQSSVDILIKPNVVENITRVLKE 515
           ++ Y G+QVW+V      A + +  L+ R  +S W GN +++D+L+ P+V+  ++R L +
Sbjct: 50  RVTYEGAQVWRVQGADDYA-EYLTYLQDRGDLSLWTGNDTTIDVLVLPDVIPRVSRFLHQ 108

Query: 516 R 518
           R
Sbjct: 109 R 109


>UniRef50_Q9W475 Cluster: CG3108-PA; n=4; Diptera|Rep: CG3108-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 1132

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 31/52 (59%), Positives = 44/52 (84%)
 Frame = +2

Query: 533 VVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLAK 688
           V+I++LQ+ I +ENPP +    ELQ+R+GHR+TW+ YHRLEDI+GF+DY+AK
Sbjct: 786 VLIDNLQRVIEKENPPAEKIA-ELQNRKGHRLTWQAYHRLEDIHGFIDYMAK 836


>UniRef50_Q7QFQ6 Cluster: ENSANGP00000007330; n=2; Nematocera|Rep:
           ENSANGP00000007330 - Anopheles gambiae str. PEST
          Length = 445

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 36/71 (50%), Positives = 46/71 (64%), Gaps = 9/71 (12%)
 Frame = +2

Query: 503 CFKRES-IDYNVVIEDLQKRINEENPPLDNDEIELQDRRG--------HRMTWKQYHRLE 655
           CF R + I Y VVIED+Q+ I+ ENP L+  E+  ++R G        HRMTW  YHRL 
Sbjct: 96  CFLRAANIPYEVVIEDMQRAIDTENPSLEETEL-WENRNGRLTNPSLRHRMTWTAYHRLA 154

Query: 656 DIYGFMDYLAK 688
           DIY +MDYLA+
Sbjct: 155 DIYDWMDYLAQ 165



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 14/52 (26%), Positives = 27/52 (51%)
 Frame = +3

Query: 321 DHEPKKIDYSGSQVWQVSTTKSGARQVIGRLRRRNLISTWGGNQSSVDILIK 476
           D   + + Y G+Q+W+++      +  +  L+ R   S W  N +SVDI ++
Sbjct: 36  DAPAQPVKYDGAQLWRIAYDDQPKKNAVAELQDRFDASMWNYNATSVDIFVR 87


>UniRef50_UPI00015B5376 Cluster: PREDICTED: similar to molting fluid
           carboxypeptidase A; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to molting fluid carboxypeptidase A -
           Nasonia vitripennis
          Length = 603

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 1/60 (1%)
 Frame = +2

Query: 509 KRESIDYNVVIEDLQKRINEENPPLDNDEIE-LQDRRGHRMTWKQYHRLEDIYGFMDYLA 685
           + + I+Y +++ DLQK I  +NP +  +  + L   +GH MTWK+YHR +DI G++DYLA
Sbjct: 230 QEKKIEYTILVNDLQKLIKSQNPRMPKERRQDLYSLQGHSMTWKRYHRYKDIMGYLDYLA 289


>UniRef50_UPI0000D56BDF Cluster: PREDICTED: similar to CG3108-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG3108-PA - Tribolium castaneum
          Length = 413

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/53 (49%), Positives = 34/53 (64%)
 Frame = +2

Query: 524 DYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYL 682
           ++ V IED+QK I+EENP   N    L  R+G R+TW  YH L DIY ++ YL
Sbjct: 86  EFKVSIEDVQKAIDEENPKPAN----LDGRKGFRLTWNYYHSLADIYDYLYYL 134



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 16/61 (26%), Positives = 34/61 (55%)
 Frame = +3

Query: 333 KKIDYSGSQVWQVSTTKSGARQVIGRLRRRNLISTWGGNQSSVDILIKPNVVENITRVLK 512
           +KI Y+G Q+W+++   +    ++  L + N +S WG N + +D L+  + +  +   L+
Sbjct: 22  EKISYTGDQLWKITNGNNSTLNLLKTLEQDNYVSIWGHNSTYIDALVHSSALNKVRDKLQ 81

Query: 513 E 515
           E
Sbjct: 82  E 82


>UniRef50_Q29JB8 Cluster: GA15990-PA; n=1; Drosophila
           pseudoobscura|Rep: GA15990-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 1032

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 18/25 (72%), Positives = 24/25 (96%)
 Frame = +2

Query: 614 RGHRMTWKQYHRLEDIYGFMDYLAK 688
           +GHR+TW+ YHRLEDI+GF+DY+AK
Sbjct: 712 KGHRLTWQAYHRLEDIHGFIDYMAK 736


>UniRef50_Q7QFK5 Cluster: ENSANGP00000017304; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000017304 - Anopheles gambiae
           str. PEST
          Length = 417

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 1/59 (1%)
 Frame = +2

Query: 515 ESIDYNVVIEDLQKRINEENPPLDN-DEIELQDRRGHRMTWKQYHRLEDIYGFMDYLAK 688
           E++ +   I D+ + I  ENP +   +++EL+  +GH +TW +YHR  DI  F+ +L +
Sbjct: 78  EALRHEPTIRDVGQAIAYENPAMTRREQLELELHQGHPLTWYRYHRYADIVKFLYHLQR 136


>UniRef50_A0EZX9 Cluster: Carboxypeptidase A1; n=1; Scophthalmus
           maximus|Rep: Carboxypeptidase A1 - Scophthalmus maximus
           (Turbot)
          Length = 171

 Score = 41.5 bits (93), Expect = 0.022
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 2/67 (2%)
 Frame = +2

Query: 515 ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA--K 688
           + I+Y+ +IEDLQ  ++ E   +D+     + R      + +YH + +IY F D L    
Sbjct: 72  QGIEYSTIIEDLQVMLDMEQEEMDSAARVAEPRNTDNFDFSRYHTINEIYSFQDMLVAEN 131

Query: 689 PILLSSV 709
           P L+S +
Sbjct: 132 PNLVSKL 138


>UniRef50_Q9UI42 Cluster: Carboxypeptidase A4 precursor; n=10;
           Euteleostomi|Rep: Carboxypeptidase A4 precursor - Homo
           sapiens (Human)
          Length = 421

 Score = 39.9 bits (89), Expect = 0.068
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +2

Query: 509 KRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA 685
           + + ++Y V IEDLQ  ++ E+  + ++E   Q+R  +   +  YH LE IY  MD +A
Sbjct: 81  RSQGLEYAVTIEDLQALLDNEDDEMQHNEG--QERSSNNFNYGAYHSLEAIYHEMDNIA 137


>UniRef50_UPI00015B41FE Cluster: PREDICTED: similar to
           carboxypeptidase A; n=3; Nasonia vitripennis|Rep:
           PREDICTED: similar to carboxypeptidase A - Nasonia
           vitripennis
          Length = 431

 Score = 38.7 bits (86), Expect = 0.16
 Identities = 21/56 (37%), Positives = 32/56 (57%)
 Frame = +2

Query: 521 IDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLAK 688
           + Y++ +ED+QK I++E     + EI    R+     W  YH L+ IY +MD LAK
Sbjct: 97  MSYDMYVEDVQKLIDQEQR---SSEI----RQAGSFGWTSYHTLDQIYAWMDQLAK 145


>UniRef50_UPI0000DB7726 Cluster: PREDICTED: similar to CG3108-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG3108-PA
           - Apis mellifera
          Length = 320

 Score = 38.3 bits (85), Expect = 0.21
 Identities = 14/28 (50%), Positives = 20/28 (71%)
 Frame = +2

Query: 599 ELQDRRGHRMTWKQYHRLEDIYGFMDYL 682
           +L   +GH MTWK+YHR  +I  +M+YL
Sbjct: 8   DLVSSQGHSMTWKRYHRYGEIVRYMEYL 35


>UniRef50_Q4QXK9 Cluster: Carboxypeptidase; n=8; Amniota|Rep:
           Carboxypeptidase - Oxyuranus scutellatus scutellatus
           (Australian taipan)
          Length = 238

 Score = 37.1 bits (82), Expect = 0.48
 Identities = 17/58 (29%), Positives = 33/58 (56%)
 Frame = +2

Query: 515 ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLAK 688
           + IDY+++IED+Q  ++EE+  + ++    ++       +  YH L+ IY  MD + K
Sbjct: 82  QQIDYSILIEDVQALLDEESREMQSN--RQREYSNSNFNYGAYHNLDTIYQAMDDIVK 137


>UniRef50_UPI000051ABA1 Cluster: PREDICTED: similar to CG17633-PA,
           partial; n=1; Apis mellifera|Rep: PREDICTED: similar to
           CG17633-PA, partial - Apis mellifera
          Length = 321

 Score = 36.3 bits (80), Expect = 0.84
 Identities = 20/66 (30%), Positives = 33/66 (50%)
 Frame = +2

Query: 491 KYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGF 670
           ++Y    +  I Y++ I ++Q  I+ E  P+                + QYH LE+IY +
Sbjct: 74  EFYDMMMKLDIPYDIYINNVQDLIDSEASPIQPLVT---------FNFAQYHTLEEIYAY 124

Query: 671 MDYLAK 688
           +DYLAK
Sbjct: 125 LDYLAK 130


>UniRef50_P15085 Cluster: Carboxypeptidase A1 precursor; n=25;
           Euteleostomi|Rep: Carboxypeptidase A1 precursor - Homo
           sapiens (Human)
          Length = 419

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = +2

Query: 521 IDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA--KPI 694
           I Y  +IED+Q  ++EE   +       + R      +  YH LE+IY F+D L    P 
Sbjct: 84  ISYETMIEDVQSLLDEEQEQMF--AFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPH 141

Query: 695 LLSSV 709
           L+S +
Sbjct: 142 LVSKI 146


>UniRef50_A3M038 Cluster: Predicted protein; n=1; Pichia
           stipitis|Rep: Predicted protein - Pichia stipitis
           (Yeast)
          Length = 782

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 15/32 (46%), Positives = 23/32 (71%), Gaps = 1/32 (3%)
 Frame = +2

Query: 590 DEIELQDRRGHRMTWKQYHRL-EDIYGFMDYL 682
           DE+EL+D      TWK++HR+ EDI+ F D++
Sbjct: 467 DELELEDDEITWKTWKRFHRVKEDIFKFRDFI 498


>UniRef50_Q4PK67 Cluster: Predicted long chain fatty acid CoA
           ligase; n=1; uncultured bacterium MedeBAC49C08|Rep:
           Predicted long chain fatty acid CoA ligase - uncultured
           bacterium MedeBAC49C08
          Length = 571

 Score = 34.7 bits (76), Expect = 2.6
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +3

Query: 6   RGLRGGGSSKPPEPALQSKPNFTFSSHGI 92
           RGL GGG+++PPE   + + NF  +S GI
Sbjct: 334 RGLNGGGAARPPEQVKEMRENFKDTSPGI 362


>UniRef50_Q8EX00 Cluster: Methionyl-tRNA formyltransferase; n=1;
           Mycoplasma penetrans|Rep: Methionyl-tRNA
           formyltransferase - Mycoplasma penetrans
          Length = 318

 Score = 34.7 bits (76), Expect = 2.6
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%)
 Frame = +2

Query: 437 MGRESVFCGHPYQTECRRKYYTCFKR-ESIDYNVVIEDLQKRINEENPPLDNDE 595
           M    V+C      E      T FK+  ++ Y++V+ DL+K  N E PP+  DE
Sbjct: 150 MDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDE 203


>UniRef50_Q9ZUE1 Cluster: F5O8.9 protein; n=2; Arabidopsis
           thaliana|Rep: F5O8.9 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 189

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +3

Query: 6   RGLRGGGSSKPPEPALQSKPNFTFSSHGIQEANGRVVLGGPN 131
           RG  GGG   PP P ++    F    +G   + G +  GGP+
Sbjct: 141 RGREGGGGGGPPPPNIKHAVRFKLPENGDHHSKGEIRRGGPS 182


>UniRef50_Q9VRZ3 Cluster: CG14820-PA; n=2; Sophophora|Rep:
           CG14820-PA - Drosophila melanogaster (Fruit fly)
          Length = 416

 Score = 33.9 bits (74), Expect = 4.5
 Identities = 17/68 (25%), Positives = 35/68 (51%)
 Frame = +2

Query: 479 ECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLED 658
           E ++ + +   + +  YN+ I+++Q  I+ + P           +R   M W Q+H LE+
Sbjct: 71  EYQKTFESLLTKHNFTYNLKIDNVQTHIDAQRPK----------QRITSMEWTQFHTLEE 120

Query: 659 IYGFMDYL 682
           IY ++D +
Sbjct: 121 IYAWLDVI 128


>UniRef50_A2TRH0 Cluster: Fructose-1,6-bisphosphatase; n=1; Dokdonia
           donghaensis MED134|Rep: Fructose-1,6-bisphosphatase -
           Dokdonia donghaensis MED134
          Length = 116

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 14/43 (32%), Positives = 24/43 (55%)
 Frame = +2

Query: 470 YQTECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEI 598
           Y  E R++  T     S D N+ I DL++ +N++   LDN ++
Sbjct: 56  YVDEARKEIMTAVDNLSTDVNIRISDLEQSLNDKTEDLDNKKV 98


>UniRef50_Q9W477 Cluster: CG15769-PA; n=1; Drosophila
           melanogaster|Rep: CG15769-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 507

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 10/62 (16%)
 Frame = +2

Query: 527 YNVVIEDLQKRINE---ENP----PLD---NDEIELQDRRGHRMTWKQYHRLEDIYGFMD 676
           YN++I+D++  I+E   E P    PLD   N+ +   +  G  M W++YH   DI  F+ 
Sbjct: 153 YNIMIDDIESAIDESYVEVPAVEHPLDSVRNNSLPWMEVPGSTMNWRRYHDQADIKQFLQ 212

Query: 677 YL 682
            L
Sbjct: 213 TL 214


>UniRef50_A7TMC5 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 491

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 14/32 (43%), Positives = 23/32 (71%)
 Frame = +2

Query: 509 KRESIDYNVVIEDLQKRINEENPPLDNDEIEL 604
           K++SIDYN++IE +   IN  N  +D+ +I+L
Sbjct: 345 KKKSIDYNIMIEWINDTINNLNDIIDSTDIQL 376


>UniRef50_Q1Z4Y7 Cluster: Putative uncharacterized protein; n=1;
           Photobacterium profundum 3TCK|Rep: Putative
           uncharacterized protein - Photobacterium profundum 3TCK
          Length = 539

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 3/86 (3%)
 Frame = +2

Query: 482 CRRKYYTCFKRESIDYNVVIEDLQKRINEEN---PPLDNDEIELQDRRGHRMTWKQYHRL 652
           C+    T  K+ +   N + + + K +N  +     LDN+++EL     HR  W   +R 
Sbjct: 358 CKIDVLTSNKKSNNVINYITKYIMKTVNVSSYNGTTLDNEQVELDKVSFHRSLWN--YRA 415

Query: 653 EDIYGFMDYLAKPILLSSV*NQ*EII 730
             I+GF + L     L  + NQ +++
Sbjct: 416 YGIFGFKNNLGLWRFLRKISNQQDLL 441


>UniRef50_Q6H962 Cluster: Carboxypeptidase precursor; n=2;
           Noctuidae|Rep: Carboxypeptidase precursor - Helicoverpa
           armigera (Cotton bollworm) (Heliothis armigera)
          Length = 424

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 16/70 (22%), Positives = 35/70 (50%)
 Frame = +2

Query: 479 ECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLED 658
           E ++++   F    + Y  + ++L   + EE   +   +   + R G  +TW  Y+R ++
Sbjct: 70  EEKQQWLHYFDERHMTYTKIADNLADILREEEAQIQKKKASAR-RSGKSITWDTYYRHDE 128

Query: 659 IYGFMDYLAK 688
           I  ++D LA+
Sbjct: 129 INDYLDELAE 138


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 718,499,641
Number of Sequences: 1657284
Number of extensions: 13485705
Number of successful extensions: 36787
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 35472
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36768
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 64615845515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -