SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20047
         (659 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A6GYV7 Cluster: Putative uncharacterized protein; n=1; ...    36   1.1  
UniRef50_A2E3S1 Cluster: Spc97 / Spc98 family protein; n=1; Tric...    34   2.6  
UniRef50_A5AQQ7 Cluster: Putative uncharacterized protein; n=1; ...    33   6.1  
UniRef50_O60716 Cluster: Catenin delta-1 (p120 catenin) (p120(ct...    33   6.1  
UniRef50_UPI0000D561DC Cluster: PREDICTED: similar to forkhead b...    33   8.0  
UniRef50_Q8IJZ3 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  
UniRef50_Q7R3N2 Cluster: GLP_39_57701_61939; n=1; Giardia lambli...    33   8.0  

>UniRef50_A6GYV7 Cluster: Putative uncharacterized protein; n=1;
           Flavobacterium psychrophilum JIP02/86|Rep: Putative
           uncharacterized protein - Flavobacterium psychrophilum
           (strain JIP02/86 / ATCC 49511)
          Length = 640

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +3

Query: 168 EFHHGRLTFERRSAVKDPERDHRSHREGKEFKEGH-FRVNRLMSESTIDVNHQ 323
           +F  G   F +RS +    +D +S  EGK +   H FR+N   SE  I +NHQ
Sbjct: 224 DFQSGNAQFSKRSRLDVYFQDAKSLLEGKRYFLDHSFRLNNKGSEHNIAINHQ 276


>UniRef50_A2E3S1 Cluster: Spc97 / Spc98 family protein; n=1;
           Trichomonas vaginalis G3|Rep: Spc97 / Spc98 family
           protein - Trichomonas vaginalis G3
          Length = 708

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 1/87 (1%)
 Frame = +1

Query: 115 HLCAIISFLPIRISDCVTSFTMGDSLLKED-PLSRIQREIIEVTERERNLKKVTSESTGL 291
           H+  I  F+ +R  D V S  + ++ L E  P+S +   I ++ +    + K TSE+T L
Sbjct: 399 HIKTITDFILLRRGDFVVS--LFENFLHEGAPISLLDHVIRDICQDSVYINKRTSENTTL 456

Query: 292 CPNLRSTLIIRMDT*TAMLMRKYHGPS 372
           C +++ T    +D     ++  Y+ P+
Sbjct: 457 CIDVKMTARNEIDNSPEAVILHYNAPT 483


>UniRef50_A5AQQ7 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 642

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 2/71 (2%)
 Frame = +1

Query: 76  RARCRCRDVETVKHLCAIISFLPIRISDCVTSFTMGDSLLKEDPL--SRIQREIIEVTER 249
           R+ C+CR +E  +    I+    I IS CV    +     K D L  S++  E++ + + 
Sbjct: 479 RSLCQCRKLEKAEKYLRIMKDRSIAISTCVYETLISGYFEKGDELRASQLHNEMLTMVQH 538

Query: 250 ERNLKKVTSES 282
            ++LKK  + S
Sbjct: 539 LQHLKKERANS 549


>UniRef50_O60716 Cluster: Catenin delta-1 (p120 catenin) (p120(ctn))
           (Cadherin-associated Src substrate) (CAS) (p120(cas));
           n=130; Euteleostomi|Rep: Catenin delta-1 (p120 catenin)
           (p120(ctn)) (Cadherin-associated Src substrate) (CAS)
           (p120(cas)) - Homo sapiens (Human)
          Length = 968

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 23  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 81

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 82  DLKLNGPQDHSHLL 95


>UniRef50_UPI0000D561DC Cluster: PREDICTED: similar to forkhead box
           L2; n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           forkhead box L2 - Tribolium castaneum
          Length = 298

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = +1

Query: 508 YSQQRKAAPAFK-CGLNTEYGHRPSPYFPLDSSI--GTSSFPP 627
           YSQQ   +P F  CG+  E   R  PY+P DS    G  S PP
Sbjct: 247 YSQQGYPSPGFSSCGVRQEAAARYPPYWPPDSEYPPGPHSSPP 289


>UniRef50_Q8IJZ3 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 880

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 2/63 (3%)
 Frame = +3

Query: 171 FHHGRLTFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTID--VNHQNGHMNGD 344
           F+ GR     +   +D   D++S  +  ++K+    ++ +  ++T D  V+H++GHM  D
Sbjct: 564 FNRGRNIRGNKYFRRDDNEDNKSEVDDSKYKKSTRSMSMIDRDNTYDERVSHRDGHMKDD 623

Query: 345 ADE 353
            D+
Sbjct: 624 RDD 626


>UniRef50_Q7R3N2 Cluster: GLP_39_57701_61939; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_39_57701_61939 - Giardia lamblia
           ATCC 50803
          Length = 1412

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 17/31 (54%), Positives = 19/31 (61%)
 Frame = +1

Query: 544 CGLNTEYGHRPSPYFPLDSSIGTSSFPPIIT 636
           C  N E G R  PY PLD  I +S FPP+IT
Sbjct: 169 CLPNAETGGRFKPYLPLD--IDSSIFPPLIT 197


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 628,836,006
Number of Sequences: 1657284
Number of extensions: 12274390
Number of successful extensions: 41081
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 38811
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41033
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 50000004659
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -