SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20041
         (743 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B62FD Cluster: PREDICTED: similar to glutamate ...   119   7e-26
UniRef50_Q96KP4 Cluster: Cytosolic non-specific dipeptidase; n=5...   105   2e-21
UniRef50_Q4V8S1 Cluster: Zgc:114181; n=1; Danio rerio|Rep: Zgc:1...    97   4e-19
UniRef50_Q4SUU3 Cluster: Chromosome undetermined SCAF13842, whol...    93   5e-18
UniRef50_Q96KN2 Cluster: Beta-Ala-His dipeptidase precursor; n=5...    88   2e-16
UniRef50_A6RX34 Cluster: Putative uncharacterized protein; n=2; ...    66   1e-09
UniRef50_P43616 Cluster: Glutamate carboxypeptidase-like protein...    65   2e-09
UniRef50_Q1IQK0 Cluster: Peptidase M20; n=3; Acidobacteria|Rep: ...    64   5e-09
UniRef50_Q0CZA8 Cluster: Putative uncharacterized protein; n=1; ...    64   5e-09
UniRef50_Q3A281 Cluster: Acetylornithine deacetylase/succinyl-di...    62   1e-08
UniRef50_Q9RSU7 Cluster: ArgE/DapE/Acy1 family protein; n=4; Dei...    62   2e-08
UniRef50_A1CN71 Cluster: Glutamate carboxypeptidase, putative; n...    61   2e-08
UniRef50_A7I4X2 Cluster: Peptidase M20; n=1; Candidatus Methanor...    60   4e-08
UniRef50_Q9RSV5 Cluster: ArgE/DapE/Acy1 family protein; n=3; Dei...    59   1e-07
UniRef50_Q04FK4 Cluster: Dipeptidase; n=3; Leuconostocaceae|Rep:...    59   1e-07
UniRef50_Q98AF9 Cluster: Mll6018 protein; n=1; Mesorhizobium lot...    58   2e-07
UniRef50_Q67Q20 Cluster: Putative peptidase; n=2; Bacilli|Rep: P...    58   2e-07
UniRef50_A7H8T3 Cluster: Peptidase M20; n=3; Myxococcaceae|Rep: ...    58   2e-07
UniRef50_Q6A6C5 Cluster: Zinc metallopeptidase; n=3; Actinomycet...    57   4e-07
UniRef50_Q1WS58 Cluster: Succinyl-diaminopimelate desuccinylase;...    57   4e-07
UniRef50_A5UT66 Cluster: Peptidase dimerisation domain protein; ...    57   4e-07
UniRef50_A5US80 Cluster: Peptidase M20; n=3; Chloroflexaceae|Rep...    57   5e-07
UniRef50_A0JX29 Cluster: Peptidase M20; n=3; Actinomycetales|Rep...    57   5e-07
UniRef50_Q2S1D7 Cluster: Peptidase, M20/M25/M40 family; n=1; Sal...    56   7e-07
UniRef50_A0L7W4 Cluster: Peptidase M20; n=1; Magnetococcus sp. M...    56   9e-07
UniRef50_Q0RKS1 Cluster: Putative cytosolic nonspecific dipeptid...    56   1e-06
UniRef50_Q7S5Y4 Cluster: Putative uncharacterized protein NCU056...    55   2e-06
UniRef50_Q74KT4 Cluster: Xaa-His dipeptidase; n=5; Lactobacillac...    55   2e-06
UniRef50_A4XGQ7 Cluster: Dipeptidase, putative; n=1; Caldicellul...    54   3e-06
UniRef50_UPI00015B4A2D Cluster: PREDICTED: similar to glutamate ...    54   4e-06
UniRef50_Q7MWN9 Cluster: Peptidase, M20/M25/M40 family; n=29; Ba...    54   4e-06
UniRef50_A0NKT4 Cluster: Peptidase B, M20/M25/M40 family; n=3; L...    54   4e-06
UniRef50_A6LNR1 Cluster: Dipeptidase, putative; n=2; Thermotogac...    54   5e-06
UniRef50_A7DSL7 Cluster: Peptidase M20; n=1; Candidatus Nitrosop...    54   5e-06
UniRef50_Q7UJ49 Cluster: ArgE/DapE/Acy1 family protein; n=3; Pla...    53   6e-06
UniRef50_Q89J35 Cluster: Blr5449 protein; n=1; Bradyrhizobium ja...    52   1e-05
UniRef50_Q822A3 Cluster: Peptidase M20/M25/M40 superfamily; n=4;...    52   1e-05
UniRef50_A1UJA4 Cluster: Peptidase M20; n=23; Actinobacteria (cl...    52   1e-05
UniRef50_A0LVT5 Cluster: Peptidase M20; n=4; Actinomycetales|Rep...    52   1e-05
UniRef50_A0RU83 Cluster: Acetylornithine deacetylase/succinyl-di...    52   1e-05
UniRef50_Q6GF48 Cluster: Probable succinyl-diaminopimelate desuc...    52   1e-05
UniRef50_Q8G5E2 Cluster: Widely conserved protein in peptidase o...    52   2e-05
UniRef50_Q836F6 Cluster: Peptidase, M20/M25/M40 family; n=3; Lac...    52   2e-05
UniRef50_A7CQP7 Cluster: Peptidase M20; n=1; Opitutaceae bacteri...    52   2e-05
UniRef50_Q6C2N8 Cluster: Similar to sp|P38149 Saccharomyces cere...    52   2e-05
UniRef50_Q0W1H4 Cluster: Predicted peptidase; n=2; cellular orga...    52   2e-05
UniRef50_A5WGM6 Cluster: Acetylornithine deacetylase; n=3; Psych...    51   3e-05
UniRef50_Q55RC2 Cluster: Putative uncharacterized protein; n=2; ...    51   3e-05
UniRef50_Q64B38 Cluster: Possible succinyl-diaminopimelate desuc...    51   3e-05
UniRef50_Q83NH1 Cluster: Putative peptidase; n=2; Tropheryma whi...    51   3e-05
UniRef50_Q4JXN9 Cluster: Putative peptidase; n=1; Corynebacteriu...    51   3e-05
UniRef50_O34984 Cluster: Acetylornitine deacetylase; n=5; Bacill...    51   3e-05
UniRef50_Q1AYU9 Cluster: Peptidase M20; n=1; Rubrobacter xylanop...    51   3e-05
UniRef50_Q0LPB5 Cluster: Peptidase M20; n=1; Herpetosiphon auran...    51   3e-05
UniRef50_Q8CUJ6 Cluster: Hypothetical conserved protein; n=1; Oc...    50   5e-05
UniRef50_Q4Q673 Cluster: Peptidase m20/m25/m40 family-like prote...    50   5e-05
UniRef50_A7T8U3 Cluster: Predicted protein; n=1; Nematostella ve...    50   5e-05
UniRef50_Q6F127 Cluster: Arginine catabolism aminotransferase; n...    50   6e-05
UniRef50_Q5WDJ9 Cluster: Deacylase; n=1; Bacillus clausii KSM-K1...    50   6e-05
UniRef50_Q0SAA1 Cluster: Possible peptidase M20/M25/M40 family, ...    50   6e-05
UniRef50_Q54X02 Cluster: Putative uncharacterized protein; n=1; ...    50   6e-05
UniRef50_O07121 Cluster: Dipeptidase; n=53; Lactobacillales|Rep:...    50   8e-05
UniRef50_Q6L031 Cluster: N-acyl-L-amino acid amidohydrolase; n=2...    50   8e-05
UniRef50_Q9ZC93 Cluster: SUCCINYL-DIAMINOPIMELATE DESUCCINYLASE;...    49   1e-04
UniRef50_Q4FL07 Cluster: Acetylornithine deacetylase; n=3; Bacte...    49   1e-04
UniRef50_A5G0P2 Cluster: Peptidase dimerisation domain protein; ...    49   1e-04
UniRef50_Q4CYZ6 Cluster: Glutamamyl carboxypeptidase, putative; ...    49   1e-04
UniRef50_A4R5H7 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_UPI0000DAE721 Cluster: hypothetical protein Rgryl_01001...    49   1e-04
UniRef50_UPI0000D573E7 Cluster: PREDICTED: similar to Cytosolic ...    49   1e-04
UniRef50_Q6MBN6 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q03SG4 Cluster: Acetylornithine deacetylase/Succinyl-di...    49   1e-04
UniRef50_Q4JBN8 Cluster: Peptidase; n=3; Sulfolobaceae|Rep: Pept...    49   1e-04
UniRef50_A0B5Z5 Cluster: Acetylornithine deacetylase or succinyl...    49   1e-04
UniRef50_Q3J7Y6 Cluster: Acetylornithine deacetylase; n=1; Nitro...    48   2e-04
UniRef50_A3WFG4 Cluster: Succinyl-diaminopimelate desuccinylase;...    48   2e-04
UniRef50_Q4D7V2 Cluster: Acetylornithine deacetylase-like, putat...    48   2e-04
UniRef50_UPI000050F9BC Cluster: COG0624: Acetylornithine deacety...    48   2e-04
UniRef50_A5WD56 Cluster: Succinyl-diaminopimelate desuccinylase;...    48   3e-04
UniRef50_A5UWC2 Cluster: Peptidase M20; n=4; Chloroflexaceae|Rep...    48   3e-04
UniRef50_Q4S5S8 Cluster: Chromosome 9 SCAF14729, whole genome sh...    47   4e-04
UniRef50_Q92B89 Cluster: Lin1661 protein; n=32; Bacilli|Rep: Lin...    47   4e-04
UniRef50_Q88XA5 Cluster: Dipeptidase; n=4; Lactobacillus|Rep: Di...    47   4e-04
UniRef50_Q5KW20 Cluster: Xaa-His dipeptidase; n=3; Bacillaceae|R...    47   4e-04
UniRef50_Q033W2 Cluster: Acetylornithine deacetylase/Succinyl-di...    47   4e-04
UniRef50_A7BDH0 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_A2QKD8 Cluster: Putative frameshift; n=1; Aspergillus n...    47   4e-04
UniRef50_P45494 Cluster: Beta-Ala-Xaa dipeptidase; n=6; Lactobac...    47   4e-04
UniRef50_Q5WY21 Cluster: Succinyl-diaminopimelate desuccinylase;...    47   6e-04
UniRef50_A6VSF3 Cluster: Acetylornithine deacetylase; n=32; Prot...    47   6e-04
UniRef50_Q97T10 Cluster: Peptidase, M20/M25/M40 family; n=30; St...    46   7e-04
UniRef50_Q47ZZ9 Cluster: Putative peptidase, M20/M25/M40 family;...    46   7e-04
UniRef50_Q6SFC6 Cluster: Peptidase, M20/M25/M40 family; n=3; Bac...    46   7e-04
UniRef50_Q18CN3 Cluster: Putative peptidase; n=2; Clostridium di...    46   7e-04
UniRef50_A0DN51 Cluster: Chromosome undetermined scaffold_57, wh...    46   7e-04
UniRef50_Q08BB2 Cluster: Zgc:154035; n=6; Clupeocephala|Rep: Zgc...    46   0.001
UniRef50_Q6LNK8 Cluster: Hypothetical peptidase, M20/M25/M40 fam...    46   0.001
UniRef50_Q8NM54 Cluster: Acetylornithine deacetylase/Succinyl-di...    46   0.001
UniRef50_Q1VM22 Cluster: Acetylornithine deacetylase; n=1; Psych...    46   0.001
UniRef50_A5ZQN2 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q0W5T9 Cluster: Acetylornithine deacetylase; n=1; uncul...    46   0.001
UniRef50_Q9A3G5 Cluster: Peptidase, M20/M25/M40 family; n=3; Alp...    45   0.002
UniRef50_Q88VV9 Cluster: Succinyl-diaminopimelate desuccinylase;...    45   0.002
UniRef50_Q1Q1P1 Cluster: Similar to succinyl-diaminopimelate des...    45   0.002
UniRef50_Q0RYH1 Cluster: Acetylornithine deacetylase; n=1; Rhodo...    45   0.002
UniRef50_A2QVX8 Cluster: Similarity to carnosinase 2 polypeptide...    45   0.002
UniRef50_Q9V0C1 Cluster: Metallopeptidase, M20/M25/M40 family; n...    45   0.002
UniRef50_O29358 Cluster: Succinyl-diaminopimelate desuccinylase;...    45   0.002
UniRef50_P57196 Cluster: Succinyl-diaminopimelate desuccinylase;...    45   0.002
UniRef50_P54638 Cluster: Acetylornithine deacetylase; n=1; Dicty...    45   0.002
UniRef50_Q987H6 Cluster: Acetylornithinase; n=7; Alphaproteobact...    45   0.002
UniRef50_Q8R5R5 Cluster: Acetylornithine deacetylase/Succinyl-di...    45   0.002
UniRef50_A6VUA6 Cluster: Acetylornithine deacetylase (ArgE) prec...    45   0.002
UniRef50_A5DQK0 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q4J819 Cluster: Peptidase; n=2; Sulfolobus|Rep: Peptida...    45   0.002
UniRef50_Q9A2D4 Cluster: Acetylornithine deacetylase; n=6; Prote...    44   0.003
UniRef50_Q5LPN6 Cluster: Acetylornithine deacetylase; n=20; Rhod...    44   0.003
UniRef50_Q472F4 Cluster: Acetylornithine deacetylase; n=3; cellu...    44   0.003
UniRef50_Q194E9 Cluster: Dipeptidase, putative; n=2; Desulfitoba...    44   0.003
UniRef50_Q184U1 Cluster: Putative dipeptidase; n=2; Clostridium ...    44   0.003
UniRef50_Q08YV7 Cluster: Peptidase, M20/M25/M40 family; n=1; Sti...    44   0.003
UniRef50_Q96DM4 Cluster: CDNA FLJ32569 fis, clone SPLEN2000134, ...    44   0.003
UniRef50_A6SRY9 Cluster: Putative uncharacterized protein; n=2; ...    44   0.003
UniRef50_A3DKU1 Cluster: Acetylornithine deacetylase or succinyl...    44   0.003
UniRef50_Q2W4P6 Cluster: Acetylornithine deacetylase/Succinyl-di...    44   0.004
UniRef50_Q9F8K6 Cluster: Putative peptidase; n=1; Carboxydotherm...    44   0.004
UniRef50_A6Q7J0 Cluster: Succinyl-diaminopimelate desuccinylase;...    44   0.004
UniRef50_A7TQL0 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_A6RA73 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q8TV20 Cluster: Predicted deacylase; n=1; Methanopyrus ...    44   0.004
UniRef50_Q399G5 Cluster: Peptidase M20; n=51; cellular organisms...    44   0.005
UniRef50_O85036 Cluster: Dipeptidase homolog; n=1; Mycoplasma ho...    44   0.005
UniRef50_A4BTC9 Cluster: Acetylornithine deacetylase; n=3; Ectot...    44   0.005
UniRef50_Q4QIR7 Cluster: Acetylornithine deacetylase-like protei...    44   0.005
UniRef50_P38149 Cluster: WD repeat-containing protein YBR281C; n...    44   0.005
UniRef50_Q5ZWC1 Cluster: Acetylornithine deacetylase; n=4; Legio...    43   0.007
UniRef50_Q3C169 Cluster: ArcT; n=33; Lactobacillales|Rep: ArcT -...    43   0.007
UniRef50_Q0LD09 Cluster: Peptidase M20; n=1; Herpetosiphon auran...    43   0.007
UniRef50_Q025W8 Cluster: Peptidase M20 precursor; n=1; Solibacte...    43   0.007
UniRef50_A6NPC8 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_A0JVT4 Cluster: Acetylornithine deacetylase or succinyl...    43   0.007
UniRef50_Q4J701 Cluster: Acetylornithine deacetylase; n=2; Sulfo...    43   0.007
UniRef50_A0SNZ3 Cluster: Succinyl-diaminopimelate desuccinylase;...    43   0.007
UniRef50_Q9X1Z4 Cluster: Succinyl-diaminopimelate desuccinylase,...    43   0.009
UniRef50_Q7VF72 Cluster: Succinyl-diaminopimelate desuccinylase;...    43   0.009
UniRef50_Q6YQT3 Cluster: Acetylornithine deacetylase; n=12; Cand...    43   0.009
UniRef50_Q5FPX5 Cluster: Succinyl-diaminopimelate desuccinylase;...    43   0.009
UniRef50_Q0F981 Cluster: Acetylornithine deacetylase; n=2; Alpha...    43   0.009
UniRef50_Q02AW5 Cluster: Peptidase M20 precursor; n=1; Solibacte...    43   0.009
UniRef50_A4EAN6 Cluster: Putative uncharacterized protein; n=1; ...    43   0.009
UniRef50_A7I845 Cluster: Acetylornithine deacetylase or succinyl...    43   0.009
UniRef50_A4WL33 Cluster: Acetylornithine deacetylase or succinyl...    43   0.009
UniRef50_Q7VRT2 Cluster: Succinyl-diaminopimelate desuccinylase;...    42   0.012
UniRef50_Q182H7 Cluster: Putative peptidase; n=2; Clostridium di...    42   0.012
UniRef50_Q0K418 Cluster: Acetylornithine deacetylase precursor; ...    42   0.012
UniRef50_A6GG07 Cluster: Putative peptidase, M20/M25/M40 family ...    42   0.012
UniRef50_A0YAV9 Cluster: Putative uncharacterized protein; n=1; ...    42   0.012
UniRef50_Q01DV7 Cluster: DIP-1; n=1; Ostreococcus tauri|Rep: DIP...    42   0.012
UniRef50_Q892Y8 Cluster: XAA-His dipeptidase; n=14; Clostridia|R...    42   0.016
UniRef50_Q8RNM5 Cluster: Zn metalloprotein; n=5; Bacteria|Rep: Z...    42   0.016
UniRef50_Q1LH39 Cluster: Peptidase M20 precursor; n=1; Ralstonia...    42   0.016
UniRef50_Q0FFV4 Cluster: Putative uncharacterized protein; n=1; ...    42   0.016
UniRef50_A6TN14 Cluster: Dipeptidase, putative; n=1; Alkaliphilu...    42   0.016
UniRef50_A6FPM0 Cluster: D-tyrosyl-tRNA deacylase; n=1; Roseobac...    42   0.016
UniRef50_A0NQR9 Cluster: Acetylornithine deacetylase; n=9; Rhodo...    42   0.016
UniRef50_A2FJP6 Cluster: Clan MH, family M20, peptidase T-like m...    42   0.016
UniRef50_A3GFT0 Cluster: Metalloexopeptidase; n=3; Saccharomycet...    42   0.016
UniRef50_Q483J4 Cluster: Acetylornithine deacetylase; n=1; Colwe...    42   0.021
UniRef50_Q160L0 Cluster: Acetylornithine deacetylase, putative; ...    42   0.021
UniRef50_Q03S16 Cluster: Acetylornithine deacetylase/Succinyl-di...    42   0.021
UniRef50_Q97ZB7 Cluster: Acetylornithine deacetylase; n=3; Sulfo...    42   0.021
UniRef50_Q2FFY7 Cluster: Putative dipeptidase SAUSA300_1697; n=1...    42   0.021
UniRef50_Q81YY6 Cluster: Acetylornitine deacetylase, putative; n...    41   0.028
UniRef50_Q5P9A2 Cluster: Succinyl-diaminopimelate desuccinylase;...    41   0.028
UniRef50_Q5LM87 Cluster: Acetylornithine deacetylase; n=1; Silic...    41   0.028
UniRef50_Q84GL0 Cluster: Succinyldiaminopimelate desuccinylase; ...    41   0.028
UniRef50_Q1U6J4 Cluster: Peptidase M20A, peptidase V; n=2; Lacto...    41   0.028
UniRef50_Q0FSK2 Cluster: Acetylornithine deacetylase; n=1; Roseo...    41   0.028
UniRef50_Q028R7 Cluster: Peptidase M20 precursor; n=1; Solibacte...    41   0.028
UniRef50_Q0U762 Cluster: Putative uncharacterized protein; n=1; ...    41   0.028
UniRef50_P0AED8 Cluster: Succinyl-diaminopimelate desuccinylase;...    41   0.028
UniRef50_UPI00015BB0F6 Cluster: acetylornithine deacetylase or s...    41   0.037
UniRef50_Q8UJJ8 Cluster: Acetylornithine deacetylase; n=1; Agrob...    41   0.037
UniRef50_Q62JI2 Cluster: Acetylornithine deacetylase; n=43; Bact...    41   0.037
UniRef50_Q5GS68 Cluster: Acetylornithine deacetylase/Succinyl-di...    41   0.037
UniRef50_Q38Z56 Cluster: Succinyl-diaminopimelate desuccinylase;...    41   0.037
UniRef50_A6U6C4 Cluster: Acetylornithine deacetylase or succinyl...    41   0.037
UniRef50_Q9YEE4 Cluster: Putative uncharacterized protein; n=1; ...    41   0.037
UniRef50_Q4J8C5 Cluster: Succinyl-diaminopimelate desuccinylase;...    41   0.037
UniRef50_Q8A1V9 Cluster: Acetylornithine deacetylase; n=8; Bacte...    40   0.049
UniRef50_Q73RM0 Cluster: Peptidase, M20/M25/M40 family; n=1; Tre...    40   0.049
UniRef50_Q6N5E6 Cluster: Possible acetylornitine deacetylase; n=...    40   0.049
UniRef50_Q5FRQ9 Cluster: N-acyl-L-amino acid amidohydrolase; n=2...    40   0.049
UniRef50_Q3E237 Cluster: Peptidase M20:Peptidase dimerisation; n...    40   0.049
UniRef50_Q5AAB6 Cluster: Putative uncharacterized protein; n=2; ...    40   0.049
UniRef50_Q2FNX2 Cluster: Peptidase M20; n=1; Methanospirillum hu...    40   0.049
UniRef50_UPI0000583EB6 Cluster: PREDICTED: hypothetical protein;...    40   0.065
UniRef50_Q193M3 Cluster: Peptidase M20; n=11; Bacteria|Rep: Pept...    40   0.065
UniRef50_O32633 Cluster: DapE; n=5; Helicobacter|Rep: DapE - Hel...    40   0.065
UniRef50_A6W2W9 Cluster: Peptidase M20; n=1; Marinomonas sp. MWY...    40   0.065
UniRef50_A3K4G5 Cluster: Acetylornithine deacetylase; n=1; Sagit...    40   0.065
UniRef50_A3JSZ2 Cluster: Acetylornithine deacetylase; n=8; Prote...    40   0.065
UniRef50_Q57899 Cluster: Uncharacterized protein MJ0457; n=6; Me...    40   0.065
UniRef50_Q8CMV9 Cluster: Succinyl-diaminopimelate desuccinylase;...    40   0.085
UniRef50_Q81QW8 Cluster: Peptidase, M20/M25/M40 family; n=12; Ba...    40   0.085
UniRef50_Q1DFN7 Cluster: Peptidase homolog, M20 family; n=1; Myx...    40   0.085
UniRef50_A4C641 Cluster: Succinyl-diaminopimelate desuccinylase;...    40   0.085
UniRef50_Q55FR8 Cluster: Peptidase M20 family protein; n=1; Dict...    40   0.085
UniRef50_Q6N7D3 Cluster: Possible acetylornithine deacetylase; n...    39   0.11 
UniRef50_Q606D5 Cluster: Acetylornithine deacetylase; n=13; Gamm...    39   0.11 
UniRef50_Q12C18 Cluster: Succinyl-diaminopimelate desuccinylase;...    39   0.11 
UniRef50_A7III1 Cluster: Acetylornithine deacetylase; n=1; Xanth...    39   0.11 
UniRef50_A5TTA2 Cluster: M20 family peptidase; n=3; Fusobacteriu...    39   0.11 
UniRef50_Q23YE0 Cluster: Peptidase family M20/M25/M40 containing...    39   0.11 
UniRef50_Q758A6 Cluster: AEL154Cp; n=1; Eremothecium gossypii|Re...    39   0.11 
UniRef50_Q4P0N3 Cluster: Putative uncharacterized protein; n=1; ...    39   0.11 
UniRef50_A5DWG9 Cluster: Putative uncharacterized protein; n=1; ...    39   0.11 
UniRef50_Q8ZVD7 Cluster: Possible succinyl-diaminopimelate desuc...    39   0.11 
UniRef50_Q9K7T7 Cluster: Xaa-His dipeptidase; n=2; Bacillus|Rep:...    39   0.15 
UniRef50_Q7MSC2 Cluster: DESUCCINYLASE; n=7; Epsilonproteobacter...    39   0.15 
UniRef50_Q127H2 Cluster: Acetylornithine deacetylase; n=1; Polar...    39   0.15 
UniRef50_Q0RYX8 Cluster: Probable acetylornithine deacetylase; n...    39   0.15 
UniRef50_A5UPI2 Cluster: Peptidase M20 precursor; n=2; Roseiflex...    39   0.15 
UniRef50_A4GK40 Cluster: Succinyl-diaminopimelate desuccinylase;...    39   0.15 
UniRef50_A4AKT2 Cluster: Putative uncharacterized protein; n=3; ...    39   0.15 
UniRef50_A4ADK2 Cluster: Peptidase M20; n=3; Proteobacteria|Rep:...    39   0.15 
UniRef50_Q0W867 Cluster: Putative peptidase (M20 family), N-term...    39   0.15 
UniRef50_Q9CLT9 Cluster: Acetylornithine deacetylase; n=98; Gamm...    39   0.15 
UniRef50_UPI0000E4862E Cluster: PREDICTED: hypothetical protein;...    38   0.20 
UniRef50_Q2LTL1 Cluster: Succinyl-diaminopimelate desuccinylase;...    38   0.20 
UniRef50_Q1AT76 Cluster: Acetylornithine deacetylase or succinyl...    38   0.20 
UniRef50_Q18D47 Cluster: Putative acetylornithine deacetylase; n...    38   0.20 
UniRef50_Q121P8 Cluster: Peptidase M20; n=17; cellular organisms...    38   0.20 
UniRef50_A4B8F1 Cluster: Succinyl-diaminopimelate desuccinylase;...    38   0.20 
UniRef50_A0Y199 Cluster: Succinyl-diaminopimelate desuccinylase;...    38   0.20 
UniRef50_A0NJH0 Cluster: Dipeptidase 2, peptidase M20 family; n=...    38   0.20 
UniRef50_A3GGM0 Cluster: Predicted protein; n=5; Saccharomycetal...    38   0.20 
UniRef50_Q9YAM6 Cluster: Putative uncharacterized protein; n=1; ...    38   0.20 
UniRef50_O59017 Cluster: Putative uncharacterized protein PH1289...    38   0.20 
UniRef50_A3H786 Cluster: Acetylornithine deacetylase or succinyl...    38   0.20 
UniRef50_Q9CC46 Cluster: Possible peptidase; n=41; Actinomycetal...    38   0.26 
UniRef50_Q5YZ79 Cluster: Putative peptidase; n=1; Nocardia farci...    38   0.26 
UniRef50_Q46ST1 Cluster: Peptidase M20A, peptidase V; n=9; Burkh...    38   0.26 
UniRef50_Q2BDY9 Cluster: Putative uncharacterized protein; n=1; ...    38   0.26 
UniRef50_Q1GWN2 Cluster: Peptidase M20 precursor; n=3; Sphingomo...    38   0.26 
UniRef50_Q1GRJ2 Cluster: Succinyl-diaminopimelate desuccinylase;...    38   0.26 
UniRef50_Q096S1 Cluster: Putative hydrolase; n=1; Stigmatella au...    38   0.26 
UniRef50_Q5JJ48 Cluster: ArgE/DapE-related deacylase; n=2; Therm...    38   0.26 
UniRef50_Q6F727 Cluster: N-acetylornithine deacetylase; n=1; Aci...    38   0.34 
UniRef50_Q2S0F6 Cluster: Peptidase, M20A family; n=1; Salinibact...    38   0.34 
UniRef50_Q1GMM6 Cluster: Peptidase M20; n=27; Alphaproteobacteri...    38   0.34 
UniRef50_Q12AJ8 Cluster: Acetylornithine deacetylase; n=5; Prote...    38   0.34 
UniRef50_A7DH29 Cluster: Acetylornithine deacetylase; n=3; Rhizo...    38   0.34 
UniRef50_A4CM93 Cluster: Putative uncharacterized protein; n=2; ...    38   0.34 
UniRef50_Q54RW1 Cluster: Putative uncharacterized protein; n=1; ...    38   0.34 
UniRef50_Q38UY8 Cluster: Putative peptidase M20 family; n=1; Lac...    37   0.46 
UniRef50_Q1VKX7 Cluster: Succinyl-diaminopimelate desuccinylase;...    37   0.46 
UniRef50_A6D4Q5 Cluster: Putative uncharacterized protein; n=1; ...    37   0.46 
UniRef50_A6C6D7 Cluster: Acetylornithine deacetylase ArgE; n=1; ...    37   0.46 
UniRef50_A5EHZ6 Cluster: Putative Acetylornithine deacetylase/Su...    37   0.46 
UniRef50_A0NZD1 Cluster: Acetylornithine deacetylase; n=5; Alpha...    37   0.46 
UniRef50_Q55DP8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.46 
UniRef50_A2SSX8 Cluster: Peptidase M20; n=1; Methanocorpusculum ...    37   0.46 
UniRef50_Q7UM22 Cluster: Acetylornithine deacetylase ArgE; n=1; ...    37   0.60 
UniRef50_Q5FNS4 Cluster: N-acyl-L-amino acid amidohydrolase; n=4...    37   0.60 
UniRef50_Q28PW3 Cluster: Peptidase M20; n=1; Jannaschia sp. CCS1...    37   0.60 
UniRef50_A5NQ23 Cluster: Acetylornithine deacetylase; n=1; Methy...    37   0.60 
UniRef50_A4EAQ9 Cluster: Putative uncharacterized protein; n=1; ...    37   0.60 
UniRef50_A3XYG5 Cluster: Xaa-His dipeptidase; n=2; Vibrio|Rep: X...    37   0.60 
UniRef50_A3RWM6 Cluster: Carboxypeptidase S; n=10; Proteobacteri...    37   0.60 
UniRef50_A1SQ01 Cluster: Peptidase M20; n=1; Nocardioides sp. JS...    37   0.60 
UniRef50_Q74M62 Cluster: NEQ511; n=1; Nanoarchaeum equitans|Rep:...    37   0.60 
UniRef50_A3DME3 Cluster: Peptidase M20; n=1; Staphylothermus mar...    37   0.60 
UniRef50_UPI0000589691 Cluster: UPI0000589691 related cluster; n...    36   0.80 
UniRef50_Q88TR8 Cluster: Succinyl-diaminopimelate desuccinylase;...    36   0.80 
UniRef50_Q46SJ7 Cluster: Peptidase M20:Peptidase dimerisation; n...    36   0.80 
UniRef50_Q1AX76 Cluster: Acetylornithine deacetylase or succinyl...    36   0.80 
UniRef50_A3TJC6 Cluster: Zinc metalloprotein; n=1; Janibacter sp...    36   0.80 
UniRef50_Q8YEQ1 Cluster: N-ACYL-L-AMINO ACID AMIDOHYDROLASE; n=6...    36   1.1  
UniRef50_Q3IHM2 Cluster: Putative hydrolase; n=3; Alteromonadale...    36   1.1  
UniRef50_Q39GU3 Cluster: Peptidase M20; n=44; Bacteria|Rep: Pept...    36   1.1  
UniRef50_Q15MX7 Cluster: Peptidase M20 precursor; n=1; Pseudoalt...    36   1.1  
UniRef50_A4BBG4 Cluster: Acetylornithine deacetylase; n=1; Reine...    36   1.1  
UniRef50_A3PQA7 Cluster: Peptidase M20; n=2; Rhodobacter sphaero...    36   1.1  
UniRef50_Q5KLQ1 Cluster: Carboxypeptidase s, putative; n=1; Filo...    36   1.1  
UniRef50_Q0CVH5 Cluster: Predicted protein; n=1; Aspergillus ter...    36   1.1  
UniRef50_A7TG58 Cluster: Putative uncharacterized protein; n=1; ...    36   1.1  
UniRef50_P44514 Cluster: Succinyl-diaminopimelate desuccinylase;...    36   1.1  
UniRef50_Q9AA70 Cluster: M20/M25/M40 family peptidase; n=2; Caul...    36   1.4  
UniRef50_Q8G5X6 Cluster: Putative uncharacterized protein; n=2; ...    36   1.4  
UniRef50_Q8D2S2 Cluster: DapE protein; n=1; Wigglesworthia gloss...    36   1.4  
UniRef50_Q093A1 Cluster: Acetylornithine deacetylase; n=2; Cysto...    36   1.4  
UniRef50_Q037Q9 Cluster: Acetylornithine deacetylase/Succinyl-di...    36   1.4  
UniRef50_A6TL17 Cluster: Acetylornithine deacetylase or succinyl...    36   1.4  
UniRef50_Q5KE59 Cluster: Putative uncharacterized protein; n=2; ...    36   1.4  
UniRef50_Q9HJN3 Cluster: Acetylornithine deacetylase related pro...    36   1.4  
UniRef50_Q41B93 Cluster: Peptidase M20A, peptidase V; n=2; Bacil...    35   1.8  
UniRef50_A6G2Q6 Cluster: Peptidase, M20E (Gly-X carboxypeptidase...    35   1.8  
UniRef50_A3I8X3 Cluster: Succinyl-diaminopimelate desuccinylase;...    35   1.8  
UniRef50_Q6BFV7 Cluster: Succinyl-diaminopimelate desuccinylase,...    35   1.8  
UniRef50_A3CVJ6 Cluster: Acetylornithine deacetylase or succinyl...    35   1.8  
UniRef50_Q6D5Q3 Cluster: Putative peptidase; n=1; Pectobacterium...    35   2.4  
UniRef50_Q18D33 Cluster: Putative peptidase; n=2; Clostridium di...    35   2.4  
UniRef50_A2RIP5 Cluster: Acetylornithine deacetylase; n=2; Lacto...    35   2.4  
UniRef50_Q7RED4 Cluster: Ion transport protein, putative; n=5; P...    35   2.4  
UniRef50_Q55DL1 Cluster: Putative uncharacterized protein; n=1; ...    35   2.4  
UniRef50_O13968 Cluster: Vacuolar carboxypeptidase; n=1; Schizos...    35   2.4  
UniRef50_Q41D95 Cluster: Acetylornithine deacetylase or succinyl...    34   3.2  
UniRef50_A7LAT6 Cluster: ArgE; n=4; Bacteria|Rep: ArgE - Trepone...    34   3.2  
UniRef50_A3M1T6 Cluster: Putative uncharacterized protein; n=1; ...    34   3.2  
UniRef50_A3JLH3 Cluster: Acetylornithine deacetylase; n=2; Alpha...    34   3.2  
UniRef50_A1FDE1 Cluster: Peptidase M20A, peptidase V precursor; ...    34   3.2  
UniRef50_Q27SP3 Cluster: Succinyl-diaminopimelate desuccinylase;...    34   3.2  
UniRef50_A5E5L8 Cluster: Putative uncharacterized protein; n=1; ...    34   3.2  
UniRef50_A7D818 Cluster: Peptidase M20; n=1; Halorubrum lacuspro...    34   3.2  
UniRef50_Q2J011 Cluster: Peptidase M20; n=1; Rhodopseudomonas pa...    34   4.2  
UniRef50_Q1NYT7 Cluster: Acetylornithine deacetylase; n=1; Candi...    34   4.2  
UniRef50_Q1IRH8 Cluster: Peptidase M20 precursor; n=2; Acidobact...    34   4.2  
UniRef50_A3VTY3 Cluster: Acetylornithine deacetylase; n=1; Parvu...    34   4.2  
UniRef50_A0Z406 Cluster: Peptidase M20; n=1; marine gamma proteo...    34   4.2  
UniRef50_A0NRF4 Cluster: Acetylornithine deacetylase; n=1; Stapp...    34   4.2  
UniRef50_Q310N9 Cluster: Acetylornithine deacetylase or succinyl...    33   5.6  
UniRef50_Q28JT6 Cluster: Peptidase M20; n=1; Jannaschia sp. CCS1...    33   5.6  
UniRef50_Q0EYR9 Cluster: Succinyl-diaminopimelate desuccinylase;...    33   5.6  
UniRef50_Q04X55 Cluster: Metallopeptidase; n=5; Leptospira|Rep: ...    33   5.6  
UniRef50_A7HPA0 Cluster: Peptidase M20; n=1; Parvibaculum lavame...    33   5.6  
UniRef50_A7C8L2 Cluster: Peptidase dimerisation domain protein p...    33   5.6  
UniRef50_A6BZG8 Cluster: Acetylornithine deacetylase; n=2; Planc...    33   5.6  
UniRef50_A0QXR5 Cluster: Acetylornithine deacetylase; n=3; Bacte...    33   5.6  
UniRef50_Q4P7E9 Cluster: Putative uncharacterized protein; n=1; ...    33   5.6  
UniRef50_Q0CBZ9 Cluster: Putative uncharacterized protein; n=1; ...    33   5.6  
UniRef50_A7D111 Cluster: Acetylornithine deacetylase or succinyl...    33   5.6  
UniRef50_Q9CM87 Cluster: Probable sugar efflux transporter; n=39...    33   5.6  
UniRef50_Q2RHZ1 Cluster: Peptidase dimerisation; n=1; Moorella t...    33   7.4  
UniRef50_A6FQK4 Cluster: Acetylornithine deacetylase; n=3; Alpha...    33   7.4  
UniRef50_A5V1V0 Cluster: Acetylornithine deacetylase or succinyl...    33   7.4  
UniRef50_A0NJ96 Cluster: Succinyldiaminopimelate; n=2; Oenococcu...    33   7.4  
UniRef50_Q1WVG7 Cluster: Succinyl-diaminopimelate desuccinylase;...    33   9.8  
UniRef50_Q0C4K0 Cluster: Peptidase, M20/M25/M40 family; n=1; Hyp...    33   9.8  
UniRef50_A4AX04 Cluster: Type III restriction enzyme, res subuni...    33   9.8  
UniRef50_A4A3I4 Cluster: Peptidase M20; n=1; Congregibacter lito...    33   9.8  
UniRef50_A3QGR1 Cluster: Succinyl-diaminopimelate desuccinylase;...    33   9.8  
UniRef50_A1SQB8 Cluster: Acetylornithine deacetylase or succinyl...    33   9.8  
UniRef50_A0PZ97 Cluster: Acetylornithine deacetylase, putative; ...    33   9.8  
UniRef50_A0KY51 Cluster: Dipeptidase, putative; n=12; Shewanella...    33   9.8  
UniRef50_Q7YX63 Cluster: Putative uncharacterized protein; n=1; ...    33   9.8  
UniRef50_Q0USR5 Cluster: Putative uncharacterized protein; n=2; ...    33   9.8  
UniRef50_A2BJ40 Cluster: Acetylornithine deacetylase related pro...    33   9.8  

>UniRef50_UPI00015B62FD Cluster: PREDICTED: similar to glutamate
           carboxypeptidase; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to glutamate carboxypeptidase -
           Nasonia vitripennis
          Length = 515

 Score =  119 bits (287), Expect = 7e-26
 Identities = 55/85 (64%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 KLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDG 434
           K K++GATTEL D+G Q + +GK++            DPKK TV IYGHLDVQPALK DG
Sbjct: 92  KFKQLGATTELADLGTQKLPNGKEIPLPPALLGTLGTDPKKKTVLIYGHLDVQPALKEDG 151

Query: 435 WETEPFELVERNEKLYGRGSTDDKG 509
           W+TEPFELVE++EKLYGRGSTDDKG
Sbjct: 152 WDTEPFELVEKDEKLYGRGSTDDKG 176



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 29/59 (49%), Positives = 38/59 (64%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGLTAY*WTN*NLRDSLIV*TMYV 685
           PVL WLH +  Y+  G ++PVN+KF+FE MEESGSEGL    W+    +DS +    YV
Sbjct: 177 PVLCWLHALQGYQALGEDIPVNVKFVFEGMEESGSEGLDELLWSR---KDSFLKGVDYV 232



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 28/41 (68%), Positives = 30/41 (73%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD LL  +   + F   VDYVCISDNYWLGTTKPCIT GLR
Sbjct: 214 LDELLWSR--KDSFLKGVDYVCISDNYWLGTTKPCITYGLR 252



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 18/48 (37%), Positives = 29/48 (60%)
 Frame = +1

Query: 115 TLPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMVHWMQT 258
           +L  +F ++D NK  Y   L++ VAI SVS   + R + I+M+ W +T
Sbjct: 44  SLTLLFAHIDSNKTRYIDNLRQVVAIKSVSAWPESRDEIIKMMKWAET 91


>UniRef50_Q96KP4 Cluster: Cytosolic non-specific dipeptidase; n=53;
           Fungi/Metazoa group|Rep: Cytosolic non-specific
           dipeptidase - Homo sapiens (Human)
          Length = 475

 Score =  105 bits (251), Expect = 2e-21
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           A  +K++G + EL D+G Q + DG ++           +DP+K TVCIYGHLDVQPA   
Sbjct: 49  AADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALE 108

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKG 509
           DGW++EPF LVER+ KLYGRGSTDDKG
Sbjct: 109 DGWDSEPFTLVERDGKLYGRGSTDDKG 135



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 26/41 (63%), Positives = 29/41 (70%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD L+    + + FF  VDYVCISDNYWLG  KPCIT GLR
Sbjct: 173 LDELIF--ARKDTFFKDVDYVCISDNYWLGKKKPCITYGLR 211



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 23/38 (60%), Positives = 30/38 (78%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PV GW++ + AY+ TG E+PVN++F  E MEESGSEGL
Sbjct: 136 PVAGWINALEAYQKTGQEIPVNVRFCLEGMEESGSEGL 173



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMV 243
           L  +FKY+D+N+D Y + L + VAI SVS   + R +  RM+
Sbjct: 4   LTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMM 45


>UniRef50_Q4V8S1 Cluster: Zgc:114181; n=1; Danio rerio|Rep:
           Zgc:114181 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 244

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 42/94 (44%), Positives = 60/94 (63%), Gaps = 1/94 (1%)
 Frame = +3

Query: 228 LHPYGSLDADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHL 404
           LH    + A+KL+ +G   E+ D+G QT+ +G  +           +DP K+TVC+YGH+
Sbjct: 57  LHRMMDMTAEKLRLIGGKVEMIDIGTQTLANGSSIDLPKVVTAQFGDDPSKHTVCVYGHV 116

Query: 405 DVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           DVQPA   DGW TEP+EL + N  LYGRG++D+K
Sbjct: 117 DVQPAKMEDGWSTEPYELTDLNGNLYGRGASDNK 150



 Score = 33.9 bits (74), Expect = 4.2
 Identities = 15/40 (37%), Positives = 27/40 (67%)
 Frame = +1

Query: 124 EIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMV 243
           E+ +YV+ ++D + + L++ +A+ S S DV  RAD  RM+
Sbjct: 22  ELTQYVNTHQDEFVETLRQWIAVESDSSDVTKRADLHRMM 61


>UniRef50_Q4SUU3 Cluster: Chromosome undetermined SCAF13842, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF13842,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 455

 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 44/94 (46%), Positives = 58/94 (61%), Gaps = 1/94 (1%)
 Frame = +3

Query: 228 LHPYGSLDADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHL 404
           LH    + A KL+++G T EL DVG Q + DG  +           ND  K+TVC+YGH+
Sbjct: 58  LHRMMEMVAQKLRQMGGTVELVDVGEQELPDGSTLALPKVVTAQFGNDSNKSTVCVYGHV 117

Query: 405 DVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           DVQPA   DGW TEP+ L + N  LYGRG++D+K
Sbjct: 118 DVQPAKLEDGWATEPYNLTDINGNLYGRGASDNK 151



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 24/40 (60%), Positives = 29/40 (72%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGLTA 628
           PVL W+H + AY+    ELPVN+KFI E MEE+GS GL A
Sbjct: 153 PVLAWIHAVQAYQALDVELPVNVKFIIEGMEETGSNGLDA 192


>UniRef50_Q96KN2 Cluster: Beta-Ala-His dipeptidase precursor; n=58;
           Eumetazoa|Rep: Beta-Ala-His dipeptidase precursor - Homo
           sapiens (Human)
          Length = 507

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 46/102 (45%), Positives = 59/102 (57%), Gaps = 1/102 (0%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           AD L+ +GA     D+G Q + DG+ +           +DP K TVC YGHLDVQPA + 
Sbjct: 82  ADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRG 141

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           DGW T+P+ L E + KLYGRG+TD+KG  L         RAL
Sbjct: 142 DGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRAL 183



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PVL W++ ++A++    +LPVN+KFI E MEE+GS  L
Sbjct: 169 PVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVAL 206



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +1

Query: 631 LMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           L++K K + FF  VDY+ ISDN W+   KP IT G R
Sbjct: 209 LVEKEK-DRFFSGVDYIVISDNLWISQRKPAITYGTR 244



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCD--VKYRADCIRMV 243
           L ++F+Y+D ++D + Q LKE VAI S S     ++R +  RM+
Sbjct: 35  LEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMM 78


>UniRef50_A6RX34 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 488

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 35/89 (39%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = +3

Query: 255 DKLKEVGATTELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDG 434
           D+L ++ A+ +   +G +      +            D KK TV IYGH DVQP    +G
Sbjct: 61  DQLTKLNASVDRHSLGKEPGTELQLPDVIIAKYPKAYDSKKKTVLIYGHYDVQP--PGEG 118

Query: 435 WETEPFELVERNE----KLYGRGSTDDKG 509
           W+T+P+ + E+ E    KLYGRGSTDDKG
Sbjct: 119 WDTDPWTITEKGEDPDKKLYGRGSTDDKG 147



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/41 (53%), Positives = 28/41 (68%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGLTAY 631
           PVLGWL+ + AY+    ++PVNL F FE MEESGS G   +
Sbjct: 148 PVLGWLNALQAYQEAKVDVPVNLIFCFEGMEESGSTGFADF 188



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 19/27 (70%), Positives = 21/27 (77%)
 Frame = +1

Query: 661 FDSVDYVCISDNYWLGTTKPCITNGLR 741
           F+ VD  CISDNYWL T KPC+T GLR
Sbjct: 196 FEHVDAACISDNYWLTTKKPCLTYGLR 222


>UniRef50_P43616 Cluster: Glutamate carboxypeptidase-like protein
           YFR044C; n=15; Dikarya|Rep: Glutamate
           carboxypeptidase-like protein YFR044C - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 481

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 30/51 (58%), Positives = 35/51 (68%), Gaps = 2/51 (3%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELV--ERNEKLYGRGSTDDKG 509
           +DP K TV +YGH DVQPA   DGW+TEPF+LV  E    + GRG TDD G
Sbjct: 90  SDPSKKTVLVYGHYDVQPAQLEDGWDTEPFKLVIDEAKGIMKGRGVTDDTG 140



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 25/42 (59%), Positives = 30/42 (71%)
 Frame = +1

Query: 616 RLDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           +LD L+  K +  G+F  VD VCISDNYWLGT KP +T GLR
Sbjct: 177 KLDELI--KKEANGYFKGVDAVCISDNYWLGTKKPVLTYGLR 216



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 19/35 (54%), Positives = 26/35 (74%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGS 613
           P+L W++ ++A+K +G E PVNL   FE MEESGS
Sbjct: 141 PLLSWINVVDAFKASGQEFPVNLVTCFEGMEESGS 175


>UniRef50_Q1IQK0 Cluster: Peptidase M20; n=3; Acidobacteria|Rep:
           Peptidase M20 - Acidobacteria bacterium (strain
           Ellin345)
          Length = 459

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 30/75 (40%), Positives = 38/75 (50%)
 Frame = +3

Query: 285 ELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWETEPFELVE 464
           EL+ +GF+ +   + +          +   K T   Y H DVQPA   D W T PFE  E
Sbjct: 49  ELKRIGFENVQVIETKGHPLVYGDWLHAEGKPTALCYAHYDVQPAEPLDEWHTPPFEPTE 108

Query: 465 RNEKLYGRGSTDDKG 509
           RN  LY RG+ DDKG
Sbjct: 109 RNSNLYARGAVDDKG 123


>UniRef50_Q0CZA8 Cluster: Putative uncharacterized protein; n=1;
           Aspergillus terreus NIH2624|Rep: Putative
           uncharacterized protein - Aspergillus terreus (strain
           NIH 2624)
          Length = 428

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 2/50 (4%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWE--TEPFELVERNEKLYGRGSTDDKG 509
           DPKK T+ IYGH DVQP  + +GW    +P++L E + KLYGRGSTDDKG
Sbjct: 94  DPKKRTILIYGHYDVQP--EGEGWTYPRKPWKLTEIDGKLYGRGSTDDKG 141



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 23/38 (60%), Positives = 28/38 (73%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           P+L WL+ + AY+  G +LPVNL F FE MEESGS GL
Sbjct: 142 PLLAWLNALEAYQKAGVDLPVNLLFCFEGMEESGSVGL 179


>UniRef50_Q3A281 Cluster: Acetylornithine
           deacetylase/succinyl-diaminopimelate desuccinylase- like
           protein; n=1; Pelobacter carbinolicus DSM 2380|Rep:
           Acetylornithine deacetylase/succinyl-diaminopimelate
           desuccinylase- like protein - Pelobacter carbinolicus
           (strain DSM 2380 / Gra Bd 1)
          Length = 456

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 30/80 (37%), Positives = 40/80 (50%)
 Frame = +3

Query: 270 VGATTELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWETEP 449
           V A  +L D+GF  ++                 P + T+ +YGH DVQPA   + W++ P
Sbjct: 44  VWAHQKLADIGFPKVETISTDGHPLVYAEWLAHPDQPTLLVYGHYDVQPAEPLEEWQSPP 103

Query: 450 FELVERNEKLYGRGSTDDKG 509
           FE   RN  LY RG  DDKG
Sbjct: 104 FEPTVRNGNLYARGVVDDKG 123


>UniRef50_Q9RSU7 Cluster: ArgE/DapE/Acy1 family protein; n=4;
           Deinococci|Rep: ArgE/DapE/Acy1 family protein -
           Deinococcus radiodurans
          Length = 459

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 27/47 (57%), Positives = 31/47 (65%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           P K TV IYGH DVQP    + W T PFE   R+ ++Y RGSTDDKG
Sbjct: 75  PGKPTVLIYGHYDVQPEAPLEEWHTPPFEPTVRDGRIYARGSTDDKG 121


>UniRef50_A1CN71 Cluster: Glutamate carboxypeptidase, putative;
           n=11; Ascomycota|Rep: Glutamate carboxypeptidase,
           putative - Aspergillus clavatus
          Length = 479

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDG-WETEPFELVERNEKLYGRGSTDDKG 509
           +D +K T+ +YGH DVQP  K DG W  E F+L E + KL+GRGSTDDKG
Sbjct: 90  HDSEKKTLLVYGHYDVQP--KGDGHWTHEAFDLTEDHGKLFGRGSTDDKG 137



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 22/41 (53%), Positives = 26/41 (63%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGLTAY 631
           PV GWL+ I AY+  G ELPVNL   FE MEE  S G + +
Sbjct: 138 PVCGWLNAIEAYQKAGVELPVNLMMCFEGMEEQDSSGFSDF 178



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 18/27 (66%), Positives = 22/27 (81%)
 Frame = +1

Query: 661 FDSVDYVCISDNYWLGTTKPCITNGLR 741
           F +VD +CI+DNYWL T KPC+T GLR
Sbjct: 187 FKNVDAICIADNYWLTTRKPCLTYGLR 213


>UniRef50_A7I4X2 Cluster: Peptidase M20; n=1; Candidatus
           Methanoregula boonei 6A8|Rep: Peptidase M20 -
           Methanoregula boonei (strain 6A8)
          Length = 467

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 27/48 (56%), Positives = 34/48 (70%), Gaps = 1/48 (2%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK-GLYLV 521
           TV +Y H DVQPA K DGW T+P+   E N +L+GRGS DDK G+ L+
Sbjct: 101 TVLMYAHYDVQPAKKEDGWTTDPWNPQEINGRLFGRGSADDKSGIMLI 148


>UniRef50_Q9RSV5 Cluster: ArgE/DapE/Acy1 family protein; n=3;
           Deinococci|Rep: ArgE/DapE/Acy1 family protein -
           Deinococcus radiodurans
          Length = 463

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 25/43 (58%), Positives = 31/43 (72%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+ IY H DVQP    + W+T PFEL ER  +LYGRG++DDKG
Sbjct: 71  TLLIYNHYDVQPEDPLELWDTPPFELTERGGRLYGRGASDDKG 113


>UniRef50_Q04FK4 Cluster: Dipeptidase; n=3; Leuconostocaceae|Rep:
           Dipeptidase - Oenococcus oeni (strain BAA-331 / PSU-1)
          Length = 473

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 25/42 (59%), Positives = 32/42 (76%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           V I  H+DV PA   DGWET+PF+ VER+ K++GRG+ DDKG
Sbjct: 85  VAILAHVDVMPA--GDGWETDPFKAVERSGKIFGRGTADDKG 124


>UniRef50_Q98AF9 Cluster: Mll6018 protein; n=1; Mesorhizobium
           loti|Rep: Mll6018 protein - Rhizobium loti
           (Mesorhizobium loti)
          Length = 486

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 26/47 (55%), Positives = 31/47 (65%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           P K T+ IYGH DVQP    D W T PFE   R+ +LY RG++DDKG
Sbjct: 78  PGKPTLLIYGHYDVQPPDPLDAWVTPPFEPTIRDGRLYARGASDDKG 124


>UniRef50_Q67Q20 Cluster: Putative peptidase; n=2; Bacilli|Rep:
           Putative peptidase - Symbiobacterium thermophilum
          Length = 457

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 29/75 (38%), Positives = 39/75 (52%)
 Frame = +3

Query: 285 ELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWETEPFELVE 464
           ELR +G   ++  +            ++P   T  IYGH DVQP    + W T PFE   
Sbjct: 48  ELRRIGLNRVEVMETGGHPVVYAERLDNPGGPTALIYGHYDVQPVDPIELWTTPPFEPDI 107

Query: 465 RNEKLYGRGSTDDKG 509
           R+ KLY RG++DDKG
Sbjct: 108 RDGKLYARGASDDKG 122


>UniRef50_A7H8T3 Cluster: Peptidase M20; n=3; Myxococcaceae|Rep:
           Peptidase M20 - Anaeromyxobacter sp. Fw109-5
          Length = 467

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 288 LRDVGFQTIDGKDVQXXXXXXXXXX-NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVE 464
           LR  GF+ ++   V+            DP   T+ +Y H DVQP  +++ W++ PFE VE
Sbjct: 54  LRRRGFEKVEVLKVEGAHPYVFGERIEDPSAPTLLLYAHHDVQPPGETELWKSAPFEPVE 113

Query: 465 RNEKLYGRGSTDDKGLYLV 521
           R+ +L+GRG+ DDK   LV
Sbjct: 114 RDGRLFGRGAADDKAGILV 132


>UniRef50_Q6A6C5 Cluster: Zinc metallopeptidase; n=3;
           Actinomycetales|Rep: Zinc metallopeptidase -
           Propionibacterium acnes
          Length = 447

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 24/43 (55%), Positives = 28/43 (65%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           TV +Y H DVQP    D W TEPF    + E+LYGRG+ DDKG
Sbjct: 85  TVLLYSHGDVQPTGNLDEWHTEPFVATAKGERLYGRGTADDKG 127


>UniRef50_Q1WS58 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=1; Lactobacillus salivarius subsp. salivarius
           UCC118|Rep: Succinyl-diaminopimelate desuccinylase -
           Lactobacillus salivarius subsp. salivarius (strain
           UCC118)
          Length = 378

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 24/37 (64%), Positives = 31/37 (83%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           GHLDV  A +SDGW ++PF+LVER+ KLYGRG++D K
Sbjct: 68  GHLDVVAAKESDGWHSDPFKLVERDGKLYGRGTSDMK 104


>UniRef50_A5UT66 Cluster: Peptidase dimerisation domain protein;
           n=9; Bacteria|Rep: Peptidase dimerisation domain protein
           - Roseiflexus sp. RS-1
          Length = 475

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 29/63 (46%), Positives = 39/63 (61%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIR 548
           P K TV IYGH D QPA   + W+  PFE V R+ ++Y RG++DDKG  L    P + + 
Sbjct: 75  PGKPTVLIYGHFDTQPADPLELWDHPPFEPVVRDGRVYARGASDDKGNMLP---PILAVE 131

Query: 549 ALV 557
           AL+
Sbjct: 132 ALL 134


>UniRef50_A5US80 Cluster: Peptidase M20; n=3; Chloroflexaceae|Rep:
           Peptidase M20 - Roseiflexus sp. RS-1
          Length = 474

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 24/43 (55%), Positives = 29/43 (67%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+ IYGH DVQPA  +D W T PF    RN  +Y RG++DDKG
Sbjct: 90  TLLIYGHYDVQPADPTDAWYTPPFVPTVRNNAMYARGASDDKG 132



 Score = 32.7 bits (71), Expect = 9.8
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +1

Query: 103 ATEKTLPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMVHWM 252
           A  +TL  +  ++   + S  + L E ++IPSVS D  + AD      W+
Sbjct: 5   AASETLHTVISHLRTQQQSLLEALHEILSIPSVSMDPAHTADMTTAAQWL 54


>UniRef50_A0JX29 Cluster: Peptidase M20; n=3; Actinomycetales|Rep:
           Peptidase M20 - Arthrobacter sp. (strain FB24)
          Length = 476

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 25/44 (56%), Positives = 30/44 (68%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           K T+ +Y H DVQP      WETEPF  VER+ +LYGRG+ DDK
Sbjct: 104 KPTILLYAHHDVQPTGDLALWETEPFTAVERDGRLYGRGAADDK 147


>UniRef50_Q2S1D7 Cluster: Peptidase, M20/M25/M40 family; n=1;
           Salinibacter ruber DSM 13855|Rep: Peptidase, M20/M25/M40
           family - Salinibacter ruber (strain DSM 13855)
          Length = 456

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 23/47 (48%), Positives = 30/47 (63%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           P K TV +YGH DVQP    + W T+PF+ +  +  LY RG+ DDKG
Sbjct: 76  PDKPTVVVYGHYDVQPPDPLEEWSTDPFDPIRHDGALYARGACDDKG 122



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +2

Query: 539 AYKGTGAELPVNLKFIFECMEESGSEGLTAY 631
           AY     +LPVNLK+I E  EE+GS  +  Y
Sbjct: 133 AYLSAEGDLPVNLKYIIEGEEETGSMAIETY 163


>UniRef50_A0L7W4 Cluster: Peptidase M20; n=1; Magnetococcus sp.
           MC-1|Rep: Peptidase M20 - Magnetococcus sp. (strain
           MC-1)
          Length = 465

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 23/48 (47%), Positives = 32/48 (66%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +P+  T+ IYGH DVQP +  + W T PF    R ++L+ RG+TDDKG
Sbjct: 80  NPQAPTLLIYGHYDVQPEIPVERWTTPPFTPHVRQDRLFARGATDDKG 127


>UniRef50_Q0RKS1 Cluster: Putative cytosolic nonspecific
           dipeptidase; n=1; Frankia alni ACN14a|Rep: Putative
           cytosolic nonspecific dipeptidase - Frankia alni (strain
           ACN14a)
          Length = 458

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 26/43 (60%), Positives = 30/43 (69%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           TV IY HLDVQPA  +  W+TEPF L    ++  GRGSTDDKG
Sbjct: 83  TVTIYNHLDVQPADPAQ-WDTEPFRLTISGDRYAGRGSTDDKG 124


>UniRef50_Q7S5Y4 Cluster: Putative uncharacterized protein
           NCU05622.1; n=4; Sordariomycetes|Rep: Putative
           uncharacterized protein NCU05622.1 - Neurospora crassa
          Length = 1065

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPA-LKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K+  V  YGH DV PA +  + W+T+PF+LV +N  LYGRG +D+KG
Sbjct: 657 KRKRVLFYGHYDVVPADMAGENWKTDPFKLVGQNGYLYGRGVSDNKG 703



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 643 LKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LK +     +DYV ++++YWL    PC+T GLR
Sbjct: 745 LKHKDLIGHIDYVLLANSYWLDDEVPCLTYGLR 777


>UniRef50_Q74KT4 Cluster: Xaa-His dipeptidase; n=5;
           Lactobacillaceae|Rep: Xaa-His dipeptidase -
           Lactobacillus johnsonii
          Length = 465

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/71 (38%), Positives = 38/71 (53%)
 Frame = +3

Query: 297 VGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEK 476
           + F   DG D +                 V I GH+DV PA   +GW+T+PF++  ++ K
Sbjct: 54  LSFAKRDGFDTENFDNYAGRINMGSGDKRVGIIGHMDVVPA--GEGWKTDPFKMTIKDGK 111

Query: 477 LYGRGSTDDKG 509
           +YGRGS DDKG
Sbjct: 112 IYGRGSADDKG 122


>UniRef50_A4XGQ7 Cluster: Dipeptidase, putative; n=1;
           Caldicellulosiruptor saccharolyticus DSM 8903|Rep:
           Dipeptidase, putative - Caldicellulosiruptor
           saccharolyticus (strain ATCC 43494 / DSM 8903)
          Length = 464

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 23/42 (54%), Positives = 30/42 (71%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           VC+ GHLDV P  + DGW   P+E V ++ K+YGRG+ DDKG
Sbjct: 83  VCVIGHLDVVP--EGDGWSVPPYEGVIKDGKIYGRGAIDDKG 122


>UniRef50_UPI00015B4A2D Cluster: PREDICTED: similar to glutamate
           carboxypeptidase; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to glutamate carboxypeptidase -
           Nasonia vitripennis
          Length = 494

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 26/49 (53%), Positives = 31/49 (63%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           ND KK T+  Y HLDV    K   W T+PFEL E++ KLYGRG+   KG
Sbjct: 86  NDTKKKTLLYYCHLDVLKVQKGQ-WITDPFELTEKDGKLYGRGTAKMKG 133



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 18/38 (47%), Positives = 25/38 (65%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           P+L ++H I  ++  G ELPVN+K I E M E  S+GL
Sbjct: 134 PLLCFIHAIECHRELGIELPVNIKIICESMYECKSKGL 171



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 13/37 (35%), Positives = 24/37 (64%)
 Frame = +1

Query: 631 LMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           +++ LK   F  ++D V +++++WLG   PCI  G+R
Sbjct: 174 ILEDLKAT-FLPNIDCVLLTESHWLGKDYPCIVYGMR 209


>UniRef50_Q7MWN9 Cluster: Peptidase, M20/M25/M40 family; n=29;
           Bacteria|Rep: Peptidase, M20/M25/M40 family -
           Porphyromonas gingivalis (Bacteroides gingivalis)
          Length = 451

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 22/48 (45%), Positives = 31/48 (64%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           DPK  T+ +Y H DV P    + W++EPFE V R+  ++ RG+ DDKG
Sbjct: 74  DPKAKTILVYAHYDVMPPEPLELWKSEPFEPVIRDGHIWARGADDDKG 121


>UniRef50_A0NKT4 Cluster: Peptidase B, M20/M25/M40 family; n=3;
           Leuconostocaceae|Rep: Peptidase B, M20/M25/M40 family -
           Oenococcus oeni ATCC BAA-1163
          Length = 453

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 23/43 (53%), Positives = 29/43 (67%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+ IY H DVQPA   D W ++P+ L ER+ K +GRG  DDKG
Sbjct: 79  TLLIYNHYDVQPAEPFDLWHSDPWILTERDNKFFGRGIDDDKG 121


>UniRef50_A6LNR1 Cluster: Dipeptidase, putative; n=2;
           Thermotogaceae|Rep: Dipeptidase, putative - Thermosipho
           melanesiensis BI429
          Length = 465

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/40 (57%), Positives = 28/40 (70%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           I GHLDV P    D WE++P+EL  R  K+YGRG +DDKG
Sbjct: 87  ILGHLDVVPEGDLDRWESDPYELTIREGKMYGRGVSDDKG 126


>UniRef50_A7DSL7 Cluster: Peptidase M20; n=1; Candidatus
           Nitrosopumilus maritimus SCM1|Rep: Peptidase M20 -
           Candidatus Nitrosopumilus maritimus SCM1
          Length = 450

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/48 (47%), Positives = 31/48 (64%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +P K T+  Y H DVQPA   D W++ PF    +  K++GRG+TDDKG
Sbjct: 74  NPNK-TLMFYNHYDVQPAEPFDLWDSPPFSGTRKGNKIFGRGATDDKG 120


>UniRef50_Q7UJ49 Cluster: ArgE/DapE/Acy1 family protein; n=3;
           Planctomycetaceae|Rep: ArgE/DapE/Acy1 family protein -
           Rhodopirellula baltica
          Length = 468

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYL 518
           P      +YGH DVQP    D W + PFE V R+ K++ RG+TDDKG  L
Sbjct: 89  PGAPVALVYGHYDVQPPEPLDLWTSPPFEPVVRDGKVFARGATDDKGQVL 138


>UniRef50_Q89J35 Cluster: Blr5449 protein; n=1; Bradyrhizobium
           japonicum|Rep: Blr5449 protein - Bradyrhizobium
           japonicum
          Length = 409

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/49 (51%), Positives = 32/49 (65%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMP 542
           GH DV P    D W  +PF+LVER+ +LYGRG+TD KG   V C+  +P
Sbjct: 93  GHTDVVPVAGQD-WSHDPFKLVERDGRLYGRGTTDMKGFVAV-CLAMVP 139


>UniRef50_Q822A3 Cluster: Peptidase M20/M25/M40 superfamily; n=4;
           Chlamydophila|Rep: Peptidase M20/M25/M40 superfamily -
           Chlamydophila caviae
          Length = 454

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/47 (44%), Positives = 30/47 (63%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           P   T+ +Y H DVQPA  +DGW  +PF +    E+L  RG++D+KG
Sbjct: 76  PAAPTLLLYNHYDVQPADLADGWLADPFTMRREGERLIARGASDNKG 122


>UniRef50_A1UJA4 Cluster: Peptidase M20; n=23; Actinobacteria
           (class)|Rep: Peptidase M20 - Mycobacterium sp. (strain
           KMS)
          Length = 453

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/46 (50%), Positives = 28/46 (60%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           P   TV +Y H DVQP      W + PFE  ER+ +LYGRG+ DDK
Sbjct: 86  PGAPTVLLYAHHDVQPEGDPGQWSSPPFEPTERDGRLYGRGTADDK 131


>UniRef50_A0LVT5 Cluster: Peptidase M20; n=4; Actinomycetales|Rep:
           Peptidase M20 - Acidothermus cellulolyticus (strain ATCC
           43068 / 11B)
          Length = 469

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYL 518
           DP   TV +YGH DVQP    + W   PFE    ++++ GRG++DDKG  L
Sbjct: 79  DPGAPTVVVYGHHDVQPVDPVEAWTFAPFEPAIVDDRILGRGASDDKGQVL 129


>UniRef50_A0RU83 Cluster: Acetylornithine
           deacetylase/succinyl-diaminopimelate desuccinylase; n=1;
           Cenarchaeum symbiosum|Rep: Acetylornithine
           deacetylase/succinyl-diaminopimelate desuccinylase -
           Cenarchaeum symbiosum
          Length = 369

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/43 (51%), Positives = 27/43 (62%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+  Y H DVQPA   D W+  PF    R  K++GRG+TDDKG
Sbjct: 77  TLLFYNHYDVQPAEPLDPWDHPPFGGTVRGNKIFGRGATDDKG 119


>UniRef50_Q6GF48 Cluster: Probable succinyl-diaminopimelate
           desuccinylase; n=15; Staphylococcus|Rep: Probable
           succinyl-diaminopimelate desuccinylase - Staphylococcus
           aureus (strain MRSA252)
          Length = 407

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/42 (50%), Positives = 29/42 (69%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           + + GH+DV  A   D W   PF+L E+++KLYGRG+TD KG
Sbjct: 67  LALSGHMDVVDAGNQDNWTYPPFQLTEKDDKLYGRGTTDMKG 108


>UniRef50_Q8G5E2 Cluster: Widely conserved protein in peptidase or
           deacetlylase family; n=4; Bifidobacterium|Rep: Widely
           conserved protein in peptidase or deacetlylase family -
           Bifidobacterium longum
          Length = 455

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 32/86 (37%), Positives = 40/86 (46%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSD 431
           AD+L+ VG  T++  V     DG                P   TV +Y H DVQP     
Sbjct: 51  ADELRLVGVDTKV--VQASNADG--TPGAWEVIGSHIVSPDAPTVLLYAHHDVQPVPDPA 106

Query: 432 GWETEPFELVERNEKLYGRGSTDDKG 509
            W T+PF   E + +LYGRGS DD G
Sbjct: 107 EWNTDPFVATEIDGRLYGRGSADDGG 132


>UniRef50_Q836F6 Cluster: Peptidase, M20/M25/M40 family; n=3;
           Lactobacillales|Rep: Peptidase, M20/M25/M40 family -
           Enterococcus faecalis (Streptococcus faecalis)
          Length = 432

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 23/52 (44%), Positives = 34/52 (65%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPI 545
           I GHLDV P  +  GW   PF+L ++N++LYGRG  D+KG  ++ C+  M +
Sbjct: 80  IIGHLDVVP--EGSGWSVPPFQLTKKNQRLYGRGILDNKG-PILACLYGMKL 128


>UniRef50_A7CQP7 Cluster: Peptidase M20; n=1; Opitutaceae bacterium
           TAV2|Rep: Peptidase M20 - Opitutaceae bacterium TAV2
          Length = 506

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query: 363 NDPKKNT-VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           N P+ +  V IYGH DVQPA   + W T PF+ V R+ +++GRG+ D+KG
Sbjct: 108 NAPENSPHVIIYGHYDVQPADPLNLWTTPPFDPVVRDGRIWGRGTADNKG 157


>UniRef50_Q6C2N8 Cluster: Similar to sp|P38149 Saccharomyces
           cerevisiae YBR281c; n=1; Yarrowia lipolytica|Rep:
           Similar to sp|P38149 Saccharomyces cerevisiae YBR281c -
           Yarrowia lipolytica (Candida lipolytica)
          Length = 867

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 21/46 (45%), Positives = 30/46 (65%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K   +  YGH DV PA ++DGW+T P+ +   +  LYGRG +D+KG
Sbjct: 502 KPKRLLFYGHYDVIPAHETDGWDTYPYTITPLDGYLYGRGVSDNKG 547



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +1

Query: 646 KPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           K +     +DY+ + ++YWL  T PCI  GLR
Sbjct: 590 KNDSMIGDIDYILLCNSYWLDDTTPCINYGLR 621


>UniRef50_Q0W1H4 Cluster: Predicted peptidase; n=2; cellular
           organisms|Rep: Predicted peptidase - Uncultured
           methanogenic archaeon RC-I
          Length = 479

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 22/43 (51%), Positives = 28/43 (65%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+ IYGH DVQP      W + PF    R+E +YGRG++DDKG
Sbjct: 81  TLLIYGHYDVQPEGDVKDWHSPPFSPEIRDETIYGRGASDDKG 123



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +1

Query: 118 LPE-IFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMVHWM 252
           LPE + +++D N + Y   L + +AIPS S    +  D  R   W+
Sbjct: 2   LPEQVLRHIDDNMERYTDELMQLIAIPSDSMTASHAGDVRRAAEWL 47


>UniRef50_A5WGM6 Cluster: Acetylornithine deacetylase; n=3;
           Psychrobacter|Rep: Acetylornithine deacetylase -
           Psychrobacter sp. PRwf-1
          Length = 404

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/60 (43%), Positives = 37/60 (61%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRALVLS 563
           + + GH DV P    D WE++PFE V R +KLYGRG+ D KG   + C  ++  +A+ LS
Sbjct: 82  IVLSGHTDVVPVDGQD-WESDPFEAVIRGDKLYGRGACDMKG--FIACALNLLPKAVALS 138


>UniRef50_Q55RC2 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 1004

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG-LYLVGC 527
           P+K  +  YGH DVQPA +   W T P+EL  R+  LYGRG TD+KG +  V C
Sbjct: 641 PRKR-ILFYGHYDVQPAAEKR-WITNPWELSGRDGYLYGRGVTDNKGPIMAVAC 692


>UniRef50_Q64B38 Cluster: Possible succinyl-diaminopimelate
           desuccinylase; n=4; environmental samples|Rep: Possible
           succinyl-diaminopimelate desuccinylase - uncultured
           archaeon GZfos27G5
          Length = 434

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 24/45 (53%), Positives = 30/45 (66%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K +V IY HLDV PA   +GW T PFE V ++ ++YGRG  D KG
Sbjct: 108 KESVDIYTHLDVVPA--GEGWSTPPFEPVIKDGRIYGRGVADSKG 150


>UniRef50_Q83NH1 Cluster: Putative peptidase; n=2; Tropheryma
           whipplei|Rep: Putative peptidase - Tropheryma whipplei
           (strain TW08/27) (Whipple's bacillus)
          Length = 446

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 24/46 (52%), Positives = 28/46 (60%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           P   TV +Y H DVQPA   D W T  F   ER+ +LYGRG+ DDK
Sbjct: 75  PGYPTVLLYAHHDVQPAGDPDKWVTPAFSPDERDGRLYGRGAADDK 120


>UniRef50_Q4JXN9 Cluster: Putative peptidase; n=1; Corynebacterium
           jeikeium K411|Rep: Putative peptidase - Corynebacterium
           jeikeium (strain K411)
          Length = 467

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 20/43 (46%), Positives = 28/43 (65%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+ +Y H DVQPA   + W  +P+ L ER+ + YGRG+ D KG
Sbjct: 92  TILLYSHFDVQPAGDIEAWTNDPWTLTERDGRWYGRGTADCKG 134


>UniRef50_O34984 Cluster: Acetylornitine deacetylase; n=5;
           Bacillus|Rep: Acetylornitine deacetylase - Bacillus
           subtilis
          Length = 436

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 21/43 (48%), Positives = 29/43 (67%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           ++ + GH+DV P      W+ EP++ VE N K+YGRGSTD KG
Sbjct: 97  SLILNGHIDVVPEGSVKDWKYEPYQAVEENGKIYGRGSTDMKG 139


>UniRef50_Q1AYU9 Cluster: Peptidase M20; n=1; Rubrobacter
           xylanophilus DSM 9941|Rep: Peptidase M20 - Rubrobacter
           xylanophilus (strain DSM 9941 / NBRC 16129)
          Length = 459

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 21/39 (53%), Positives = 26/39 (66%)
 Frame = +3

Query: 393 YGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           YGH DVQP    + WE++PFE   R ++LY RG  DDKG
Sbjct: 89  YGHYDVQPPEPLELWESDPFEPAIRGDRLYARGVADDKG 127


>UniRef50_Q0LPB5 Cluster: Peptidase M20; n=1; Herpetosiphon
           aurantiacus ATCC 23779|Rep: Peptidase M20 -
           Herpetosiphon aurantiacus ATCC 23779
          Length = 457

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/42 (52%), Positives = 27/42 (64%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           T+ +Y H DVQP    + W+  PFE V R+ KLY RGS DDK
Sbjct: 83  TILVYAHYDVQPVEPLELWKNPPFEPVLRDGKLYARGSIDDK 124


>UniRef50_Q8CUJ6 Cluster: Hypothetical conserved protein; n=1;
           Oceanobacillus iheyensis|Rep: Hypothetical conserved
           protein - Oceanobacillus iheyensis
          Length = 453

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 20/43 (46%), Positives = 31/43 (72%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           TV +YGH DVQP    + W+++PF+   R+ +++ RGS+DDKG
Sbjct: 82  TVLLYGHYDVQPVDPIELWDSDPFKPELRDGRIFARGSSDDKG 124


>UniRef50_Q4Q673 Cluster: Peptidase m20/m25/m40 family-like protein;
           n=15; Trypanosomatidae|Rep: Peptidase m20/m25/m40
           family-like protein - Leishmania major
          Length = 576

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 22/46 (47%), Positives = 29/46 (63%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDD 503
           +P  NTV +YGH+D QP L+      +P + V R+ KLYGRG  DD
Sbjct: 193 EPTNNTVLMYGHMDKQPPLRPWAEGLDPHKAVVRDGKLYGRGGADD 238


>UniRef50_A7T8U3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 143

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 21/27 (77%), Positives = 23/27 (85%)
 Frame = +3

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKG 509
           DGW+TEPF L E + KLYGRGSTDDKG
Sbjct: 2   DGWDTEPFTLQEIDGKLYGRGSTDDKG 28



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 14/24 (58%), Positives = 18/24 (75%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLK 580
           PVL WLH I AYK  G +LP+N++
Sbjct: 29  PVLCWLHVIEAYKAIGEDLPINIR 52


>UniRef50_Q6F127 Cluster: Arginine catabolism aminotransferase; n=5;
           Mollicutes|Rep: Arginine catabolism aminotransferase -
           Mesoplasma florum (Acholeplasma florum)
          Length = 450

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/45 (53%), Positives = 27/45 (60%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K    I  HLDV PA     W T PFE +E++ KL GRGS DDKG
Sbjct: 78  KELYVILCHLDVVPAGDMSEWVTNPFEPIEKDGKLIGRGSIDDKG 122


>UniRef50_Q5WDJ9 Cluster: Deacylase; n=1; Bacillus clausii
           KSM-K16|Rep: Deacylase - Bacillus clausii (strain
           KSM-K16)
          Length = 432

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 22/48 (45%), Positives = 29/48 (60%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           D    T+ IYGH DVQP      WET PFE   R+ +++ RG+ D+KG
Sbjct: 56  DKHAPTLLIYGHYDVQPPDPLSEWETPPFEPTVRDGRIFARGAGDNKG 103


>UniRef50_Q0SAA1 Cluster: Possible peptidase M20/M25/M40 family,
           acetylornithine deacetylase/succinyl-diaminopimelate
           desuccinylase and related deacylases; n=6; Bacteria|Rep:
           Possible peptidase M20/M25/M40 family, acetylornithine
           deacetylase/succinyl-diaminopimelate desuccinylase and
           related deacylases - Rhodococcus sp. (strain RHA1)
          Length = 451

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 22/43 (51%), Positives = 27/43 (62%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           TV +Y H DVQP      W T+PF L ER+ + YGRG+ D KG
Sbjct: 83  TVLLYCHYDVQPPGDEKLWHTDPFTLTERDGRWYGRGAADCKG 125


>UniRef50_Q54X02 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 473

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 2/46 (4%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDGWET--EPFELVERNEKLYGRGSTDD 503
           K  TV +YGH+D QP L +D W+    P++ V +N KLYGRG  DD
Sbjct: 91  KVKTVLLYGHMDKQPPL-TDAWDEGLHPYKAVIKNNKLYGRGGADD 135


>UniRef50_O07121 Cluster: Dipeptidase; n=53; Lactobacillales|Rep:
           Dipeptidase - Lactococcus lactis
          Length = 472

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/40 (57%), Positives = 27/40 (67%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           I GHLDV PA    GW++ PFE   RN  LY RG++DDKG
Sbjct: 89  IIGHLDVVPA--GSGWDSNPFEPEIRNGNLYARGASDDKG 126


>UniRef50_Q6L031 Cluster: N-acyl-L-amino acid amidohydrolase; n=2;
           Archaea|Rep: N-acyl-L-amino acid amidohydrolase -
           Picrophilus torridus
          Length = 438

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCI 530
           D +   + IY H DVQPA   D W+T+PF      ++LY RG +D+KG  +   I
Sbjct: 65  DSRSRRIIIYNHYDVQPADPLDEWKTDPFNPRMIGKRLYARGVSDNKGTLIARLI 119


>UniRef50_Q9ZC93 Cluster: SUCCINYL-DIAMINOPIMELATE DESUCCINYLASE;
           n=11; Rickettsieae|Rep: SUCCINYL-DIAMINOPIMELATE
           DESUCCINYLASE - Rickettsia prowazekii
          Length = 383

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 DKLKEVGATTELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDG 434
           D LK+    TE++  G    D K  Q          N+P    +C  GH+DV PA   + 
Sbjct: 28  DLLKQHSFKTEIKIFG----DSKKEQVTNLYAIFGGNEPN---ICFVGHVDVVPAGNYEF 80

Query: 435 WE-TEPFELVERNEKLYGRGSTDDKG 509
           W  + PF+  E++ K+YGRG+ D KG
Sbjct: 81  WHNSNPFKFHEQDGKIYGRGTVDMKG 106


>UniRef50_Q4FL07 Cluster: Acetylornithine deacetylase; n=3;
           Bacteria|Rep: Acetylornithine deacetylase - Pelagibacter
           ubique
          Length = 396

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 28/89 (31%), Positives = 42/89 (47%)
 Frame = +3

Query: 285 ELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWETEPFELVE 464
           +L    F+T D +  +              K  + + GH DV P  K  GW T+PF    
Sbjct: 45  KLGATSFKTFDDEKKRVNLFATLKAKKPSNKKPIILSGHTDVVPVSK--GWSTDPFVATI 102

Query: 465 RNEKLYGRGSTDDKGLYLVGCIPSMPIRA 551
           +++KL+GRGS D KG ++   +   PI A
Sbjct: 103 KDDKLFGRGSCDMKG-FIACTLAFAPIYA 130


>UniRef50_A5G0P2 Cluster: Peptidase dimerisation domain protein;
           n=3; Alphaproteobacteria|Rep: Peptidase dimerisation
           domain protein - Acidiphilium cryptum (strain JF-5)
          Length = 406

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           P+  T+ +YGH DVQP    + W++ PFE   R+ +++GRG  D+KG
Sbjct: 80  PEMPTILLYGHYDVQPPEPLELWKSPPFEPTIRDGRIWGRGLGDNKG 126


>UniRef50_Q4CYZ6 Cluster: Glutamamyl carboxypeptidase, putative;
           n=7; Trypanosoma cruzi|Rep: Glutamamyl carboxypeptidase,
           putative - Trypanosoma cruzi
          Length = 396

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/49 (44%), Positives = 31/49 (63%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLV 521
           K  + + GH DV P +    W+++PF L ER+ KLYGRG++D KG   V
Sbjct: 69  KGGIILSGHTDVVP-VDGQKWDSDPFTLTERDGKLYGRGTSDMKGFVAV 116


>UniRef50_A4R5H7 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 989

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/47 (46%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPA-LKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K+  +  YGH DV PA  K   W ++PF L   N  LYGRG +D+KG
Sbjct: 587 KRKRILFYGHYDVVPADAKKGNWTSDPFTLTGTNGYLYGRGVSDNKG 633



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 670 VDYVCISDNYWLGTTKPCITNGLR 741
           VDY+ ++++YWL    PC+T GLR
Sbjct: 684 VDYILLANSYWLDDETPCLTYGLR 707


>UniRef50_UPI0000DAE721 Cluster: hypothetical protein
           Rgryl_01001089; n=1; Rickettsiella grylli|Rep:
           hypothetical protein Rgryl_01001089 - Rickettsiella
           grylli
          Length = 390

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/47 (51%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = +3

Query: 372 KKNTVCIY-GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           KK+ + ++ GH DV PA   + WET PF    RN +LYGRGS D KG
Sbjct: 65  KKSPLLVFVGHTDVVPAGPLEKWETPPFMPTIRNGQLYGRGSADMKG 111


>UniRef50_UPI0000D573E7 Cluster: PREDICTED: similar to Cytosolic
           nonspecific dipeptidase (Glutamate carboxypeptidase-like
           protein 1) (CNDP dipeptidase 2); n=1; Tribolium
           castaneum|Rep: PREDICTED: similar to Cytosolic
           nonspecific dipeptidase (Glutamate carboxypeptidase-like
           protein 1) (CNDP dipeptidase 2) - Tribolium castaneum
          Length = 477

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/82 (28%), Positives = 42/82 (51%)
 Frame = +3

Query: 261 LKEVGATTELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWE 440
           L ++G   E  ++GF  + G+  +          ND +K T+CIY HLDV+   ++  W+
Sbjct: 87  LSKLGLKYERFNIGFHELGGEKHRLPVILLASLGNDQRKKTLCIYVHLDVKEP-EASKWQ 145

Query: 441 TEPFELVERNEKLYGRGSTDDK 506
           T+P+ + +    ++G G    K
Sbjct: 146 TDPWSVSQVGHSIFGCGVAQGK 167



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +2

Query: 512 VLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGLTAY 631
           ++ W H I A++ +  E PVNLKFI E M    S GL  +
Sbjct: 170 LIHWFHIIEAFQKSNIEFPVNLKFIIESMYHYDSVGLADF 209


>UniRef50_Q6MBN6 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Protochlamydia amoebophila UWE25|Rep:
           Putative uncharacterized protein - Protochlamydia
           amoebophila (strain UWE25)
          Length = 480

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/45 (46%), Positives = 30/45 (66%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K T+ IY H DVQPA   + W+T+PF+   R+  +Y RG+ D+KG
Sbjct: 88  KPTLLIYNHYDVQPADPLNEWKTDPFQPSLRDGSVYARGAQDNKG 132


>UniRef50_Q03SG4 Cluster: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase
           related deacylase; n=3; Lactobacillus|Rep:
           Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase related deacylase - Lactobacillus brevis
           (strain ATCC 367 / JCM 1170)
          Length = 451

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/43 (48%), Positives = 26/43 (60%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+  Y H DVQP    D W+T PF+L E + K   RG +DDKG
Sbjct: 82  TLLFYNHYDVQPPEPLDEWQTAPFDLTEVDGKYVARGVSDDKG 124


>UniRef50_Q4JBN8 Cluster: Peptidase; n=3; Sulfolobaceae|Rep:
           Peptidase - Sulfolobus acidocaldarius
          Length = 423

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/49 (42%), Positives = 29/49 (59%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           N   K T+ IY H DVQP    + W ++PF  V ++ K++ RG  DDKG
Sbjct: 57  NVGSKKTLLIYNHYDVQPVEPLEKWNSDPFNPVIKDGKIFARGVGDDKG 105


>UniRef50_A0B5Z5 Cluster: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase; n=1;
           Methanosaeta thermophila PT|Rep: Acetylornithine
           deacetylase or succinyl-diaminopimelate desuccinylase -
           Methanosaeta thermophila (strain DSM 6194 / PT)
           (Methanothrixthermophila (strain DSM 6194 / PT))
          Length = 442

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/40 (55%), Positives = 26/40 (65%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           IY HLDV P    DGW T+PF L  R+ + YGRG +D KG
Sbjct: 126 IYTHLDVVPP--GDGWSTDPFSLTIRDGRAYGRGVSDSKG 163


>UniRef50_Q3J7Y6 Cluster: Acetylornithine deacetylase; n=1;
           Nitrosococcus oceani ATCC 19707|Rep: Acetylornithine
           deacetylase - Nitrosococcus oceani (strain ATCC 19707 /
           NCIMB 11848)
          Length = 379

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/74 (35%), Positives = 36/74 (48%)
 Frame = +3

Query: 288 LRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWETEPFELVER 467
           L   GFQT    + Q             KK  + + GH DV P +    W  +PF L+++
Sbjct: 37  LNSRGFQTQRFYNKQRNKANLMARIGPDKKGGLMLAGHTDVVP-VDQQAWTNDPFRLIKK 95

Query: 468 NEKLYGRGSTDDKG 509
           N  LYGRG++D KG
Sbjct: 96  NGCLYGRGTSDMKG 109


>UniRef50_A3WFG4 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=4; Alphaproteobacteria|Rep: Succinyl-diaminopimelate
           desuccinylase - Erythrobacter sp. NAP1
          Length = 385

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/58 (44%), Positives = 33/58 (56%), Gaps = 2/58 (3%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG--LYLVGCIPSMPIRALVLS 563
           GHLDV P    DGW ++PFE  ER E LYGRG+ D K     +V  +  +P  A  +S
Sbjct: 76  GHLDVVPP--GDGWASDPFEPTERGELLYGRGAVDMKSSIACMVAAVADVPKDAGTIS 131


>UniRef50_Q4D7V2 Cluster: Acetylornithine deacetylase-like,
           putative; n=1; Trypanosoma cruzi|Rep: Acetylornithine
           deacetylase-like, putative - Trypanosoma cruzi
          Length = 395

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMP 542
           + + GH DV P +    W+++PF L ER+ KLYGRG+ D KG ++  C+   P
Sbjct: 71  IILSGHTDVVP-VDGQKWDSDPFTLTERDGKLYGRGTCDMKG-FIAVCMSMTP 121


>UniRef50_UPI000050F9BC Cluster: COG0624: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase and
           related deacylases; n=1; Brevibacterium linens BL2|Rep:
           COG0624: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase and
           related deacylases - Brevibacterium linens BL2
          Length = 519

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 31/85 (36%), Positives = 41/85 (48%), Gaps = 3/85 (3%)
 Frame = +3

Query: 285 ELRDVGFQTI--DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWE-TEPFE 455
           EL  +GF T   D  +             DP   TV +YGH DVQ A  S   E  +P+ 
Sbjct: 64  ELAALGFATTIHDNPESAEHPLLIAARIEDPDLPTVLLYGHGDVQFAHDSQWSEGLDPWV 123

Query: 456 LVERNEKLYGRGSTDDKGLYLVGCI 530
           L    ++LYGRGS D+KG + V  +
Sbjct: 124 LTRDGDRLYGRGSADNKGQHTVNSL 148


>UniRef50_A5WD56 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=126; Proteobacteria|Rep: Succinyl-diaminopimelate
           desuccinylase - Psychrobacter sp. PRwf-1
          Length = 402

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 26/84 (30%), Positives = 35/84 (41%)
 Frame = +3

Query: 255 DKLKEVGATTELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDG 434
           ++L  +G   E    G +   G+D Q           DP    VC  GH DV P    D 
Sbjct: 43  ERLSPLGFVHEFMYFGDEQASGRDAQVKNLWARRGNQDP---VVCFAGHTDVVPTGNPDN 99

Query: 435 WETEPFELVERNEKLYGRGSTDDK 506
           W   PF+    +  L+GRG+ D K
Sbjct: 100 WRIAPFDAKVHDGYLWGRGAADMK 123


>UniRef50_A5UWC2 Cluster: Peptidase M20; n=4; Chloroflexaceae|Rep:
           Peptidase M20 - Roseiflexus sp. RS-1
          Length = 448

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/43 (48%), Positives = 26/43 (60%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+ +Y H DVQP    D W + PFE   R+ KLY RG  D+KG
Sbjct: 75  TLLVYDHYDVQPPEPLDLWHSPPFEPTLRDGKLYARGVADNKG 117


>UniRef50_Q4S5S8 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 9 SCAF14729, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 405

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 19/39 (48%), Positives = 25/39 (64%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           +  H+DV PA +SDGW+  PF   E    +YGRG+ DDK
Sbjct: 139 LLAHIDVVPASQSDGWDAPPFSAEEIGGFIYGRGTIDDK 177


>UniRef50_Q92B89 Cluster: Lin1661 protein; n=32; Bacilli|Rep:
           Lin1661 protein - Listeria innocua
          Length = 470

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/47 (48%), Positives = 27/47 (57%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVG 524
           V + GH+DV P    DGW   PFE   R+ KLY RG  DDKG  + G
Sbjct: 83  VGVLGHVDVVPV--GDGWTNGPFEPTLRDGKLYARGVADDKGPTIAG 127


>UniRef50_Q88XA5 Cluster: Dipeptidase; n=4; Lactobacillus|Rep:
           Dipeptidase - Lactobacillus plantarum
          Length = 467

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/43 (46%), Positives = 29/43 (67%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+ I  H+D  PA   +GW+T+PFE   ++ K+Y RG +DDKG
Sbjct: 81  TLAILAHVDEMPA--GNGWDTDPFEPTIKDGKMYARGVSDDKG 121


>UniRef50_Q5KW20 Cluster: Xaa-His dipeptidase; n=3; Bacillaceae|Rep:
           Xaa-His dipeptidase - Geobacillus kaustophilus
          Length = 469

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/42 (50%), Positives = 27/42 (64%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           V + GH+DV P    DGW  +PF    R+ +LYGRG+ DDKG
Sbjct: 82  VGVLGHIDVVPP--GDGWTMDPFAAEVRDGRLYGRGAIDDKG 121


>UniRef50_Q033W2 Cluster: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase
           related deacylase; n=1; Lactobacillus casei ATCC
           334|Rep: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase
           related deacylase - Lactobacillus casei (strain ATCC
           334)
          Length = 447

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+  Y H DVQPA     W+++PF+L   +  LY RG  DDKG
Sbjct: 70  TILFYNHYDVQPAEPLALWQSDPFQLKMTDTHLYARGINDDKG 112


>UniRef50_A7BDH0 Cluster: Putative uncharacterized protein; n=1;
           Actinomyces odontolyticus ATCC 17982|Rep: Putative
           uncharacterized protein - Actinomyces odontolyticus ATCC
           17982
          Length = 445

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDD 503
           TV +Y H DVQP  +   W  +P++   R +++YGRGS+DD
Sbjct: 82  TVLLYAHHDVQPVGELSRWSMDPYKAEVRGDRIYGRGSSDD 122


>UniRef50_A2QKD8 Cluster: Putative frameshift; n=1; Aspergillus
           niger|Rep: Putative frameshift - Aspergillus niger
          Length = 437

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/35 (57%), Positives = 25/35 (71%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGS 613
           PVL WL  + AY+    ++PVNL+F FE MEESGS
Sbjct: 92  PVLAWLSALEAYQKAEVDVPVNLRFCFEGMEESGS 126



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/27 (66%), Positives = 19/27 (70%)
 Frame = +1

Query: 661 FDSVDYVCISDNYWLGTTKPCITNGLR 741
           F  V   CISDNYWL T KPC+T GLR
Sbjct: 140 FTKVGAACISDNYWLTTRKPCLTYGLR 166


>UniRef50_P45494 Cluster: Beta-Ala-Xaa dipeptidase; n=6;
           Lactobacillus|Rep: Beta-Ala-Xaa dipeptidase -
           Lactobacillus delbrueckii subsp. lactis
          Length = 470

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/41 (48%), Positives = 29/41 (70%), Gaps = 1/41 (2%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFEL-VERNEKLYGRGSTDDKG 509
           I GH+DV PA   +GW  +PF++ ++   ++YGRGS DDKG
Sbjct: 84  IIGHMDVVPA--GEGWTRDPFKMEIDEEGRIYGRGSADDKG 122


>UniRef50_Q5WY21 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=11; Proteobacteria|Rep: Succinyl-diaminopimelate
           desuccinylase - Legionella pneumophila (strain Lens)
          Length = 377

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 20/38 (52%), Positives = 24/38 (63%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           GH DV P  +   W+T+PF L E+N  LYGRG  D KG
Sbjct: 65  GHTDVVPVGEVSKWDTDPFSLEEKNGMLYGRGVADMKG 102


>UniRef50_A6VSF3 Cluster: Acetylornithine deacetylase; n=32;
           Proteobacteria|Rep: Acetylornithine deacetylase -
           Marinomonas sp. MWYL1
          Length = 390

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSM 539
           V + GH DV P +    W  +PFEL E++ K YGRGS D KG YL  C+ +M
Sbjct: 73  VMLSGHTDVVP-VDGQKWTCQPFELTEQDGKYYGRGSADMKG-YL-ACVLAM 121


>UniRef50_Q97T10 Cluster: Peptidase, M20/M25/M40 family; n=30;
           Streptococcus|Rep: Peptidase, M20/M25/M40 family -
           Streptococcus pneumoniae
          Length = 457

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/47 (44%), Positives = 24/47 (51%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           P   T+  Y H D  PA     W  +PF L  RN  +YGRG  DDKG
Sbjct: 80  PDAKTLIFYNHYDTVPADGDQVWTEDPFTLSVRNGFMYGRGVDDDKG 126


>UniRef50_Q47ZZ9 Cluster: Putative peptidase, M20/M25/M40 family;
           n=1; Colwellia psychrerythraea 34H|Rep: Putative
           peptidase, M20/M25/M40 family - Colwellia
           psychrerythraea (strain 34H / ATCC BAA-681)
           (Vibriopsychroerythus)
          Length = 267

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +3

Query: 378 NTVCIYGHLDVQPALKSDGW-ETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           N + IYGH DV P  + + W   E F L   N +LYGRG  D+KG  +   I    +++L
Sbjct: 53  NKIVIYGHYDVAPVKELNSWVSEEAFTLENINGRLYGRGIADNKGPLMARMI---ALKSL 109

Query: 555 VLS 563
           +LS
Sbjct: 110 ILS 112


>UniRef50_Q6SFC6 Cluster: Peptidase, M20/M25/M40 family; n=3;
           Bacteria|Rep: Peptidase, M20/M25/M40 family - uncultured
           bacterium 581
          Length = 494

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 2/70 (2%)
 Frame = +3

Query: 303 FQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPAL--KSDGWETEPFELVERNEK 476
           F+ +D + +           +DP +N V    H DV P      +GW+  PF  V  N  
Sbjct: 94  FEQLDVEYINTYSILLRWAGSDPSQNPVLFTAHTDVVPIEIGTENGWQHPPFAGVIENNN 153

Query: 477 LYGRGSTDDK 506
           LYGRG+ DDK
Sbjct: 154 LYGRGTLDDK 163


>UniRef50_Q18CN3 Cluster: Putative peptidase; n=2; Clostridium
           difficile|Rep: Putative peptidase - Clostridium
           difficile (strain 630)
          Length = 350

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 19/42 (45%), Positives = 29/42 (69%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           VC+ GH+DV    + DGW+ +P++  E N ++YGRG  D+KG
Sbjct: 79  VCVIGHVDV--VHEGDGWKHQPYKGEETNGRIYGRGVLDNKG 118


>UniRef50_A0DN51 Cluster: Chromosome undetermined scaffold_57, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_57,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 430

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 25/64 (39%), Positives = 32/64 (50%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMP 542
           N  +  T+  YGH D QP     GW+  P   +  N +LYGRGS DD      GC+P   
Sbjct: 81  NQEQNKTILCYGHYDKQPHFV--GWKYGPTTPIIENNRLYGRGSADD------GCVPYAI 132

Query: 543 IRAL 554
           I A+
Sbjct: 133 IAAI 136


>UniRef50_Q08BB2 Cluster: Zgc:154035; n=6; Clupeocephala|Rep:
           Zgc:154035 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 522

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 18/39 (46%), Positives = 26/39 (66%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           +  H+DV PA ++DGW+  PF   E N  +YGRG+ D+K
Sbjct: 139 LLAHIDVVPANEADGWDAPPFSAQEINGFIYGRGTIDNK 177


>UniRef50_Q6LNK8 Cluster: Hypothetical peptidase, M20/M25/M40
           family; n=4; Bacteria|Rep: Hypothetical peptidase,
           M20/M25/M40 family - Photobacterium profundum
           (Photobacterium sp. (strain SS9))
          Length = 455

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/40 (50%), Positives = 26/40 (65%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           + GHLDV P      W++ PFE   R+ +LYGRG+ DDKG
Sbjct: 87  VLGHLDVVPVGDLSTWDSLPFEPEIRDGRLYGRGTQDDKG 126


>UniRef50_Q8NM54 Cluster: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase and
           related deacylases; n=4; Corynebacterium|Rep:
           Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase and related deacylases - Corynebacterium
           glutamicum (Brevibacterium flavum)
          Length = 457

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/46 (47%), Positives = 28/46 (60%), Gaps = 4/46 (8%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERN----EKLYGRGSTDDKG 509
           V +Y H DV P+   D W+T PFEL ER+     + YGRG+ D KG
Sbjct: 87  VLLYSHFDVVPSGPLDLWDTNPFELTERDAGHGTRWYGRGAADCKG 132


>UniRef50_Q1VM22 Cluster: Acetylornithine deacetylase; n=1;
           Psychroflexus torquis ATCC 700755|Rep: Acetylornithine
           deacetylase - Psychroflexus torquis ATCC 700755
          Length = 252

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/56 (41%), Positives = 32/56 (57%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRA 551
           + + GH D  P  KS  W T+PF+   + +KLYGRGS D KG ++   +   PI A
Sbjct: 78  IILSGHTDTVPVSKS--WSTDPFKATIKGDKLYGRGSCDMKG-FIACTLAFAPIYA 130


>UniRef50_A5ZQN2 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 454

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/42 (47%), Positives = 26/42 (61%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           V I GHLD+ P      W  +PF+L    + +YGRG+TDDKG
Sbjct: 80  VGIAGHLDIVPV--GGDWTYDPFKLTREGDHVYGRGTTDDKG 119


>UniRef50_Q0W5T9 Cluster: Acetylornithine deacetylase; n=1;
           uncultured methanogenic archaeon RC-I|Rep:
           Acetylornithine deacetylase - Uncultured methanogenic
           archaeon RC-I
          Length = 375

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +3

Query: 399 HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           H DV P+L    W T PF+  ER  ++YGRG+TD KG
Sbjct: 71  HEDVIPSLDESKWTTHPFQPSEREGRIYGRGATDAKG 107


>UniRef50_Q9A3G5 Cluster: Peptidase, M20/M25/M40 family; n=3;
           Alphaproteobacteria|Rep: Peptidase, M20/M25/M40 family -
           Caulobacter crescentus (Caulobacter vibrioides)
          Length = 474

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           D     + +  H+DV  A + D W  +PF+LVE N   YGRG++DDK
Sbjct: 99  DATTKPMLLLAHIDVVEAKRED-WTRDPFKLVEENGYFYGRGTSDDK 144


>UniRef50_Q88VV9 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=2; Lactobacillaceae|Rep: Succinyl-diaminopimelate
           desuccinylase - Lactobacillus plantarum
          Length = 381

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/41 (46%), Positives = 28/41 (68%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           + + GH+DV  A     W+T+PF LVE++ +L+GRG TD K
Sbjct: 67  LAVSGHMDVVAAGDLAAWDTDPFTLVEKSGQLFGRGVTDMK 107


>UniRef50_Q1Q1P1 Cluster: Similar to succinyl-diaminopimelate
           desuccinylase; n=1; Candidatus Kuenenia
           stuttgartiensis|Rep: Similar to succinyl-diaminopimelate
           desuccinylase - Candidatus Kuenenia stuttgartiensis
          Length = 396

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/37 (51%), Positives = 28/37 (75%)
 Frame = +3

Query: 399 HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           HLDV PA   DGW+++PF    +N +++GRGS+D+KG
Sbjct: 89  HLDVVPA--GDGWQSDPFCAHVKNGRIFGRGSSDNKG 123


>UniRef50_Q0RYH1 Cluster: Acetylornithine deacetylase; n=1;
           Rhodococcus sp. RHA1|Rep: Acetylornithine deacetylase -
           Rhodococcus sp. (strain RHA1)
          Length = 424

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/43 (44%), Positives = 26/43 (60%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +V + GH+DV PA     W   PF  V R+ ++YGRG+ D KG
Sbjct: 98  SVVLNGHIDVVPAGDQAAWTDAPFSGVRRDGRIYGRGAVDTKG 140


>UniRef50_A2QVX8 Cluster: Similarity to carnosinase 2 polypeptide
           HC2 from patent EP1122307-A1 - Homo sapiens; n=8;
           Eurotiomycetidae|Rep: Similarity to carnosinase 2
           polypeptide HC2 from patent EP1122307-A1 - Homo sapiens
           - Aspergillus niger
          Length = 1041

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = +3

Query: 381 TVCIYGHLDVQPA-LKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+  YGH DV  A    D W T+P+ L   +  LYGRG TD+KG
Sbjct: 443 TILFYGHYDVVGADANRDKWNTDPYRLTSIDGFLYGRGVTDNKG 486



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 670 VDYVCISDNYWLGTTKPCITNGLR 741
           VD++ ++++YWL    PC+T GLR
Sbjct: 537 VDWILLANSYWLDDHNPCLTYGLR 560


>UniRef50_Q9V0C1 Cluster: Metallopeptidase, M20/M25/M40 family; n=4;
           Thermococcaceae|Rep: Metallopeptidase, M20/M25/M40
           family - Pyrococcus abyssi
          Length = 474

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/42 (45%), Positives = 26/42 (61%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           V    H DV P +  + W+T+PF+L    ++ YGRGS DDKG
Sbjct: 105 VLFMAHFDVVP-VNPEEWKTDPFKLTIEGDRAYGRGSADDKG 145


>UniRef50_O29358 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=1; Archaeoglobus fulgidus|Rep:
           Succinyl-diaminopimelate desuccinylase - Archaeoglobus
           fulgidus
          Length = 403

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/52 (42%), Positives = 31/52 (59%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCI 530
           + T+ I  HLDV P      WET PF+ + +N ++YGRGS +D G  LV  +
Sbjct: 80  EKTIWIVAHLDVVPEGDERLWETPPFKGIVKNGRIYGRGS-EDNGQSLVSSL 130


>UniRef50_P57196 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=10; Gammaproteobacteria|Rep: Succinyl-diaminopimelate
           desuccinylase - Buchnera aphidicola subsp. Acyrthosiphon
           pisum (Acyrthosiphon pisumsymbiotic bacterium)
          Length = 375

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/43 (46%), Positives = 27/43 (62%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+   GH DV P  +   W+T+PF+ V R+  L+GRGS D KG
Sbjct: 60  TLTFAGHTDVVPIGQDKDWQTDPFQPVIRSGYLFGRGSADMKG 102


>UniRef50_P54638 Cluster: Acetylornithine deacetylase; n=1;
           Dictyostelium discoideum|Rep: Acetylornithine
           deacetylase - Dictyostelium discoideum (Slime mold)
          Length = 447

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 1/44 (2%)
 Frame = +3

Query: 381 TVCIYG-HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+   G HLDV PA K+  W+  PF+L+   +KLYGRG+TD  G
Sbjct: 96  TISFVGSHLDVVPADKT-AWDRNPFQLIIEGDKLYGRGTTDCLG 138


>UniRef50_Q987H6 Cluster: Acetylornithinase; n=7;
           Alphaproteobacteria|Rep: Acetylornithinase - Rhizobium
           loti (Mesorhizobium loti)
          Length = 374

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/52 (44%), Positives = 31/52 (59%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRA 551
           GH DV PA +   W + PF L    E+LYGRG+TD KG +L   + ++P  A
Sbjct: 68  GHTDVVPAGEPQ-WSSAPFALRREGEQLYGRGTTDMKG-FLAAVLAAVPTLA 117


>UniRef50_Q8R5R5 Cluster: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase and
           related deacylases; n=2; Clostridia|Rep: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase and
           related deacylases - Thermoanaerobacter tengcongensis
          Length = 464

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/42 (45%), Positives = 26/42 (61%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           + + GHLDV P  + DGW   P+     + K+YGRG+ DDKG
Sbjct: 78  IAVLGHLDVVP--EGDGWTYPPYGAEIHDGKIYGRGTVDDKG 117


>UniRef50_A6VUA6 Cluster: Acetylornithine deacetylase (ArgE)
           precursor; n=19; Gammaproteobacteria|Rep:
           Acetylornithine deacetylase (ArgE) precursor -
           Marinomonas sp. MWYL1
          Length = 391

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/42 (47%), Positives = 27/42 (64%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLV 521
           GH D  P  K   W+++PF+L ER+ KLYG GS D KG + +
Sbjct: 78  GHTDTVPYDKGR-WQSDPFKLEERDHKLYGLGSCDMKGFFAI 118


>UniRef50_A5DQK0 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 941

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/39 (48%), Positives = 23/39 (58%)
 Frame = +3

Query: 393 YGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           Y H DV  A  SD W T PF L  ++  LY RG +D+KG
Sbjct: 569 YAHYDVVEASSSDDWSTNPFILTAKDGNLYARGVSDNKG 607



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = +1

Query: 652 EGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           + F   VD++ +S++YW+    PC+  GLR
Sbjct: 652 KSFIGDVDWIMLSNSYWMDDEIPCLNYGLR 681


>UniRef50_Q4J819 Cluster: Peptidase; n=2; Sulfolobus|Rep: Peptidase
           - Sulfolobus acidocaldarius
          Length = 433

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           N+    T+ +Y H DVQP    + W+ +PF    ++  +Y RG++D+KG
Sbjct: 60  NNGGDKTLLVYNHYDVQPVDPLNEWKYDPFSATVKDNYIYARGASDNKG 108


>UniRef50_Q9A2D4 Cluster: Acetylornithine deacetylase; n=6;
           Proteobacteria|Rep: Acetylornithine deacetylase -
           Caulobacter crescentus (Caulobacter vibrioides)
          Length = 391

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/42 (47%), Positives = 27/42 (64%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           V + GH DV P +    W T+P+ L ER+ +LYGRG+ D KG
Sbjct: 73  VVLSGHTDVVP-VDGQPWSTDPWTLTERDGRLYGRGTCDMKG 113


>UniRef50_Q5LPN6 Cluster: Acetylornithine deacetylase; n=20;
           Rhodobacterales|Rep: Acetylornithine deacetylase -
           Silicibacter pomeroyi
          Length = 388

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/46 (41%), Positives = 30/46 (65%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           ++  V + GH DV P +    W+++PF +VER+ K +GRG+ D KG
Sbjct: 65  EEGAVVLSGHTDVVP-VDGQPWDSDPFTVVERDGKYFGRGTCDMKG 109


>UniRef50_Q472F4 Cluster: Acetylornithine deacetylase; n=3; cellular
           organisms|Rep: Acetylornithine deacetylase - Ralstonia
           eutropha (strain JMP134) (Alcaligenes eutrophus)
          Length = 404

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/42 (47%), Positives = 27/42 (64%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           + + GH DV P +    W T+PF+ V R+ KLYGRG+ D KG
Sbjct: 85  IVLSGHTDVVP-VDGQNWTTDPFKPVVRDGKLYGRGTCDMKG 125


>UniRef50_Q194E9 Cluster: Dipeptidase, putative; n=2;
           Desulfitobacterium hafniense|Rep: Dipeptidase, putative
           - Desulfitobacterium hafniense (strain DCB-2)
          Length = 467

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/40 (47%), Positives = 25/40 (62%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           I GHLDV P  + DGW   P+    +  ++YGRG+ DDKG
Sbjct: 84  ILGHLDVVP--EGDGWSVPPYSGTIKEGRIYGRGALDDKG 121


>UniRef50_Q184U1 Cluster: Putative dipeptidase; n=2; Clostridium
           difficile|Rep: Putative dipeptidase - Clostridium
           difficile (strain 630)
          Length = 467

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +  V +  H+DV P    + W+++PF++ +++  LYGRG  D+KG
Sbjct: 82  EEVVGVLNHIDVVPIYNKELWKSKPFKVCQKDNYLYGRGVNDNKG 126


>UniRef50_Q08YV7 Cluster: Peptidase, M20/M25/M40 family; n=1;
           Stigmatella aurantiaca DW4/3-1|Rep: Peptidase,
           M20/M25/M40 family - Stigmatella aurantiaca DW4/3-1
          Length = 444

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/41 (46%), Positives = 27/41 (65%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGL 512
           +  HLD  PA + + W T+P+ L ER+  LYGRG  D+KG+
Sbjct: 97  VLAHLDTVPARREE-WSTDPWTLTERDGFLYGRGVQDNKGM 136


>UniRef50_Q96DM4 Cluster: CDNA FLJ32569 fis, clone SPLEN2000134,
           weakly similar to CARBOXYPEPTIDASE S; n=4;
           Tetrapoda|Rep: CDNA FLJ32569 fis, clone SPLEN2000134,
           weakly similar to CARBOXYPEPTIDASE S - Homo sapiens
           (Human)
          Length = 361

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/48 (41%), Positives = 27/48 (56%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           +DP      +  H DV PA   +GWE  PF  +ER+  +YG G+ DDK
Sbjct: 113 SDPSLQPYLLMAHFDVVPA-PEEGWEVPPFSGLERDGVIYGWGTLDDK 159


>UniRef50_A6SRY9 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 1090

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPAL-KSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K+  +  YGH DV PA  K   W  +PF++   N  LYGRG +D+KG
Sbjct: 613 KRKKILFYGHYDVVPADDKQKKWIIDPFQMKGVNGYLYGRGVSDNKG 659



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = +1

Query: 646 KPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           K +     VDY+ ++++YWL    PC+T GLR
Sbjct: 702 KYKDLIGDVDYIILANSYWLDDEVPCLTYGLR 733


>UniRef50_A3DKU1 Cluster: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase; n=1;
           Staphylothermus marinus F1|Rep: Acetylornithine
           deacetylase or succinyl-diaminopimelate desuccinylase -
           Staphylothermus marinus (strain ATCC 43588 / DSM 3639 /
           F1)
          Length = 412

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/39 (51%), Positives = 28/39 (71%), Gaps = 1/39 (2%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWE-TEPFELVERNEKLYGRGSTDDKG 509
           GH DV      +GW+ TEPF+ +++N ++YGRGSTD KG
Sbjct: 90  GHYDV--VFPGEGWKVTEPFKPIKKNGRIYGRGSTDMKG 126


>UniRef50_Q2W4P6 Cluster: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase and
           related deacylase; n=3; Proteobacteria|Rep:
           Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase and related deacylase - Magnetospirillum
           magneticum (strain AMB-1 / ATCC 700264)
          Length = 404

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/53 (39%), Positives = 30/53 (56%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMP 542
           + + GH DV P    D W  +PF LV+ + KLYGRG+ D K  ++  C+   P
Sbjct: 88  IVLSGHTDVVPVDGQD-WSRDPFHLVQADGKLYGRGTADMKS-FIAICLAMAP 138


>UniRef50_Q9F8K6 Cluster: Putative peptidase; n=1; Carboxydothermus
           hydrogenoformans|Rep: Putative peptidase -
           Carboxydothermus hydrogenoformans
          Length = 159

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/45 (46%), Positives = 28/45 (62%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K  V I  HLDV P  + DGW  +P+  V  N ++YGRG+ D+KG
Sbjct: 82  KELVGILVHLDVVP--EGDGWSYDPYXGVIVNNRIYGRGTVDNKG 124


>UniRef50_A6Q7J0 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=2; Epsilonproteobacteria|Rep: Succinyl-diaminopimelate
           desuccinylase - Sulfurovum sp. (strain NBC37-1)
          Length = 367

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/41 (48%), Positives = 25/41 (60%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           +C  GH+DV PA   DGW T PF  V +  K+Y RG+ D K
Sbjct: 59  LCFAGHVDVVPA--GDGWHTNPFVPVIKEGKIYARGTQDMK 97


>UniRef50_A7TQL0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 884

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/45 (42%), Positives = 27/45 (60%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K  +  YGH DV P+  ++ W T+PF L   N  + GRG +D+KG
Sbjct: 518 KKRILWYGHYDVIPSGNTNLWNTDPFRLTCENGYMKGRGVSDNKG 562


>UniRef50_A6RA73 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 1033

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/44 (50%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSD-GWETEPFELVERNEKLYGRGSTDDKG 509
           TV  YGH DV  A  +   W T+PF+L   N  LYGRG +D+KG
Sbjct: 515 TVLFYGHYDVVGADTNHLKWNTDPFQLCSINGFLYGRGVSDNKG 558


>UniRef50_Q8TV20 Cluster: Predicted deacylase; n=1; Methanopyrus
           kandleri|Rep: Predicted deacylase - Methanopyrus
           kandleri
          Length = 381

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/38 (57%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +3

Query: 399 HLDVQPALKSDGWE-TEPFELVERNEKLYGRGSTDDKG 509
           HLD  P    DGWE T+PF+   RN KLYGRG+ D KG
Sbjct: 75  HLDTVPP--GDGWEVTDPFDPTIRNGKLYGRGAADCKG 110


>UniRef50_Q399G5 Cluster: Peptidase M20; n=51; cellular
           organisms|Rep: Peptidase M20 - Burkholderia sp. (strain
           383) (Burkholderia cepacia (strain ATCC 17760/ NCIB 9086
           / R18194))
          Length = 484

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 2/44 (4%)
 Frame = +3

Query: 378 NTVCIYGHLDVQPALKSDGWETE--PFELVERNEKLYGRGSTDD 503
           +T+ +YGHLD QP  + DGW  +  P+     N KLYGRG  DD
Sbjct: 100 DTILLYGHLDKQP--EFDGWRADLGPWTPKYENGKLYGRGGADD 141


>UniRef50_O85036 Cluster: Dipeptidase homolog; n=1; Mycoplasma
           hominis|Rep: Dipeptidase homolog - Mycoplasma hominis
          Length = 365

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/40 (52%), Positives = 22/40 (55%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           I  HLDV PA     W T  F  V  NE + GRGS DDKG
Sbjct: 85  ILAHLDVVPAGDESQWRTSAFVPVITNESIIGRGSLDDKG 124


>UniRef50_A4BTC9 Cluster: Acetylornithine deacetylase; n=3;
           Ectothiorhodospiraceae|Rep: Acetylornithine deacetylase
           - Nitrococcus mobilis Nb-231
          Length = 446

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           TV + GH+DV PA     W  EPF      +++YGRG++D K
Sbjct: 89  TVLLTGHIDVVPAGDYSQWRLEPFSGAREGDRIYGRGASDMK 130


>UniRef50_Q4QIR7 Cluster: Acetylornithine deacetylase-like protein;
           n=3; Leishmania|Rep: Acetylornithine deacetylase-like
           protein - Leishmania major
          Length = 397

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/49 (42%), Positives = 29/49 (59%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMP 542
           GH DV P +    W ++PF L ER+  LYGRGS D K  ++  C+  +P
Sbjct: 76  GHTDVVP-VDGQKWTSDPFVLTERDGNLYGRGSCDMKA-FIAVCLALVP 122


>UniRef50_P38149 Cluster: WD repeat-containing protein YBR281C; n=4;
           Saccharomycetales|Rep: WD repeat-containing protein
           YBR281C - Saccharomyces cerevisiae (Baker's yeast)
          Length = 878

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 24/56 (42%), Positives = 31/56 (55%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSM 539
           KK  +  YGH DV  +  +  W T+PF L   N  L GRG +D+KG  LV  I S+
Sbjct: 511 KKKRILWYGHYDVISSGNTFNWNTDPFTLTCENGYLKGRGVSDNKG-PLVSAIHSV 565


>UniRef50_Q5ZWC1 Cluster: Acetylornithine deacetylase; n=4;
           Legionella pneumophila|Rep: Acetylornithine deacetylase
           - Legionella pneumophila subsp. pneumophila (strain
           Philadelphia 1 /ATCC 33152 / DSM 7513)
          Length = 384

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/46 (39%), Positives = 28/46 (60%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLV 521
           + + GH DV P +    W+++PF+   +N K+YGRG+ D KG   V
Sbjct: 67  IILSGHTDVVP-VDGQIWDSDPFQATVKNNKVYGRGACDMKGFIAV 111


>UniRef50_Q3C169 Cluster: ArcT; n=33; Lactobacillales|Rep: ArcT -
           Streptococcus suis
          Length = 452

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/42 (47%), Positives = 24/42 (57%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           + I  HLDV PA     W+T PFE V   + + GRG  DDKG
Sbjct: 85  LAILCHLDVVPAGDLSQWQTPPFEAVVEGDYIIGRGVQDDKG 126


>UniRef50_Q0LD09 Cluster: Peptidase M20; n=1; Herpetosiphon
           aurantiacus ATCC 23779|Rep: Peptidase M20 -
           Herpetosiphon aurantiacus ATCC 23779
          Length = 443

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 28/76 (36%), Positives = 35/76 (46%), Gaps = 2/76 (2%)
 Frame = +3

Query: 288 LRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNT--VCIYGHLDVQPALKSDGWETEPFELV 461
           LR +GFQ     +V           + P K+   +  + H DV PA     W  EPF L 
Sbjct: 43  LRGLGFQV----NVHPTEGAPIILAHRPGKSAQRLLFFNHYDVMPAGVWRDWFHEPFTLA 98

Query: 462 ERNEKLYGRGSTDDKG 509
           ER   LYGRG  +DKG
Sbjct: 99  EREGLLYGRGVANDKG 114


>UniRef50_Q025W8 Cluster: Peptidase M20 precursor; n=1; Solibacter
           usitatus Ellin6076|Rep: Peptidase M20 precursor -
           Solibacter usitatus (strain Ellin6076)
          Length = 442

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 19/47 (40%), Positives = 28/47 (59%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGL 512
           K+  + +  H DV PA +S  W  +P   +E+N  +YGRG+ DDK L
Sbjct: 72  KQRPLLLIAHSDVVPADRSQ-WSVDPLAAIEKNGYIYGRGAEDDKQL 117


>UniRef50_A6NPC8 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 472

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 6/63 (9%)
 Frame = +3

Query: 375 KNTVC-IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG-----LYLVGCIPS 536
           K+T+  I  H+DV    K  GW+T+P+  VE++  LYGRG  DDKG     L+ + C+  
Sbjct: 81  KDTILHILAHMDVVGEGK--GWDTDPYGPVEKDGVLYGRGVADDKGPAVAALFAMKCVKD 138

Query: 537 MPI 545
           + I
Sbjct: 139 LGI 141


>UniRef50_A0JVT4 Cluster: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase; n=2;
           Actinomycetales|Rep: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase - Arthrobacter
           sp. (strain FB24)
          Length = 411

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 21/38 (55%), Positives = 25/38 (65%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           GH DV PA    GWE  PFE   ++ +L+GRGSTD KG
Sbjct: 97  GHSDVVPA--GTGWELPPFEPYIQDGRLFGRGSTDMKG 132


>UniRef50_Q4J701 Cluster: Acetylornithine deacetylase; n=2;
           Sulfolobus|Rep: Acetylornithine deacetylase - Sulfolobus
           acidocaldarius
          Length = 413

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVG 524
           +   GH DV PA    GW   P+  V ++ KLYGRGS D K   + G
Sbjct: 88  IAFNGHYDVVPA--GSGWNVSPYSAVVKDGKLYGRGSADMKSGIIAG 132


>UniRef50_A0SNZ3 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=1; uncultured euryarchaeote ARMAN-2|Rep:
           Succinyl-diaminopimelate desuccinylase - uncultured
           euryarchaeote ARMAN-2
          Length = 291

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/52 (38%), Positives = 32/52 (61%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCI 530
           K+T+ +  H+D         W+ +PF+ VE++ K+YGRG+TDD G   +G I
Sbjct: 83  KSTLWVISHIDTVAPGDLALWDHDPFDPVEKDGKIYGRGTTDD-GQSAIGSI 133


>UniRef50_Q9X1Z4 Cluster: Succinyl-diaminopimelate desuccinylase,
           putative; n=4; Thermotogaceae|Rep:
           Succinyl-diaminopimelate desuccinylase, putative -
           Thermotoga maritima
          Length = 396

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 5/79 (6%)
 Frame = +3

Query: 288 LRDVGFQTIDGKDVQXXXXXXXXXX--NDPKKN---TVCIYGHLDVQPALKSDGWETEPF 452
           LRD GF+ +D  DV+              P KN   T+ I  H+D  P      WET+PF
Sbjct: 47  LRDFGFE-VDRCDVRDDRGIWRSNIVAKIPGKNREKTLWIVTHIDTVPPGDLSLWETDPF 105

Query: 453 ELVERNEKLYGRGSTDDKG 509
             V ++ K+YGRG+ D+ G
Sbjct: 106 VPVVKDGKVYGRGAEDNGG 124


>UniRef50_Q7VF72 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=14; Campylobacterales|Rep: Succinyl-diaminopimelate
           desuccinylase - Helicobacter hepaticus
          Length = 392

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 19/41 (46%), Positives = 25/41 (60%)
 Frame = +3

Query: 387 CIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           C  GH+DV P    +GWE EPF   +  + +YGRG+ D KG
Sbjct: 72  CFAGHIDVVPT--GEGWEFEPFCGTQDEKYIYGRGTQDMKG 110


>UniRef50_Q6YQT3 Cluster: Acetylornithine deacetylase; n=12;
           Candidatus Phytoplasma asteris|Rep: Acetylornithine
           deacetylase - Onion yellows phytoplasma
          Length = 458

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +K  V + GHLDV PA    GW+  P+  +  +  LYGRG+ DDKG
Sbjct: 78  QKEWVGMIGHLDVVPA--GTGWDYPPYAALIVDGTLYGRGTQDDKG 121


>UniRef50_Q5FPX5 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=42; Alphaproteobacteria|Rep: Succinyl-diaminopimelate
           desuccinylase - Gluconobacter oxydans (Gluconobacter
           suboxydans)
          Length = 401

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 19/42 (45%), Positives = 24/42 (57%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +C  GH DV P    +GW  +PF  V   ++LYGRG  D KG
Sbjct: 91  LCFAGHTDVVPP--GEGWAHDPFAAVIEGDRLYGRGIADMKG 130


>UniRef50_Q0F981 Cluster: Acetylornithine deacetylase; n=2;
           Alphaproteobacteria|Rep: Acetylornithine deacetylase -
           alpha proteobacterium HTCC2255
          Length = 384

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 17/53 (32%), Positives = 30/53 (56%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMP 542
           + + GH DV P +    W ++PF++   N+  YGRG+ D KG ++   +  +P
Sbjct: 67  IILSGHTDVVPVI-GQNWSSDPFKMKRENDSFYGRGTCDMKG-FIASTLAMVP 117


>UniRef50_Q02AW5 Cluster: Peptidase M20 precursor; n=1; Solibacter
           usitatus Ellin6076|Rep: Peptidase M20 precursor -
           Solibacter usitatus (strain Ellin6076)
          Length = 456

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 20/42 (47%), Positives = 26/42 (61%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +   GHLDV  A +SD W  +PFE  E+    YGRG++D KG
Sbjct: 88  ILFLGHLDVVEARRSD-WPWDPFEFREQEGYFYGRGTSDMKG 128


>UniRef50_A4EAN6 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 478

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 27/71 (38%), Positives = 34/71 (47%)
 Frame = +3

Query: 297 VGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEK 476
           +G+QT D  D             D +  T+C   H+DV PA    GW T+PF +  R   
Sbjct: 62  LGYQTSD--DDGYVGIADIPGRGDKQLATIC---HVDVVPA--GPGWNTDPFAMERREGW 114

Query: 477 LYGRGSTDDKG 509
           L GRG  DDKG
Sbjct: 115 LLGRGVIDDKG 125


>UniRef50_A7I845 Cluster: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase; n=1; Candidatus
           Methanoregula boonei 6A8|Rep: Acetylornithine
           deacetylase or succinyl-diaminopimelate desuccinylase -
           Methanoregula boonei (strain 6A8)
          Length = 393

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 21/48 (43%), Positives = 30/48 (62%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           DP+   +C  GH+DV PAL+ +GWE  PF        ++GRG++D KG
Sbjct: 58  DPRSLMLC--GHVDVVPALE-EGWERPPFSGAIEEGYVWGRGTSDMKG 102


>UniRef50_A4WL33 Cluster: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase; n=2;
           Pyrobaculum|Rep: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase - Pyrobaculum
           arsenaticum (strain DSM 13514 / JCM 11321)
          Length = 399

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 20/39 (51%), Positives = 26/39 (66%), Gaps = 1/39 (2%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWE-TEPFELVERNEKLYGRGSTDDKG 509
           GH DV P    + W+ T+PFE V +N +LYGRG+ D KG
Sbjct: 81  GHYDVVPPGPLESWKVTKPFEPVYQNGRLYGRGAVDMKG 119


>UniRef50_Q7VRT2 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=2; Candidatus Blochmannia|Rep:
           Succinyl-diaminopimelate desuccinylase - Blochmannia
           floridanus
          Length = 384

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 366 DPKKNTVCIY-GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           D KK T  ++ GH DV P      W+  PF     N  +YGRGS+D KG
Sbjct: 59  DQKKYTTLLFAGHTDVVPPGDIHNWQYPPFSGTVHNNIIYGRGSSDMKG 107


>UniRef50_Q182H7 Cluster: Putative peptidase; n=2; Clostridium
           difficile|Rep: Putative peptidase - Clostridium
           difficile (strain 630)
          Length = 456

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 23/60 (38%), Positives = 34/60 (56%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           K  V I+GH DV      +GW++EPF+L    +KL  RG +D+KG  +V  +    I+ L
Sbjct: 81  KEYVDIFGHCDV--VNPGEGWDSEPFKLNIIGDKLVARGVSDNKGPMIVNFLALKMIKDL 138


>UniRef50_Q0K418 Cluster: Acetylornithine deacetylase precursor;
           n=2; Proteobacteria|Rep: Acetylornithine deacetylase
           precursor - Ralstonia eutropha (strain ATCC 17699 / H16
           / DSM 428 / Stanier 337)(Cupriavidus necator (strain
           ATCC 17699 / H16 / DSM 428 / Stanier337))
          Length = 391

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRA 551
           V + GH DV P ++   W + PFE   R+ ++YGRG+ D KG   V C  +  + A
Sbjct: 71  VLLSGHTDVVP-VEGQPWTSPPFEATHRDGRIYGRGTADMKG--FVACAVTAMVAA 123


>UniRef50_A6GG07 Cluster: Putative peptidase, M20/M25/M40 family
           protein; n=1; Plesiocystis pacifica SIR-1|Rep: Putative
           peptidase, M20/M25/M40 family protein - Plesiocystis
           pacifica SIR-1
          Length = 426

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 18/42 (42%), Positives = 26/42 (61%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           V +YGH D  PA  + GW ++P  L+ER  + + RG  D+KG
Sbjct: 212 VVLYGHYDTIPA--NPGWSSDPDVLIERERRWFARGIADNKG 251


>UniRef50_A0YAV9 Cluster: Putative uncharacterized protein; n=1;
           marine gamma proteobacterium HTCC2143|Rep: Putative
           uncharacterized protein - marine gamma proteobacterium
           HTCC2143
          Length = 483

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
 Frame = +3

Query: 369 PKKNTVCIYGHLDVQPALKS--DGWETEPFELVERNEKLYGRGSTDDK 506
           P+   V + GH DV P +    D WE+ PF    +N  +YGRG+ DDK
Sbjct: 109 PELQPVLLTGHYDVVPVIPGTEDKWESAPFSGELKNGYIYGRGAMDDK 156


>UniRef50_Q01DV7 Cluster: DIP-1; n=1; Ostreococcus tauri|Rep: DIP-1
           - Ostreococcus tauri
          Length = 483

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +3

Query: 399 HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           HLDV PA   + W  +PF+L    +KLYGRG+TD  G
Sbjct: 143 HLDVVPA-NPEAWSVDPFKLTIDGDKLYGRGTTDCLG 178


>UniRef50_Q892Y8 Cluster: XAA-His dipeptidase; n=14; Clostridia|Rep:
           XAA-His dipeptidase - Clostridium tetani
          Length = 481

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 18/40 (45%), Positives = 24/40 (60%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           + GHLDV P  + +GW   P+       K+YGRG+ DDKG
Sbjct: 95  VLGHLDVVP--EGEGWSHPPYAAEIHEGKIYGRGALDDKG 132


>UniRef50_Q8RNM5 Cluster: Zn metalloprotein; n=5; Bacteria|Rep: Zn
           metalloprotein - Legionella pneumophila
          Length = 469

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 19/44 (43%), Positives = 25/44 (56%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           K  + +  H DV  A  SD W  +PF+L E+    YGRG+ DDK
Sbjct: 98  KKPLLLLAHTDVVEAKASD-WSMDPFQLTEKEGYFYGRGTLDDK 140


>UniRef50_Q1LH39 Cluster: Peptidase M20 precursor; n=1; Ralstonia
           metallidurans CH34|Rep: Peptidase M20 precursor -
           Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM
           2839)
          Length = 478

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGL 512
           +  V +  H+DV  A + D W+T+PF+L E N     RGS DDK +
Sbjct: 109 RQPVLLLAHIDVVEAKRED-WKTDPFQLQETNGYFTARGSIDDKAM 153


>UniRef50_Q0FFV4 Cluster: Putative uncharacterized protein; n=1;
           alpha proteobacterium HTCC2255|Rep: Putative
           uncharacterized protein - alpha proteobacterium HTCC2255
          Length = 458

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 2/49 (4%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETE--PFELVERNEKLYGRGSTDDKGLYLV 521
           T+  YGH DV    + + WE +  P++L+E++   YGRG+ D+KG + +
Sbjct: 86  TILTYGHGDVVLG-QDESWEDDLTPYKLIEKDGSFYGRGTADNKGQHFI 133


>UniRef50_A6TN14 Cluster: Dipeptidase, putative; n=1; Alkaliphilus
           metalliredigens QYMF|Rep: Dipeptidase, putative -
           Alkaliphilus metalliredigens QYMF
          Length = 448

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 21/42 (50%), Positives = 22/42 (52%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           V I  HLDV P    D W    FE      KLYGRG+ DDKG
Sbjct: 79  VGILAHLDVVPVENPDQWSHPVFEGEIHEGKLYGRGAVDDKG 120


>UniRef50_A6FPM0 Cluster: D-tyrosyl-tRNA deacylase; n=1; Roseobacter
           sp. AzwK-3b|Rep: D-tyrosyl-tRNA deacylase - Roseobacter
           sp. AzwK-3b
          Length = 408

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMP 542
           + + GH DV P  + D W + PFE+ E    LYGRG+ D KG ++   +   P
Sbjct: 90  IVLSGHSDVVPVDEQD-WASYPFEMTEHEGLLYGRGTCDMKG-FIAAAVAMAP 140


>UniRef50_A0NQR9 Cluster: Acetylornithine deacetylase; n=9;
           Rhodobacterales|Rep: Acetylornithine deacetylase -
           Stappia aggregata IAM 12614
          Length = 391

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 24/78 (30%), Positives = 35/78 (44%)
 Frame = +3

Query: 276 ATTELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWETEPFE 455
           + T LR+ G +    +D                   + + GH DV PA  ++ W   PF+
Sbjct: 34  SATLLREAGARVRVSRDETGRKANLFATIGPDVSGGIVLSGHSDVVPADPAE-WTCNPFQ 92

Query: 456 LVERNEKLYGRGSTDDKG 509
           + E N  LYGRG+ D KG
Sbjct: 93  MREENGLLYGRGTCDMKG 110


>UniRef50_A2FJP6 Cluster: Clan MH, family M20, peptidase T-like
           metallopeptidase; n=2; Trichomonas vaginalis G3|Rep:
           Clan MH, family M20, peptidase T-like metallopeptidase -
           Trichomonas vaginalis G3
          Length = 474

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 24/67 (35%), Positives = 29/67 (43%), Gaps = 2/67 (2%)
 Frame = +3

Query: 309 TIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWE--TEPFELVERNEKLY 482
           T + K+V+           D     V  YGHLD  P L   GW     P   V R  K+Y
Sbjct: 70  TFEEKNVEPLLMVEIESTADHDVPAVLTYGHLDKMPHLDPAGWSEGLGPTNPVVRGNKIY 129

Query: 483 GRGSTDD 503
           GRG+ DD
Sbjct: 130 GRGTNDD 136


>UniRef50_A3GFT0 Cluster: Metalloexopeptidase; n=3;
           Saccharomycetaceae|Rep: Metalloexopeptidase - Pichia
           stipitis (Yeast)
          Length = 977

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDG--WETEPFELVERNEKLYGRGSTDDKG 509
           K   V  Y H DV  A   +   WET+PF L  R+  LY RG +D+KG
Sbjct: 601 KPTRVLWYAHYDVVDATNHEAADWETDPFLLTARDGNLYARGVSDNKG 648



 Score = 32.7 bits (71), Expect = 9.8
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +1

Query: 670 VDYVCISDNYWLGTTKPCITNGLR 741
           +D+V +S++YWL    PC+  GLR
Sbjct: 699 IDWVMLSNSYWLDDETPCLNYGLR 722


>UniRef50_Q483J4 Cluster: Acetylornithine deacetylase; n=1;
           Colwellia psychrerythraea 34H|Rep: Acetylornithine
           deacetylase - Colwellia psychrerythraea (strain 34H /
           ATCC BAA-681) (Vibriopsychroerythus)
          Length = 392

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLV 521
           K+ V + GH DV P +    W+T+PF +  ++  L+GRG+ D KG   +
Sbjct: 69  KSGVMLSGHTDVVP-VTGQAWDTDPFCVTHKDGMLFGRGTCDMKGFIAI 116


>UniRef50_Q160L0 Cluster: Acetylornithine deacetylase, putative;
           n=2; Rhodobacteraceae|Rep: Acetylornithine deacetylase,
           putative - Roseobacter denitrificans (strain ATCC 33942
           / OCh 114) (Erythrobactersp. (strain OCh 114))
           (Roseobacter denitrificans)
          Length = 382

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +C+ GH DV P ++   W    F+L +   +++GRG+TD KG
Sbjct: 68  ICLSGHTDVVP-VEGQNWTRPAFKLTQEGARVFGRGATDMKG 108


>UniRef50_Q03S16 Cluster: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase
           related deacylase; n=2; Bacilli|Rep: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase
           related deacylase - Lactobacillus brevis (strain ATCC
           367 / JCM 1170)
          Length = 386

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 18/39 (46%), Positives = 26/39 (66%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           I GH+DV        W+++PF+L ER+  LYGRG++D K
Sbjct: 69  ISGHMDVVSPGDVTQWQSDPFKLSERSGNLYGRGASDMK 107


>UniRef50_Q97ZB7 Cluster: Acetylornithine deacetylase; n=3;
           Sulfolobaceae|Rep: Acetylornithine deacetylase -
           Sulfolobus solfataricus
          Length = 376

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 20/37 (54%), Positives = 23/37 (62%)
 Frame = +3

Query: 399 HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           H DV P    DGW T PFEL   + K YGRG++D KG
Sbjct: 85  HYDVVPP--GDGWLTNPFELKVVDNKAYGRGTSDMKG 119


>UniRef50_Q2FFY7 Cluster: Putative dipeptidase SAUSA300_1697; n=16;
           Staphylococcus|Rep: Putative dipeptidase SAUSA300_1697 -
           Staphylococcus aureus (strain USA300)
          Length = 469

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 18/37 (48%), Positives = 24/37 (64%)
 Frame = +3

Query: 399 HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           H+DV PA   DGW++ PFE V   + +  RG+ DDKG
Sbjct: 84  HVDVVPA--GDGWDSNPFEPVVTEDAIIARGTLDDKG 118


>UniRef50_Q81YY6 Cluster: Acetylornitine deacetylase, putative;
           n=18; Bacillales|Rep: Acetylornitine deacetylase,
           putative - Bacillus anthracis
          Length = 426

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +D  K+ + I GH+DV      + WET PFE   ++  L GRG+ D KG
Sbjct: 78  SDTHKSLI-INGHMDVAEVSADEAWETNPFEPFIKDGWLVGRGAADMKG 125


>UniRef50_Q5P9A2 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=4; Anaplasmataceae|Rep: Succinyl-diaminopimelate
           desuccinylase - Anaplasma marginale (strain St. Maries)
          Length = 400

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 30/102 (29%), Positives = 45/102 (44%), Gaps = 5/102 (4%)
 Frame = +3

Query: 216 ISCGLHPYGSLDADKLKEVGATTEL-RDVGFQ----TIDGKDVQXXXXXXXXXXNDPKKN 380
           ++C L  Y S+  D+   +    EL  D+GF+    +    DV+            P   
Sbjct: 28  LACRLMSYPSVTPDRSGAIPFLAELLSDLGFRCEILSFGNGDVEVKNLYAQYGNGHPN-- 85

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
            +C  GH DV P      W T+PF    ++  LYGRG++D K
Sbjct: 86  -LCFAGHTDVVPP--GGTWRTDPFSPQVKDGMLYGRGASDMK 124


>UniRef50_Q5LM87 Cluster: Acetylornithine deacetylase; n=1;
           Silicibacter pomeroyi|Rep: Acetylornithine deacetylase -
           Silicibacter pomeroyi
          Length = 381

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 18/37 (48%), Positives = 24/37 (64%)
 Frame = +3

Query: 399 HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           H DV P ++   W   PF+L  + +KLYGRG+TD KG
Sbjct: 70  HSDVVP-VEGQSWCVPPFKLTRQGDKLYGRGTTDMKG 105


>UniRef50_Q84GL0 Cluster: Succinyldiaminopimelate desuccinylase;
           n=29; Bacilli|Rep: Succinyldiaminopimelate desuccinylase
           - Listeria monocytogenes
          Length = 159

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 18/37 (48%), Positives = 22/37 (59%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           GH+DV  A     W+  PFE  E   K+YGRG+TD K
Sbjct: 39  GHMDVVDAGDVSKWKFPPFEATEHEGKIYGRGATDMK 75


>UniRef50_Q1U6J4 Cluster: Peptidase M20A, peptidase V; n=2;
           Lactobacillus reuteri|Rep: Peptidase M20A, peptidase V -
           Lactobacillus reuteri 100-23
          Length = 444

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = +3

Query: 399 HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           HLD  PA     W+ +PF+    N+ +YGRGS DDKG
Sbjct: 83  HLDTVPAGDLGKWKHDPFKGTVINDAVYGRGSQDDKG 119


>UniRef50_Q0FSK2 Cluster: Acetylornithine deacetylase; n=1;
           Roseovarius sp. HTCC2601|Rep: Acetylornithine
           deacetylase - Roseovarius sp. HTCC2601
          Length = 405

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 19/38 (50%), Positives = 26/38 (68%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           GH DV PA + + W+++PF    R+ KLYGRG+ D KG
Sbjct: 83  GHTDVVPADEPE-WQSDPFTAEIRDGKLYGRGACDMKG 119


>UniRef50_Q028R7 Cluster: Peptidase M20 precursor; n=1; Solibacter
           usitatus Ellin6076|Rep: Peptidase M20 precursor -
           Solibacter usitatus (strain Ellin6076)
          Length = 464

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 19/60 (31%), Positives = 32/60 (53%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           K  + I GH DV   ++ + W  +PF  + RN  +Y RGS DDK   + G +  + ++ +
Sbjct: 90  KKPLLIMGHTDVV-GVQREKWSFDPFAAINRNGVIYARGSRDDKPHVVAGIMTLLLLKRM 148


>UniRef50_Q0U762 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 983

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDG-WETEPFELVERNEKLYGRGSTDDKG 509
           +  +  YGH DV PA      W+ +PF L      LYGRG +D+KG
Sbjct: 552 RKKILFYGHYDVIPAENEHRKWKHDPFSLTGEGGYLYGRGVSDNKG 597



 Score = 32.7 bits (71), Expect = 9.8
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 670 VDYVCISDNYWLGTTKPCITNGLR 741
           VD++ ++++YWL    PC+T GLR
Sbjct: 648 VDWILLANSYWLDDHVPCLTYGLR 671


>UniRef50_P0AED8 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=75; Gammaproteobacteria|Rep: Succinyl-diaminopimelate
           desuccinylase - Shigella flexneri
          Length = 375

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 19/43 (44%), Positives = 24/43 (55%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+   GH DV P   +D W   PFE   R+  L+GRG+ D KG
Sbjct: 60  TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKG 102


>UniRef50_UPI00015BB0F6 Cluster: acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase; n=2; Ignicoccus
           hospitalis KIN4/I|Rep: acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase - Ignicoccus
           hospitalis KIN4/I
          Length = 385

 Score = 40.7 bits (91), Expect = 0.037
 Identities = 21/38 (55%), Positives = 22/38 (57%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           GH DV P    DGWE  PFE     E L GRG+TD KG
Sbjct: 81  GHYDVVPP--GDGWEGNPFEPKVVGEYLVGRGATDMKG 116


>UniRef50_Q8UJJ8 Cluster: Acetylornithine deacetylase; n=1;
           Agrobacterium tumefaciens str. C58|Rep: Acetylornithine
           deacetylase - Agrobacterium tumefaciens (strain C58 /
           ATCC 33970)
          Length = 387

 Score = 40.7 bits (91), Expect = 0.037
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +3

Query: 399 HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRA 551
           H+D  PA   DGW T+ F L E + KL+GRG+ D KG  L+  I +M + A
Sbjct: 76  HMDTVPA--GDGWTTDAFILREDDGKLFGRGACDCKG-PLIAMIEAMRMLA 123


>UniRef50_Q62JI2 Cluster: Acetylornithine deacetylase; n=43;
           Bacteria|Rep: Acetylornithine deacetylase - Burkholderia
           mallei (Pseudomonas mallei)
          Length = 405

 Score = 40.7 bits (91), Expect = 0.037
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           + + GH DV P +    W+++PF+   R+ KLYGRG+ D KG
Sbjct: 86  IVLSGHTDVVP-VDGQQWDSDPFKPQVRDGKLYGRGTCDMKG 126


>UniRef50_Q5GS68 Cluster: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase; n=6;
           Rickettsiales|Rep: Acetylornithine
           deacetylase/Succinyl-diaminopimelate desuccinylase -
           Wolbachia sp. subsp. Brugia malayi (strain TRS)
          Length = 401

 Score = 40.7 bits (91), Expect = 0.037
 Identities = 18/41 (43%), Positives = 25/41 (60%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           +C  GH+DV P  +   W ++PF    R+  LYGRG+TD K
Sbjct: 66  LCFAGHVDVVPPGQLKDWISDPFSPEVRDGLLYGRGATDMK 106


>UniRef50_Q38Z56 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=2; Bacilli|Rep: Succinyl-diaminopimelate desuccinylase
           - Lactobacillus sakei subsp. sakei (strain 23K)
          Length = 432

 Score = 40.7 bits (91), Expect = 0.037
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           + + GH+DV        W ++PF L  R+ KL+GRG+TD K
Sbjct: 66  LAVTGHMDVVSIGDRSKWTSDPFTLTARDGKLFGRGATDMK 106


>UniRef50_A6U6C4 Cluster: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase; n=1;
           Sinorhizobium medicae WSM419|Rep: Acetylornithine
           deacetylase or succinyl-diaminopimelate desuccinylase -
           Sinorhizobium medicae WSM419
          Length = 447

 Score = 40.7 bits (91), Expect = 0.037
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWET-EPFELVERNEKLYGRGSTDDKGLYLVGCI 530
           GH+D     K + W + +P++ V R E+L+G GSTD KG     C+
Sbjct: 104 GHVDTVAPFKPEAWTSGDPWKPVRRGEELFGLGSTDMKGGLAAACL 149


>UniRef50_Q9YEE4 Cluster: Putative uncharacterized protein; n=1;
           Aeropyrum pernix|Rep: Putative uncharacterized protein -
           Aeropyrum pernix
          Length = 419

 Score = 40.7 bits (91), Expect = 0.037
 Identities = 21/39 (53%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWE-TEPFELVERNEKLYGRGSTDDKG 509
           GH DV P     GW  TEPF+ V ++ KLYGRG+ D KG
Sbjct: 94  GHYDVVPG--GPGWSVTEPFKPVVKDGKLYGRGAIDMKG 130


>UniRef50_Q4J8C5 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=2; Sulfolobus|Rep: Succinyl-diaminopimelate
           desuccinylase - Sulfolobus acidocaldarius
          Length = 382

 Score = 40.7 bits (91), Expect = 0.037
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +3

Query: 363 NDPKKN--TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           N+ KK+  ++ + GH DV P      W  +PF  +   +K+YGRGS+D K
Sbjct: 58  NNGKKSDKSIMLNGHYDVVPTGDLKSWSHDPFSALILEDKIYGRGSSDMK 107


>UniRef50_Q8A1V9 Cluster: Acetylornithine deacetylase; n=8;
           Bacteroidales|Rep: Acetylornithine deacetylase -
           Bacteroides thetaiotaomicron
          Length = 355

 Score = 40.3 bits (90), Expect = 0.049
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLD-VQPALKSDGWETEPFELVERNEKLYGRGSTD 500
           D KK T+ +  H+D V+P    +GW  +PF   E N KLYG GS D
Sbjct: 62  DLKKPTILLNSHIDTVKPV---NGWRKDPFTPREENGKLYGLGSND 104


>UniRef50_Q73RM0 Cluster: Peptidase, M20/M25/M40 family; n=1;
           Treponema denticola|Rep: Peptidase, M20/M25/M40 family -
           Treponema denticola
          Length = 411

 Score = 40.3 bits (90), Expect = 0.049
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +3

Query: 261 LKEVGATT-ELRDVGFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGW 437
           LKE G +  E  D   + +  K ++          ND  K  + I  HLDV P      W
Sbjct: 51  LKEAGFSNFERLDAPDERVSSK-IRPNLIVTIPGKND--KERLWIMSHLDVVPPGDLSKW 107

Query: 438 ETEPFELVERNEKLYGRGSTDDK 506
           E++P+ ++E++ KL GRG  D++
Sbjct: 108 ESDPWTVIEKDGKLIGRGVEDNQ 130


>UniRef50_Q6N5E6 Cluster: Possible acetylornitine deacetylase; n=5;
           Bradyrhizobiaceae|Rep: Possible acetylornitine
           deacetylase - Rhodopseudomonas palustris
          Length = 426

 Score = 40.3 bits (90), Expect = 0.049
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           ++ + GH DV PA   + W+T PF  V +  ++YGRG+ D K
Sbjct: 98  SLILQGHCDVVPAGPLEMWDTPPFSPVIKQGRMYGRGACDMK 139


>UniRef50_Q5FRQ9 Cluster: N-acyl-L-amino acid amidohydrolase; n=2;
           Alphaproteobacteria|Rep: N-acyl-L-amino acid
           amidohydrolase - Gluconobacter oxydans (Gluconobacter
           suboxydans)
          Length = 480

 Score = 40.3 bits (90), Expect = 0.049
 Identities = 22/47 (46%), Positives = 26/47 (55%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           DP    + I GH+DV  A  SD W  +PF+    N  L GRGSTD K
Sbjct: 109 DPSLKPLVISGHMDVVEAKASD-WTHDPFKPQIENGYLLGRGSTDMK 154


>UniRef50_Q3E237 Cluster: Peptidase M20:Peptidase dimerisation; n=2;
           Chloroflexus|Rep: Peptidase M20:Peptidase dimerisation -
           Chloroflexus aurantiacus J-10-fl
          Length = 443

 Score = 40.3 bits (90), Expect = 0.049
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +  T+ +Y H D  P      W  EPF++ ER+ +++GRG    KG
Sbjct: 69  RPQTLLLYHHYDTPPTGPWRHWSHEPFDIAERDGRVFGRGVAGGKG 114


>UniRef50_Q5AAB6 Cluster: Putative uncharacterized protein; n=2;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 634

 Score = 40.3 bits (90), Expect = 0.049
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = +3

Query: 393 YGHLDVQPALKSDG--WETEPFELVERNEKLYGRGSTDDKG 509
           Y H DV  A K++   W+T+PF L  +   LY RG +D+KG
Sbjct: 246 YAHYDVVDATKNEAKDWKTDPFILTAKEGNLYARGVSDNKG 286


>UniRef50_Q2FNX2 Cluster: Peptidase M20; n=1; Methanospirillum
           hungatei JF-1|Rep: Peptidase M20 - Methanospirillum
           hungatei (strain JF-1 / DSM 864)
          Length = 391

 Score = 40.3 bits (90), Expect = 0.049
 Identities = 20/45 (44%), Positives = 28/45 (62%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +NT+ + GH+DV PAL  D W   P+     +  ++GRGSTD KG
Sbjct: 58  QNTLLLCGHVDVVPALPDD-WTYPPYSGRIDDTVVHGRGSTDMKG 101


>UniRef50_UPI0000583EB6 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 509

 Score = 39.9 bits (89), Expect = 0.065
 Identities = 22/62 (35%), Positives = 33/62 (53%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMP 542
           +DP      +  H DV P +K   W+  PFE  E +  +YGRG+ DDK   L+G + ++ 
Sbjct: 115 SDPTIMPYMLAAHQDVVP-VKDQDWDYPPFEAREVDGYIYGRGTIDDKHA-LMGIMEALE 172

Query: 543 IR 548
            R
Sbjct: 173 FR 174


>UniRef50_Q193M3 Cluster: Peptidase M20; n=11; Bacteria|Rep:
           Peptidase M20 - Desulfitobacterium hafniense (strain
           DCB-2)
          Length = 395

 Score = 39.9 bits (89), Expect = 0.065
 Identities = 20/55 (36%), Positives = 26/55 (47%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGC 527
           N P K  +   GH+D  P      W  +PF     N ++YGRG+TD KG     C
Sbjct: 61  NRPGKK-ILYEGHMDEVPVADPKVWTHDPFGAEIENGRIYGRGATDMKGGLSAAC 114


>UniRef50_O32633 Cluster: DapE; n=5; Helicobacter|Rep: DapE -
           Helicobacter pylori (Campylobacter pylori)
          Length = 388

 Score = 39.9 bits (89), Expect = 0.065
 Identities = 17/38 (44%), Positives = 25/38 (65%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           GH+DV P    D W+++PF+ + +   LYGRG+ D KG
Sbjct: 83  GHIDVVPP--GDNWQSDPFKPIIKEGFLYGRGAQDMKG 118


>UniRef50_A6W2W9 Cluster: Peptidase M20; n=1; Marinomonas sp.
           MWYL1|Rep: Peptidase M20 - Marinomonas sp. MWYL1
          Length = 467

 Score = 39.9 bits (89), Expect = 0.065
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 2/54 (3%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWE--TEPFELVERNEKLYGRGSTDDKGLYLV 521
           D    T+  YGH DV    + + W+  T P+EL +  EK++GRG+ D+KG + +
Sbjct: 89  DESLPTLLTYGHGDVTNG-QVELWQEGTHPWELTQIEEKIFGRGTADNKGQHTI 141


>UniRef50_A3K4G5 Cluster: Acetylornithine deacetylase; n=1;
           Sagittula stellata E-37|Rep: Acetylornithine deacetylase
           - Sagittula stellata E-37
          Length = 422

 Score = 39.9 bits (89), Expect = 0.065
 Identities = 19/42 (45%), Positives = 25/42 (59%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           V + GHLDV P +    W  +PF L  R+ + YGRG+ D KG
Sbjct: 75  VMLSGHLDVVP-VDGQPWAGDPFSLSLRDGRAYGRGAADMKG 115


>UniRef50_A3JSZ2 Cluster: Acetylornithine deacetylase; n=8;
           Proteobacteria|Rep: Acetylornithine deacetylase -
           Rhodobacterales bacterium HTCC2150
          Length = 391

 Score = 39.9 bits (89), Expect = 0.065
 Identities = 23/59 (38%), Positives = 32/59 (54%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRALVL 560
           V + GH DV P +    W    FEL   N + +GRG+TD KG +L   + +M +RA  L
Sbjct: 73  VMLSGHSDVVP-VAGQNWTKPAFELTHENGRYFGRGTTDMKG-FLASSL-AMALRAAKL 128


>UniRef50_Q57899 Cluster: Uncharacterized protein MJ0457; n=6;
           Methanococcales|Rep: Uncharacterized protein MJ0457 -
           Methanococcus jannaschii
          Length = 410

 Score = 39.9 bits (89), Expect = 0.065
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDD-KGL 512
           +  T+ I  HLD  P      W T P+E V ++ K+YGRGS D+ KG+
Sbjct: 78  RDKTLHIISHLDTVPEGDISLWGTNPYEPVIKDGKIYGRGSEDNHKGI 125


>UniRef50_Q8CMV9 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=4; Staphylococcus|Rep: Succinyl-diaminopimelate
           desuccinylase - Staphylococcus epidermidis (strain ATCC
           12228)
          Length = 414

 Score = 39.5 bits (88), Expect = 0.085
 Identities = 18/39 (46%), Positives = 21/39 (53%)
 Frame = +3

Query: 390 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           I GH+DV      D W  +PF L E    LYGRG+ D K
Sbjct: 69  ISGHMDVVSEGNHDDWTYDPFTLTENQGYLYGRGAADMK 107


>UniRef50_Q81QW8 Cluster: Peptidase, M20/M25/M40 family; n=12;
           Bacteria|Rep: Peptidase, M20/M25/M40 family - Bacillus
           anthracis
          Length = 422

 Score = 39.5 bits (88), Expect = 0.085
 Identities = 16/43 (37%), Positives = 25/43 (58%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           ++ + GH+DV P    D W+  P+       ++YGRG+TD KG
Sbjct: 95  SMILNGHIDVVPEGDVDQWDHHPYSGERIGNRIYGRGTTDMKG 137


>UniRef50_Q1DFN7 Cluster: Peptidase homolog, M20 family; n=1;
           Myxococcus xanthus DK 1622|Rep: Peptidase homolog, M20
           family - Myxococcus xanthus (strain DK 1622)
          Length = 431

 Score = 39.5 bits (88), Expect = 0.085
 Identities = 22/39 (56%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
 Frame = +3

Query: 399 HLDVQPA-LKSDGWETEPFELVE-RNEKLYGRGSTDDKG 509
           H DV PA  K++GWE  PFEL E     LYGRG TD  G
Sbjct: 91  HFDVVPADQKTEGWERSPFELWEGPGGVLYGRGVTDCLG 129


>UniRef50_A4C641 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=1; Pseudoalteromonas tunicata D2|Rep:
           Succinyl-diaminopimelate desuccinylase -
           Pseudoalteromonas tunicata D2
          Length = 389

 Score = 39.5 bits (88), Expect = 0.085
 Identities = 18/38 (47%), Positives = 25/38 (65%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           GH+DV PA  + GW +EPF     ++ +YGRG+ D KG
Sbjct: 75  GHVDVVPA-NNKGWYSEPFSGQIIDQHIYGRGAADMKG 111


>UniRef50_Q55FR8 Cluster: Peptidase M20 family protein; n=1;
           Dictyostelium discoideum AX4|Rep: Peptidase M20 family
           protein - Dictyostelium discoideum AX4
          Length = 519

 Score = 39.5 bits (88), Expect = 0.085
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           D     + + GH+DV P L  D W   PF     +  ++GRG+ DDKG
Sbjct: 140 DESLKPILLAGHIDVVPTLFLDKWTHPPFSGHIDDTYIWGRGTMDDKG 187


>UniRef50_Q6N7D3 Cluster: Possible acetylornithine deacetylase; n=5;
           Bradyrhizobiaceae|Rep: Possible acetylornithine
           deacetylase - Rhodopseudomonas palustris
          Length = 432

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           +D K  ++ + GH+DV P    D W   P+E   R+  + GRG+ D KG
Sbjct: 98  SDGKGRSLILQGHIDVVPEGPVDLWSDPPYEAKVRDGWMIGRGAQDMKG 146


>UniRef50_Q606D5 Cluster: Acetylornithine deacetylase; n=13;
           Gammaproteobacteria|Rep: Acetylornithine deacetylase -
           Methylococcus capsulatus
          Length = 388

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLY 515
           + + GH D  P    D W ++PF  VE++ ++YG GS D K  +
Sbjct: 75  LALSGHTDTVPC-DPDRWHSDPFTAVEKDGRIYGLGSADMKSFF 117


>UniRef50_Q12C18 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=32; Proteobacteria|Rep: Succinyl-diaminopimelate
           desuccinylase - Polaromonas sp. (strain JS666 / ATCC
           BAA-500)
          Length = 425

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/42 (42%), Positives = 22/42 (52%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           T+   GH DV P    + W + PF    RN  LYGRG+ D K
Sbjct: 90  TLVFAGHTDVVPTGPLEQWHSHPFTPSHRNGVLYGRGAADMK 131


>UniRef50_A7III1 Cluster: Acetylornithine deacetylase; n=1;
           Xanthobacter autotrophicus Py2|Rep: Acetylornithine
           deacetylase - Xanthobacter sp. (strain Py2)
          Length = 397

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCI 530
           + +  H DV  A++   W + PF +  R+ +LYGRG++D KG   + C+
Sbjct: 67  IVLSAHTDVV-AVEGQPWTSNPFRIAARDGRLYGRGTSDMKG--FIACV 112


>UniRef50_A5TTA2 Cluster: M20 family peptidase; n=3; Fusobacterium
           nucleatum|Rep: M20 family peptidase - Fusobacterium
           nucleatum subsp. polymorphum ATCC 10953
          Length = 452

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/45 (40%), Positives = 26/45 (57%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K T+ I  H+DV P  + D W   P+     + K++GRG+ DDKG
Sbjct: 75  KETLGILAHVDVVP--EGDNWTYPPYSGTIADGKIFGRGTLDDKG 117


>UniRef50_Q23YE0 Cluster: Peptidase family M20/M25/M40 containing
           protein; n=5; Oligohymenophorea|Rep: Peptidase family
           M20/M25/M40 containing protein - Tetrahymena thermophila
           SB210
          Length = 473

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 2/57 (3%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALK--SDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPI 545
           TV  YGH D QP     SDG       +++  +KLYGRGS DD G  + G + S+ I
Sbjct: 92  TVLFYGHFDKQPPFTGWSDGLAFNKPVVID--DKLYGRGSVDD-GYSIFGAVSSIKI 145


>UniRef50_Q758A6 Cluster: AEL154Cp; n=1; Eremothecium gossypii|Rep:
           AEL154Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 888

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/39 (46%), Positives = 22/39 (56%)
 Frame = +3

Query: 393 YGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           YGH DV  A     W+ +PF L   N  L GRG +D+KG
Sbjct: 528 YGHYDVISADHPSQWDNDPFTLTCENGYLKGRGVSDNKG 566


>UniRef50_Q4P0N3 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1166

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +3

Query: 363 NDPKKNTVCI-YGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           + P+    C+ YGH D   A     W ++PF L  R+  LYGRG +D+KG
Sbjct: 782 SQPRHEKRCLFYGHYDCIAA--EGNWTSDPFTLDGRDGYLYGRGVSDNKG 829



 Score = 32.7 bits (71), Expect = 9.8
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +1

Query: 670 VDYVCISDNYWLGTTKPCITNGLR 741
           +D + +S++YWL    PC+T GLR
Sbjct: 880 IDVILLSNSYWLDEETPCLTIGLR 903


>UniRef50_A5DWG9 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 1044

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDG--WETEPFELVERNEKLYGRGSTDDKG 509
           K   +  Y H DV  A + +   W T PF L  +   LY RG +D+KG
Sbjct: 689 KLERILYYAHYDVVDATRQEAQDWSTNPFVLTAKEGNLYARGVSDNKG 736


>UniRef50_Q8ZVD7 Cluster: Possible succinyl-diaminopimelate
           desuccinylase; n=3; Thermoprotei|Rep: Possible
           succinyl-diaminopimelate desuccinylase - Pyrobaculum
           aerophilum
          Length = 397

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 19/39 (48%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWE-TEPFELVERNEKLYGRGSTDDKG 509
           GH DV P    + W  T PFE V R  ++YGRG+ D KG
Sbjct: 81  GHYDVVPPGPLESWRVTMPFEPVYREGRVYGRGAVDMKG 119


>UniRef50_Q9K7T7 Cluster: Xaa-His dipeptidase; n=2; Bacillus|Rep:
           Xaa-His dipeptidase - Bacillus halodurans
          Length = 465

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           + +V I  H+DV P    +GW + PF    +N+++  RG+ DDKG  +        I  L
Sbjct: 83  EESVGILCHIDVVPP--GEGWSSPPFAAEIQNDRIVARGALDDKGPTIAAFFAMRIIHEL 140

Query: 555 VLS 563
            LS
Sbjct: 141 NLS 143


>UniRef50_Q7MSC2 Cluster: DESUCCINYLASE; n=7;
           Epsilonproteobacteria|Rep: DESUCCINYLASE - Wolinella
           succinogenes
          Length = 364

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +3

Query: 387 CIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           C+ GH+DV P    +GW  +PF    +   LYGRG+ D K
Sbjct: 62  CLAGHIDVVPP--GEGWSVDPFGAELKEGYLYGRGAQDMK 99


>UniRef50_Q127H2 Cluster: Acetylornithine deacetylase; n=1;
           Polaromonas sp. JS666|Rep: Acetylornithine deacetylase -
           Polaromonas sp. (strain JS666 / ATCC BAA-500)
          Length = 406

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           + K   + + GH DV P +    W+T+PF      ++LYGRG TD K
Sbjct: 79  ETKTGGLVLSGHTDVVP-VDGQPWDTDPFAATIIGDRLYGRGVTDMK 124


>UniRef50_Q0RYX8 Cluster: Probable acetylornithine deacetylase; n=1;
           Rhodococcus sp. RHA1|Rep: Probable acetylornithine
           deacetylase - Rhodococcus sp. (strain RHA1)
          Length = 435

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           ++ + GH+DV PA   D W  +PF   E + +++GRG++D K
Sbjct: 91  SLLLNGHIDVVPAGNLDTWTGDPFVASEVSGRIHGRGASDMK 132


>UniRef50_A5UPI2 Cluster: Peptidase M20 precursor; n=2;
           Roseiflexus|Rep: Peptidase M20 precursor - Roseiflexus
           sp. RS-1
          Length = 448

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           T+ +Y H D         W  +PF+L ER+  +YGRG  D KG
Sbjct: 72  TLLLYHHYDTPSPGPWRAWLHDPFQLAERDGMVYGRGVADGKG 114


>UniRef50_A4GK40 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=2; Bacteria|Rep: Succinyl-diaminopimelate
           desuccinylase - uncultured marine bacterium HF130_81H07
          Length = 378

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 2/76 (2%)
 Frame = +3

Query: 288 LRDVGFQT--IDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDGWETEPFELV 461
           L D+GF++  ID K+V+          ND    T C  GH DV P    + W   PF   
Sbjct: 31  LTDLGFKSERIDYKNVENLYSVYG---NDGP--TFCFLGHTDVVPTGPEELWTHPPFSGK 85

Query: 462 ERNEKLYGRGSTDDKG 509
             + +++GRG+ D KG
Sbjct: 86  NVDGRIFGRGAADMKG 101


>UniRef50_A4AKT2 Cluster: Putative uncharacterized protein; n=3;
           Actinobacteria (class)|Rep: Putative uncharacterized
           protein - marine actinobacterium PHSC20C1
          Length = 443

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 2/86 (2%)
 Frame = +3

Query: 261 LKEVGATTELRDV--GFQTIDGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKSDG 434
           L+++G TT+  D   G  T+  + V+          +  ++  + ++GH DV PA     
Sbjct: 44  LEDMGLTTQYFDAATGRTTVVAR-VEGSYDTETSAPHAKERPALILHGHTDVVPA-DPKN 101

Query: 435 WETEPFELVERNEKLYGRGSTDDKGL 512
           W  +PF  V R+  L+GRG+ D K +
Sbjct: 102 WSVDPFGGVIRDGLLWGRGAVDMKNM 127


>UniRef50_A4ADK2 Cluster: Peptidase M20; n=3; Proteobacteria|Rep:
           Peptidase M20 - Congregibacter litoralis KT71
          Length = 485

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           K  + + GH+DV  AL+ D W   PF+L   +   Y RG+ D+K
Sbjct: 115 KKPILLLGHMDVVEALEKD-WVRPPFKLTRDDVNFYARGTIDNK 157


>UniRef50_Q0W867 Cluster: Putative peptidase (M20 family),
           N-terminal; n=1; uncultured methanogenic archaeon
           RC-I|Rep: Putative peptidase (M20 family), N-terminal -
           Uncultured methanogenic archaeon RC-I
          Length = 115

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRG 491
           T+ +YGH DVQP      W+T PF  V ++  +Y RG
Sbjct: 76  TLLVYGHYDVQPPGPLHAWKTLPFTPVVKDGAIYARG 112


>UniRef50_Q9CLT9 Cluster: Acetylornithine deacetylase; n=98;
           Gammaproteobacteria|Rep: Acetylornithine deacetylase -
           Pasteurella multocida
          Length = 382

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 16/40 (40%), Positives = 23/40 (57%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLY 515
           GH D  P      W+ +PF+L E++ K YG G+ D KG +
Sbjct: 78  GHTDTVP-FDEGRWQFDPFKLTEKDGKFYGLGTADMKGFF 116


>UniRef50_UPI0000E4862E Cluster: PREDICTED: hypothetical protein;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 472

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVE-RNEKLYGRGSTDDK 506
           DP   ++ +  H+DV PA  +D W+ +PFE  +  N  +Y RG+ D K
Sbjct: 74  DPTLKSIILNSHIDVVPA-SADHWKCDPFEAKKMENGDIYARGTQDMK 120


>UniRef50_Q2LTL1 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=1; Syntrophus aciditrophicus SB|Rep:
           Succinyl-diaminopimelate desuccinylase - Syntrophus
           aciditrophicus (strain SB)
          Length = 417

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 14/42 (33%), Positives = 27/42 (64%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           TV I  HLD+ P  +   W+++P+ +  +  ++YGRG+ D++
Sbjct: 92  TVWILTHLDIVPPGELSFWDSDPYRVSVKGRRVYGRGTEDNQ 133


>UniRef50_Q1AT76 Cluster: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase; n=3;
           Bacteria|Rep: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase - Rubrobacter
           xylanophilus (strain DSM 9941 / NBRC 16129)
          Length = 420

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 19/56 (33%), Positives = 26/56 (46%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIR 548
           T+    H DV  A + + WE  PF       ++YGRG+ D KG      I +  IR
Sbjct: 93  TLLFEAHTDVVTAGREEDWEHPPFGAELEGGRIYGRGACDTKGNLAAAVIAARAIR 148


>UniRef50_Q18D47 Cluster: Putative acetylornithine deacetylase; n=2;
           Clostridium difficile|Rep: Putative acetylornithine
           deacetylase - Clostridium difficile (strain 630)
          Length = 420

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           +D    T+   GH+D  P      W+  P+   E N KLYG G+ D K
Sbjct: 96  DDLPGKTIVFNGHVDTMPPGDISKWKYNPYRATEDNGKLYGLGTADMK 143


>UniRef50_Q121P8 Cluster: Peptidase M20; n=17; cellular
           organisms|Rep: Peptidase M20 - Polaromonas sp. (strain
           JS666 / ATCC BAA-500)
          Length = 500

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 2/43 (4%)
 Frame = +3

Query: 381 TVCIYGHLDVQPALKSDGWETE--PFELVERNEKLYGRGSTDD 503
           TV +YGHLD QP  +  GW  +  P+     + KLYGRG  DD
Sbjct: 114 TVLMYGHLDKQP--EFTGWRNDLGPWTPKYEDGKLYGRGGADD 154


>UniRef50_A4B8F1 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=1; Alteromonas macleodii 'Deep ecotype'|Rep:
           Succinyl-diaminopimelate desuccinylase - Alteromonas
           macleodii 'Deep ecotype'
          Length = 390

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 17/37 (45%), Positives = 21/37 (56%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           GH DV P    + W++ PF  V    KLYGRG+ D K
Sbjct: 75  GHTDVVPPGPLEKWKSPPFSPVVSQNKLYGRGAADMK 111


>UniRef50_A0Y199 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=1; Alteromonadales bacterium TW-7|Rep:
           Succinyl-diaminopimelate desuccinylase - Alteromonadales
           bacterium TW-7
          Length = 394

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 20/42 (47%), Positives = 24/42 (57%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           V   GH+DV PA   D W T PF+    N  +YGRG+ D KG
Sbjct: 77  VAFSGHIDVVPADNGD-WLTPPFDGRIINGVIYGRGAADMKG 117


>UniRef50_A0NJH0 Cluster: Dipeptidase 2, peptidase M20 family; n=2;
           Oenococcus oeni|Rep: Dipeptidase 2, peptidase M20 family
           - Oenococcus oeni ATCC BAA-1163
          Length = 497

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 21/45 (46%), Positives = 27/45 (60%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           + TV I  H+DV P  K + W  EPF     +++LYGRGS D KG
Sbjct: 107 RQTVGILIHVDVVPVDK-ELWNYEPFAGTIVDDRLYGRGSDDMKG 150


>UniRef50_A3GGM0 Cluster: Predicted protein; n=5;
           Saccharomycetales|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 600

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKS--DGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPI 545
           K  + +  H DV P  K   D W+  P+E     E LYGRGS D K L L+G + ++ +
Sbjct: 184 KKPILLAAHQDVVPIQKESLDQWDYPPYEGGYDGEWLYGRGSADCKSL-LIGLLETIEL 241


>UniRef50_Q9YAM6 Cluster: Putative uncharacterized protein; n=1;
           Aeropyrum pernix|Rep: Putative uncharacterized protein -
           Aeropyrum pernix
          Length = 441

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 399 HLDVQPALKSDGWE-TEPFELVERNEKLYGRGSTDDK 506
           H DV P     GW  TEPF+ V +  +LYGRG+ DDK
Sbjct: 73  HFDVVPP--GPGWRVTEPFKPVVKGGRLYGRGAADDK 107


>UniRef50_O59017 Cluster: Putative uncharacterized protein PH1289;
           n=1; Pyrococcus horikoshii|Rep: Putative uncharacterized
           protein PH1289 - Pyrococcus horikoshii
          Length = 115

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 22/36 (61%), Positives = 22/36 (61%)
 Frame = -2

Query: 508 PLSSVEPLPYNFSLRSTSSKGSVSHPSDFNAGCTSK 401
           PLSS  PLPY       SSKGSVSH S F  G TSK
Sbjct: 66  PLSSALPLPYALFSLIVSSKGSVSHSSRF-TGTTSK 100


>UniRef50_A3H786 Cluster: Acetylornithine deacetylase or
           succinyl-diaminopimelate desuccinylase; n=1; Caldivirga
           maquilingensis IC-167|Rep: Acetylornithine deacetylase
           or succinyl-diaminopimelate desuccinylase - Caldivirga
           maquilingensis IC-167
          Length = 413

 Score = 38.3 bits (85), Expect = 0.20
 Identities = 19/45 (42%), Positives = 23/45 (51%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           K  + + GH DV P    D W   PF       ++YGRGSTD KG
Sbjct: 66  KPIIILNGHTDVVPPGDPDKWTHPPFSGRVIEGRVYGRGSTDMKG 110


>UniRef50_Q9CC46 Cluster: Possible peptidase; n=41;
           Actinomycetales|Rep: Possible peptidase - Mycobacterium
           leprae
          Length = 467

 Score = 37.9 bits (84), Expect = 0.26
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGL 512
           D  +  + I+GHLDV PA  ++ W   PF       +++GRG+ D K +
Sbjct: 97  DSSRGALLIHGHLDVVPAETAE-WSVHPFSGAVEGGQVWGRGAIDMKDM 144


>UniRef50_Q5YZ79 Cluster: Putative peptidase; n=1; Nocardia
           farcinica|Rep: Putative peptidase - Nocardia farcinica
          Length = 449

 Score = 37.9 bits (84), Expect = 0.26
 Identities = 19/51 (37%), Positives = 28/51 (54%)
 Frame = +3

Query: 366 DPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYL 518
           +P++ +  +  H DV PA   DGW   PF  V  +  ++GRG+ DDK   L
Sbjct: 68  EPERVSAILLAHQDVVPA--GDGWTHPPFAGVVDDGFIWGRGAIDDKSRVL 116


>UniRef50_Q46ST1 Cluster: Peptidase M20A, peptidase V; n=9;
           Burkholderiales|Rep: Peptidase M20A, peptidase V -
           Ralstonia eutropha (strain JMP134) (Alcaligenes
           eutrophus)
          Length = 592

 Score = 37.9 bits (84), Expect = 0.26
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 5/45 (11%)
 Frame = +3

Query: 390 IYGHLDVQPALKSD-----GWETEPFELVERNEKLYGRGSTDDKG 509
           I  H DV PA   D     G + +PF +    ++LYGRG+ DDKG
Sbjct: 181 ILTHADVVPAAAEDWVLDNGTKLDPFSVTRVGDRLYGRGTIDDKG 225


>UniRef50_Q2BDY9 Cluster: Putative uncharacterized protein; n=1;
           Bacillus sp. NRRL B-14911|Rep: Putative uncharacterized
           protein - Bacillus sp. NRRL B-14911
          Length = 479

 Score = 37.9 bits (84), Expect = 0.26
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKS--DGWETEPFELVERNEKLYGRGSTDDK 506
           KN + +  H DV P L    + WE  PF      +K++GRG+ DDK
Sbjct: 104 KNPIGLTSHYDVVPVLSGTENKWEQGPFSGKVEGKKIWGRGTLDDK 149


>UniRef50_Q1GWN2 Cluster: Peptidase M20 precursor; n=3;
           Sphingomonadaceae|Rep: Peptidase M20 precursor -
           Sphingopyxis alaskensis (Sphingomonas alaskensis)
          Length = 457

 Score = 37.9 bits (84), Expect = 0.26
 Identities = 18/44 (40%), Positives = 25/44 (56%)
 Frame = +3

Query: 375 KNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           K  + + GH+DV  A   D W  +PF  VE    ++GRGS D+K
Sbjct: 91  KKPILLLGHMDVVEADPKD-WTRDPFLPVEEEGYIFGRGSEDNK 133


>UniRef50_Q1GRJ2 Cluster: Succinyl-diaminopimelate desuccinylase;
           n=10; Alphaproteobacteria|Rep: Succinyl-diaminopimelate
           desuccinylase - Sphingopyxis alaskensis (Sphingomonas
           alaskensis)
          Length = 377

 Score = 37.9 bits (84), Expect = 0.26
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +3

Query: 396 GHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLY--LVGCIPSMPIRALVLSCL 569
           GHLDV P     GW ++ F    R E LYGRG+ D KG     V    + P+ A  +S +
Sbjct: 74  GHLDVVPP--GVGWTSDAFAPEIRGELLYGRGAVDMKGAIAAFVAAAAATPVDAGTISLI 131


>UniRef50_Q096S1 Cluster: Putative hydrolase; n=1; Stigmatella
           aurantiaca DW4/3-1|Rep: Putative hydrolase - Stigmatella
           aurantiaca DW4/3-1
          Length = 558

 Score = 37.9 bits (84), Expect = 0.26
 Identities = 18/37 (48%), Positives = 22/37 (59%)
 Frame = +3

Query: 399 HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           H DV PA  S+ W  +PF+      KLYGRG +D KG
Sbjct: 143 HADVAPATASE-WRHDPFDPQVMEGKLYGRGVSDGKG 178


>UniRef50_Q5JJ48 Cluster: ArgE/DapE-related deacylase; n=2;
           Thermococcaceae|Rep: ArgE/DapE-related deacylase -
           Pyrococcus kodakaraensis (Thermococcus kodakaraensis)
          Length = 422

 Score = 37.9 bits (84), Expect = 0.26
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 372 KKNTVCIYGHLDVQPALKSDGWE-TEPFELVERNEKLYGRGSTDDKGLYLVGCI 530
           K   + I  HLDV P      W  TEPF+ V ++ K+YGRGS +D G  LV  +
Sbjct: 89  KSPRLWILTHLDVVPPGDLSKWTVTEPFKPVVKDGKVYGRGS-EDNGQSLVASL 141


>UniRef50_Q6F727 Cluster: N-acetylornithine deacetylase; n=1;
           Acinetobacter sp. ADP1|Rep: N-acetylornithine
           deacetylase - Acinetobacter sp. (strain ADP1)
          Length = 379

 Score = 37.5 bits (83), Expect = 0.34
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = +3

Query: 384 VCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSM 539
           + + GH DV P +    W+T  F  V +++ +YGRG+ D KG +L   I +M
Sbjct: 68  ILLSGHSDVVP-VTGQQWDTPAFNAVIKDDHVYGRGTADMKG-FLACAINAM 117


>UniRef50_Q2S0F6 Cluster: Peptidase, M20A family; n=1; Salinibacter
           ruber DSM 13855|Rep: Peptidase, M20A family -
           Salinibacter ruber (strain DSM 13855)
          Length = 361

 Score = 37.5 bits (83), Expect = 0.34
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +3

Query: 378 NTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           +T+ +  HLDV P   SD    +PFE VE +  LYGRG+ D K
Sbjct: 61  DTLLLNSHLDVVPP--SDDHPYDPFEPVETDGVLYGRGAVDAK 101


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 778,951,247
Number of Sequences: 1657284
Number of extensions: 15833875
Number of successful extensions: 41448
Number of sequences better than 10.0: 348
Number of HSP's better than 10.0 without gapping: 39800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41410
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 60911752460
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -