SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20040
         (701 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7KRU8 Cluster: CG2216-PA, isoform A; n=18; Endopterygo...   114   2e-24
UniRef50_UPI0000DB77A5 Cluster: PREDICTED: similar to Ferritin 1...   105   1e-21
UniRef50_Q9U0S2 Cluster: Ferritin subunit (Non-glycosylated) pre...    91   2e-17
UniRef50_P41822 Cluster: Ferritin subunit precursor (EC 1.16.3.1...    80   5e-14
UniRef50_A1C331 Cluster: Ferritin 1-like protein A; n=1; Daphnia...    76   7e-13
UniRef50_Q2TQ28 Cluster: Ferritin heavy chain-1b; n=2; Carcinosc...    63   7e-09
UniRef50_P42578 Cluster: Yolk ferritin precursor; n=1; Lymnaea s...    59   1e-07
UniRef50_Q9VYH1 Cluster: CG4349-PA; n=2; Sophophora|Rep: CG4349-...    58   2e-07
UniRef50_Q26061 Cluster: Ferritin; n=5; Eumetazoa|Rep: Ferritin ...    56   6e-07
UniRef50_P49947 Cluster: Ferritin, middle subunit; n=7; Euteleos...    54   3e-06
UniRef50_P49946 Cluster: Ferritin, heavy subunit; n=21; Vertebra...    53   6e-06
UniRef50_Q9S756 Cluster: Ferritin-4, chloroplast precursor; n=56...    52   1e-05
UniRef50_A7S8I5 Cluster: Predicted protein; n=2; Nematostella ve...    52   2e-05
UniRef50_A7LGB1 Cluster: Ferritin; n=8; Coelomata|Rep: Ferritin ...    50   4e-05
UniRef50_A0K014 Cluster: Ferritin, Dps family protein; n=1; Arth...    50   6e-05
UniRef50_A1UNA8 Cluster: Ferritin, Dps family protein; n=20; Act...    49   1e-04
UniRef50_Q0S9G1 Cluster: Probable ferritin; n=2; Nocardiaceae|Re...    49   1e-04
UniRef50_A7QKU5 Cluster: Chromosome chr8 scaffold_115, whole gen...    49   1e-04
UniRef50_O15972 Cluster: Ferritin subunit; n=2; Mollusca|Rep: Fe...    49   1e-04
UniRef50_UPI0000365A30 Cluster: Homolog of Gallus gallus "Ferrit...    48   2e-04
UniRef50_A5UUE1 Cluster: Ferroxidase; n=4; Bacteria|Rep: Ferroxi...    48   2e-04
UniRef50_UPI0000E4A7A4 Cluster: PREDICTED: similar to ferritin; ...    48   2e-04
UniRef50_Q01DZ9 Cluster: Ferritin; n=1; Ostreococcus tauri|Rep: ...    48   2e-04
UniRef50_Q17PG4 Cluster: Ferritin-precursor, putative; n=1; Aede...    48   2e-04
UniRef50_A1C336 Cluster: Ferritin 3-like protein E; n=3; Daphnia...    48   2e-04
UniRef50_Q95MP7 Cluster: Ferritin heavy chain; n=58; Coelomata|R...    48   2e-04
UniRef50_Q6MCM0 Cluster: Probable ferritin; n=1; Candidatus Prot...    47   4e-04
UniRef50_Q8LRU1 Cluster: Pre-apoferritin; n=1; Chlamydomonas rei...    47   4e-04
UniRef50_A2VCJ5 Cluster: Ferritin; n=1; Clonorchis sinensis|Rep:...    47   5e-04
UniRef50_A1SHK2 Cluster: Ferritin, Dps family protein; n=1; Noca...    46   7e-04
UniRef50_Q5D9N3 Cluster: SJCHGC02278 protein; n=1; Schistosoma j...    46   9e-04
UniRef50_Q2YDI9 Cluster: Ferritin, mitochondrial precursor; n=16...    46   9e-04
UniRef50_Q9XFY2 Cluster: Putative ferritin; n=1; Auxenochlorella...    46   0.001
UniRef50_Q1ASD6 Cluster: Ferritin and Dps; n=1; Rubrobacter xyla...    45   0.002
UniRef50_Q8N4E7 Cluster: Ferritin, mitochondrial precursor; n=91...    44   0.003
UniRef50_UPI0000D55E75 Cluster: PREDICTED: similar to D1037.3; n...    43   0.008
UniRef50_UPI00005A2E21 Cluster: PREDICTED: similar to Ferritin l...    42   0.011
UniRef50_Q2NG12 Cluster: Predicted ferritin; n=1; Methanosphaera...    42   0.015
UniRef50_Q9KDT7 Cluster: Ferritin; n=6; Firmicutes|Rep: Ferritin...    42   0.019
UniRef50_Q8MUW9 Cluster: Ferritin 2; n=3; Cucujiformia|Rep: Ferr...    42   0.019
UniRef50_A0CYK8 Cluster: Chromosome undetermined scaffold_31, wh...    42   0.019
UniRef50_Q81XE2 Cluster: Ferritin; n=14; Bacteria|Rep: Ferritin ...    41   0.026
UniRef50_A4XMZ6 Cluster: Ferritin, Dps family protein; n=2; Clos...    41   0.034
UniRef50_P07798 Cluster: Ferritin, middle subunit; n=16; Sarcopt...    41   0.034
UniRef50_UPI0000F20869 Cluster: PREDICTED: hypothetical protein;...    40   0.045
UniRef50_Q49YT7 Cluster: Ferritin; n=17; Bacillales|Rep: Ferriti...    40   0.045
UniRef50_O83010 Cluster: Ferritin; n=5; Bacteroidales|Rep: Ferri...    40   0.059
UniRef50_Q0IB83 Cluster: Ferritin; n=11; Cyanobacteria|Rep: Ferr...    40   0.059
UniRef50_UPI0000E21C9F Cluster: PREDICTED: similar to FTH1 prote...    40   0.078
UniRef50_Q6AMM6 Cluster: Probable ferritin; n=1; Desulfotalea ps...    40   0.078
UniRef50_Q73QJ4 Cluster: Ferritin, putative; n=1; Treponema dent...    39   0.10 
UniRef50_Q9U0S3 Cluster: Ferritin subunit (Glycosylated) precurs...    38   0.18 
UniRef50_O77232 Cluster: Apoferritin-2; n=1; Schistosoma japonic...    38   0.18 
UniRef50_O29424 Cluster: Ferritin, putative; n=12; cellular orga...    38   0.32 
UniRef50_P28733 Cluster: Ferritin; n=5; Bacteroides|Rep: Ferriti...    37   0.42 
UniRef50_UPI00005860CA Cluster: PREDICTED: similar to snail soma...    37   0.55 
UniRef50_Q9N2P3 Cluster: Ferritin precursor; n=7; Obtectomera|Re...    37   0.55 
UniRef50_A7T946 Cluster: Predicted protein; n=1; Nematostella ve...    37   0.55 
UniRef50_P02792 Cluster: Ferritin light chain; n=102; cellular o...    37   0.55 
UniRef50_Q9BXU8 Cluster: Ferritin heavy polypeptide-like 17; n=3...    37   0.55 
UniRef50_Q67S14 Cluster: Ferritin; n=6; Bacteria|Rep: Ferritin -...    36   0.73 
UniRef50_A4ANB4 Cluster: RsgA; n=3; Flavobacteriales|Rep: RsgA -...    36   0.73 
UniRef50_Q5QBK7 Cluster: Ferritin light chain-like; n=1; Culicoi...    36   0.73 
UniRef50_Q0PKG1 Cluster: Ferritin subunit 1; n=1; Haliotis discu...    36   0.73 
UniRef50_Q4RUA6 Cluster: Chromosome 1 SCAF14995, whole genome sh...    36   1.3  
UniRef50_Q7VC60 Cluster: Ferritin family protein; n=5; Prochloro...    36   1.3  
UniRef50_A0ND34 Cluster: ENSANGP00000030559; n=1; Anopheles gamb...    36   1.3  
UniRef50_Q7SH18 Cluster: Predicted protein; n=1; Neurospora cras...    36   1.3  
UniRef50_P52093 Cluster: Ferritin; n=11; Bacteria|Rep: Ferritin ...    36   1.3  
UniRef50_Q8RB64 Cluster: Ferritin-like protein; n=8; cellular or...    35   1.7  
UniRef50_A6EKF4 Cluster: Ferritin-like protein; n=1; Pedobacter ...    35   1.7  
UniRef50_A5I2Q6 Cluster: Ferritin; n=8; Clostridium|Rep: Ferriti...    35   1.7  
UniRef50_P38874 Cluster: Elongator complex protein 5; n=5; Sacch...    35   1.7  
UniRef50_Q8AYG9 Cluster: Ferritoid; n=1; Gallus gallus|Rep: Ferr...    35   2.2  
UniRef50_A3YZ65 Cluster: Ferritin; n=1; Synechococcus sp. WH 570...    35   2.2  
UniRef50_Q29226 Cluster: Ferritin light chain; n=6; Laurasiather...    35   2.2  
UniRef50_Q9U4U2 Cluster: Ferritin 2 light chain homolog; n=5; Sc...    35   2.2  
UniRef50_A7HD23 Cluster: Ferritin Dps family protein; n=1; Anaer...    34   2.9  
UniRef50_A7CSI5 Cluster: Ferritin Dps family protein; n=1; Opitu...    34   2.9  
UniRef50_Q172H3 Cluster: Secreted ferritin G subunit, putative; ...    34   2.9  
UniRef50_UPI0000DA1EA4 Cluster: PREDICTED: similar to Ferritin l...    34   3.9  
UniRef50_UPI00005548EA Cluster: hypothetical protein PdenDRAFT_1...    34   3.9  
UniRef50_Q8KBP5 Cluster: Ferritin; n=2; Chlorobiaceae|Rep: Ferri...    34   3.9  
UniRef50_UPI00001C63B6 Cluster: PREDICTED: similar to ferritin h...    33   5.1  
UniRef50_Q31JA0 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_Q6NW17 Cluster: Ferritin; n=17; Coelomata|Rep: Ferritin...    33   5.1  
UniRef50_Q9HI00 Cluster: Vng6149h; n=1; Halobacterium salinarum|...    33   5.1  
UniRef50_UPI0000DA3E22 Cluster: PREDICTED: hypothetical protein;...    33   9.0  
UniRef50_A0D7I6 Cluster: Chromosome undetermined scaffold_4, who...    33   9.0  
UniRef50_Q7S840 Cluster: Predicted protein; n=1; Neurospora cras...    33   9.0  

>UniRef50_Q7KRU8 Cluster: CG2216-PA, isoform A; n=18;
           Endopterygota|Rep: CG2216-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 205

 Score =  114 bits (275), Expect = 2e-24
 Identities = 53/80 (66%), Positives = 63/80 (78%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W+ M+  C   MR QIQEE+ AS QYLAMGAYFS DTVNRPGFA+ FF AA EEREH +
Sbjct: 33  DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGS 92

Query: 438 KLIDYLLMRGKLTGSVTDLI 497
           KL++YL MRG+LT  V+DLI
Sbjct: 93  KLVEYLSMRGQLTEGVSDLI 112



 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%)
 Frame = +2

Query: 512 ANTSWESGASALEHALKLESDVTNSIREVIKTCESS-FNDYHLVDYLSGEFLDEQYKG 682
           A   W  GA+AL  AL LE  VT SIR++I+TCE+  +N YHLVDYL+G +L+EQ  G
Sbjct: 118 AKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHG 175


>UniRef50_UPI0000DB77A5 Cluster: PREDICTED: similar to Ferritin 1
           heavy chain homologue CG2216-PE, isoform E; n=1; Apis
           mellifera|Rep: PREDICTED: similar to Ferritin 1 heavy
           chain homologue CG2216-PE, isoform E - Apis mellifera
          Length = 153

 Score =  105 bits (251), Expect = 1e-21
 Identities = 44/90 (48%), Positives = 64/90 (71%)
 Frame = +3

Query: 261 WLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATK 440
           WL M++ C   +  Q+  E+ A++ YLAMGA+F++D +NRPGF+K FF++ATEEREHA K
Sbjct: 42  WLDMDKNCIKSLESQVNVEIKAAMTYLAMGAHFALDVINRPGFSKFFFESATEEREHAIK 101

Query: 441 LIDYLLMRGKLTGSVTDLITYRAPQTRRGR 530
           +++YLLMRG LT    D +  R P +  G+
Sbjct: 102 VLEYLLMRGXLTNINEDNVLLRFPLSSLGK 131


>UniRef50_Q9U0S2 Cluster: Ferritin subunit (Non-glycosylated)
           precursor; n=3; Neoptera|Rep: Ferritin subunit
           (Non-glycosylated) precursor - Nilaparvata lugens (Brown
           planthopper)
          Length = 227

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 44/93 (47%), Positives = 62/93 (66%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           EW TM   C   ++ QI+ E  A++ YL++G +FS D VNRPGFAK FF++A+EER+HA 
Sbjct: 38  EWKTMHSNCTLEVKDQIKMEYNAAMIYLSLGVHFSRDFVNRPGFAKFFFESASEERQHAI 97

Query: 438 KLIDYLLMRGKLTGSVTDLITYRAPQTRRGRAA 536
           KLI+YL MRG+    +  L+    P+T  G A+
Sbjct: 98  KLIEYLSMRGESVTDIAKLVKL-DPETMPGMAS 129



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 9/73 (12%)
 Frame = +2

Query: 491 PHHVQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSF---------NDYHLVD 643
           P  + G A+ S  +G  ALE AL+ E  VTN+I +V+K CE+           NDYHLVD
Sbjct: 121 PETMPGMASVSL-NGKEALEKALQQEVLVTNNILKVMKACENEEVKDAAWTLPNDYHLVD 179

Query: 644 YLSGEFLDEQYKG 682
           +L+ EFLDEQYKG
Sbjct: 180 WLTAEFLDEQYKG 192


>UniRef50_P41822 Cluster: Ferritin subunit precursor (EC 1.16.3.1)
           (Ferritin heavy chain-like protein) (AeFer(H)); n=6;
           Culicidae|Rep: Ferritin subunit precursor (EC 1.16.3.1)
           (Ferritin heavy chain-like protein) (AeFer(H)) - Aedes
           aegypti (Yellowfever mosquito)
          Length = 209

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 36/71 (50%), Positives = 47/71 (66%)
 Frame = +3

Query: 258 EWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHAT 437
           +W +++  C   + +QI +E  ASI YL   AYF+ + +N PGF K FF AA EEREH  
Sbjct: 38  QWDSVDDQCLAALHRQINKEFDASIIYLKYAAYFAQEKINLPGFEKFFFHAAAEEREHGI 97

Query: 438 KLIDYLLMRGK 470
           KLI+Y LMRGK
Sbjct: 98  KLIEYALMRGK 108



 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 33/51 (64%), Positives = 40/51 (78%)
 Frame = +2

Query: 530 SGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYKG 682
           +G SALE AL+ E +VT SIR VIK CE   ND+HL DYL+GE+LDEQ+KG
Sbjct: 128 TGESALETALQKEVEVTRSIRGVIKACEDGSNDFHLADYLTGEYLDEQHKG 178


>UniRef50_A1C331 Cluster: Ferritin 1-like protein A; n=1; Daphnia
           pulex|Rep: Ferritin 1-like protein A - Daphnia pulex
           (Water flea)
          Length = 205

 Score = 76.2 bits (179), Expect = 7e-13
 Identities = 34/63 (53%), Positives = 45/63 (71%)
 Frame = +3

Query: 279 TCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLL 458
           TC N +R  I+ E+ A++ YLAMGA+ +  +V RPG A  FFD+A+EEREH  KL+ YL 
Sbjct: 36  TCLNHLRSHIKRELQAAVTYLAMGAWANHYSVQRPGLANFFFDSASEEREHGLKLLGYLR 95

Query: 459 MRG 467
           MRG
Sbjct: 96  MRG 98



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/53 (50%), Positives = 38/53 (71%)
 Frame = +2

Query: 524 WESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYKG 682
           WE+  SAL  ALK+E DVT SI+++I  C  +  D+ L DYL+G+F++EQ KG
Sbjct: 118 WENSLSALRQALKMEKDVTESIKKIIDYCADA-EDHQLADYLTGDFMEEQLKG 169


>UniRef50_Q2TQ28 Cluster: Ferritin heavy chain-1b; n=2;
           Carcinoscorpius rotundicauda|Rep: Ferritin heavy
           chain-1b - Carcinoscorpius rotundicauda (Southeast Asian
           horseshoe crab)
          Length = 204

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 29/65 (44%), Positives = 42/65 (64%)
 Frame = +3

Query: 270 MEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLID 449
           ++  C N ++ QI EE  AS+ Y+ M ++F  + V R GF+K F  ++ EEREHA KLID
Sbjct: 39  LDNKCINGLQLQINEERHASLVYMHMASHFGSNAVGRKGFSKFFKHSSDEEREHAQKLID 98

Query: 450 YLLMR 464
           Y+  R
Sbjct: 99  YINKR 103



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/58 (37%), Positives = 35/58 (60%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQ 673
           ++ P  T W++G  AL+ AL LE+ V N +  + +  +    D HL+++L GEFL EQ
Sbjct: 112 IKMPGKTIWKNGMEALQDALNLENHVNNKLHHLHQMADKICADPHLMNFLEGEFLTEQ 169


>UniRef50_P42578 Cluster: Yolk ferritin precursor; n=1; Lymnaea
           stagnalis|Rep: Yolk ferritin precursor - Lymnaea
           stagnalis (Great pond snail)
          Length = 239

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/59 (47%), Positives = 39/59 (66%)
 Frame = +3

Query: 291 MMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           ++ +QIQ+E+AAS  Y A  +YF    V+ PG  K F DA++EER+ A  LIDY+  RG
Sbjct: 36  LLEQQIQKELAASYIYQAYASYFQRADVSLPGIKKFFSDASSEERDDAQSLIDYINQRG 94



 Score = 33.1 bits (72), Expect = 6.8
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = +2

Query: 518 TSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQ 673
           + W+ G  A E  L +E  V   + ++ K  +    D HL   L  EFL+EQ
Sbjct: 149 SDWKEGLIAFEDTLAIERYVNAQLLDIHKKADDE-KDAHLTHILEHEFLEEQ 199


>UniRef50_Q9VYH1 Cluster: CG4349-PA; n=2; Sophophora|Rep: CG4349-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 186

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 27/66 (40%), Positives = 39/66 (59%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           ++C   +  QI  E+ AS QYLAM  +F    ++ PG  + F  A+ EEREHA K++ Y+
Sbjct: 22  KSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYM 81

Query: 456 LMRGKL 473
             RG L
Sbjct: 82  NKRGGL 87


>UniRef50_Q26061 Cluster: Ferritin; n=5; Eumetazoa|Rep: Ferritin -
           Pacifastacus leniusculus (Signal crayfish)
          Length = 181

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 27/58 (46%), Positives = 36/58 (62%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + KQI  E  AS  Y++MG YF  D ++ PG +K F D++ EEREH  KL+ Y   RG
Sbjct: 16  INKQINLEFYASYVYMSMGHYFDRDDISLPGASKFFKDSSDEEREHGQKLMKYQNKRG 73



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/58 (39%), Positives = 34/58 (58%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQ 673
           +  P+   W +   AL+ AL LE++V  S+ ++  T  S  ND HL + L GEFL+EQ
Sbjct: 81  IAAPSLQEWGNLHDALQAALDLENEVNQSLLDLDATA-SKINDPHLTNMLEGEFLEEQ 137


>UniRef50_P49947 Cluster: Ferritin, middle subunit; n=7;
           Euteleostomi|Rep: Ferritin, middle subunit - Salmo salar
           (Atlantic salmon)
          Length = 176

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 27/62 (43%), Positives = 35/62 (56%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   + + I  E+ AS  Y +M  YFS D V  PGFA  F + + EEREHA KL+ +   
Sbjct: 13  CERAINRMINMEMFASYTYTSMAFYFSRDDVALPGFAHFFKENSEEEREHADKLLSFQNK 72

Query: 462 RG 467
           RG
Sbjct: 73  RG 74


>UniRef50_P49946 Cluster: Ferritin, heavy subunit; n=21;
           Vertebrata|Rep: Ferritin, heavy subunit - Salmo salar
           (Atlantic salmon)
          Length = 177

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 25/60 (41%), Positives = 35/60 (58%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           V+ P    W SG  ALE +L+LE  V  S+ ++ K C S  ND H+ D++   +LDEQ K
Sbjct: 82  VKKPEKDEWGSGVEALESSLQLEKSVNQSLLDLHKVC-SEHNDPHMCDFIETHYLDEQVK 140



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/64 (42%), Positives = 34/64 (53%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           Q C   + +QI  E+ AS  YL+M  YF  D      FAK F + + EEREHA KL+   
Sbjct: 11  QDCEAAINRQINLELYASYVYLSMAYYFDRDDQALHNFAKFFKNQSHEEREHAEKLMKVQ 70

Query: 456 LMRG 467
             RG
Sbjct: 71  NQRG 74


>UniRef50_Q9S756 Cluster: Ferritin-4, chloroplast precursor; n=56;
           Eukaryota|Rep: Ferritin-4, chloroplast precursor -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 259

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 27/62 (43%), Positives = 35/62 (56%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   + +QI  E   S  Y AM AYF  D +   G AK F +++ EEREHA KL++Y   
Sbjct: 97  CEAAINEQINVEYNVSYVYHAMYAYFDRDNIALKGLAKFFKESSLEEREHAEKLMEYQNK 156

Query: 462 RG 467
           RG
Sbjct: 157 RG 158


>UniRef50_A7S8I5 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 248

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/69 (37%), Positives = 36/69 (52%)
 Frame = +3

Query: 261 WLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATK 440
           W+         + KQI  E+ A   YL+M A+F  D ++ PGFA  F  AA EE  HA  
Sbjct: 82  WIWANNDIEAGINKQINRELFAHYTYLSMAAHFGRDDIHLPGFAAFFKKAAEEEYTHAHM 141

Query: 441 LIDYLLMRG 467
            +++L  RG
Sbjct: 142 FMEFLNKRG 150


>UniRef50_A7LGB1 Cluster: Ferritin; n=8; Coelomata|Rep: Ferritin -
           Holothuria glaberrima
          Length = 174

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 26/58 (44%), Positives = 34/58 (58%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  Y++M  YF  D V  PG  K F  A+ EEREHA KL+ +   RG
Sbjct: 18  VNRQINMELYASYVYMSMAYYFDRDDVALPGAHKYFKKASEEEREHAEKLMKFQNQRG 75


>UniRef50_A0K014 Cluster: Ferritin, Dps family protein; n=1;
           Arthrobacter sp. FB24|Rep: Ferritin, Dps family protein
           - Arthrobacter sp. (strain FB24)
          Length = 196

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 26/63 (41%), Positives = 39/63 (61%)
 Frame = +3

Query: 279 TCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLL 458
           T  +++ KQ+  E AAS QY+A+ A+F  D  + P  AK F+  + EER HA  ++ Y+L
Sbjct: 5   TFNDLLAKQVGNEFAASQQYIAIAAWF--DGQDLPRLAKHFYRQSLEERNHAMMMVRYIL 62

Query: 459 MRG 467
            RG
Sbjct: 63  DRG 65


>UniRef50_A1UNA8 Cluster: Ferritin, Dps family protein; n=20;
           Actinobacteria (class)|Rep: Ferritin, Dps family protein
           - Mycobacterium sp. (strain KMS)
          Length = 181

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/60 (38%), Positives = 37/60 (61%)
 Frame = +3

Query: 285 YNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMR 464
           + ++++QI+ E  A+ QY+A+  YF  D  + P  AK F+  + EER HA  L+ YL+ R
Sbjct: 12  HGLLQEQIRSEFTAAQQYIAIAVYF--DGADLPQLAKHFYGQSVEERNHAMMLVQYLIDR 69


>UniRef50_Q0S9G1 Cluster: Probable ferritin; n=2; Nocardiaceae|Rep:
           Probable ferritin - Rhodococcus sp. (strain RHA1)
          Length = 192

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 6/80 (7%)
 Frame = +3

Query: 291 MMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLL---M 461
           ++++QI+ E  AS QY+A+  YF  D+ + P  A+ F+  A EER HA  +I YL+   +
Sbjct: 24  LLQQQIRNEFTASQQYIAVAVYF--DSHDLPQLARRFYSQAAEERGHALMMIQYLIDNNL 81

Query: 462 RGKLTG---SVTDLITYRAP 512
           R  + G    VTD  + R P
Sbjct: 82  RVTVPGIDDVVTDFDSVRGP 101


>UniRef50_A7QKU5 Cluster: Chromosome chr8 scaffold_115, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_115, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 328

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/64 (37%), Positives = 36/64 (56%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           + C   + +QI  +   S  Y +M AYF  D +   G AK F +++ EER+HA KL++Y 
Sbjct: 165 EECEAAINEQINVKYNVSYVYHSMFAYFDRDNIALTGLAKFFKESSEEERQHAEKLMEYQ 224

Query: 456 LMRG 467
             RG
Sbjct: 225 NKRG 228


>UniRef50_O15972 Cluster: Ferritin subunit; n=2; Mollusca|Rep:
           Ferritin subunit - Liolophura japonica (Acanthopleura
           japonica)
          Length = 223

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/58 (43%), Positives = 33/58 (56%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           M  QI  E+ AS  Y     YF  D V   GFA  F  A++EE++HA KL++Y+  RG
Sbjct: 35  MNDQINLELHASYLYHGYARYFDRDDVALSGFADFFKHASSEEKDHADKLMEYMNTRG 92


>UniRef50_UPI0000365A30 Cluster: Homolog of Gallus gallus "Ferritin
           heavy chain (Ferritin H subunit).; n=1; Takifugu
           rubripes|Rep: Homolog of Gallus gallus "Ferritin heavy
           chain (Ferritin H subunit). - Takifugu rubripes
          Length = 174

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/48 (43%), Positives = 31/48 (64%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YLA+G YF  D V  P F++ F + + +ER+ A KL++Y  +RG
Sbjct: 27  ASYTYLALGMYFDRDDVALPNFSRFFLERSVKERDQAEKLLEYQNVRG 74


>UniRef50_A5UUE1 Cluster: Ferroxidase; n=4; Bacteria|Rep:
           Ferroxidase - Roseiflexus sp. RS-1
          Length = 167

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/66 (39%), Positives = 39/66 (59%)
 Frame = +3

Query: 270 MEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLID 449
           + ++    + KQI  E +AS  Y+AM AYF  ++++  GFA  F   + EEREHA +  D
Sbjct: 2   LSESIQQAINKQITYEFSASHAYMAMAAYF--ESLSLTGFAHWFRLQSEEEREHALRFFD 59

Query: 450 YLLMRG 467
           Y+  RG
Sbjct: 60  YVNDRG 65


>UniRef50_UPI0000E4A7A4 Cluster: PREDICTED: similar to ferritin;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to ferritin - Strongylocentrotus purpuratus
          Length = 167

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 30/82 (36%), Positives = 42/82 (51%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKL 473
           + +QI  E+ AS  YL+M  YF  D V      K F  A+ EER+HA KL+ +   RG  
Sbjct: 17  VNRQINLELYASYTYLSMAFYFDRDDVALKNIHKYFLKASDEERDHAQKLMTFQNQRG-- 74

Query: 474 TGSVTDLITYRAPQTRRGRAAH 539
            GS+      +AP   +  +AH
Sbjct: 75  -GSIV-FQDIKAPHKTQWSSAH 94


>UniRef50_Q01DZ9 Cluster: Ferritin; n=1; Ostreococcus tauri|Rep:
           Ferritin - Ostreococcus tauri
          Length = 242

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 26/62 (41%), Positives = 33/62 (53%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   +  QI  E   S  Y AM A+F  D V   GFA  F   A EER HA +L++Y+ +
Sbjct: 76  CERALNAQINVEYNVSYIYHAMWAFFERDNVALKGFADHFKAEALEERSHAEQLMEYVNL 135

Query: 462 RG 467
           RG
Sbjct: 136 RG 137


>UniRef50_Q17PG4 Cluster: Ferritin-precursor, putative; n=1; Aedes
           aegypti|Rep: Ferritin-precursor, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 209

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/59 (40%), Positives = 34/59 (57%)
 Frame = +3

Query: 288 NMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMR 464
           N + +QI  E+AA   YL+M  +F+  TV   GF+K +   + EE  HA  L +YLL R
Sbjct: 50  NAINEQINVELAAGYTYLSMSFHFAKSTVGLIGFSKFYCTMSKEELGHARSLAEYLLKR 108


>UniRef50_A1C336 Cluster: Ferritin 3-like protein E; n=3; Daphnia
           pulex|Rep: Ferritin 3-like protein E - Daphnia pulex
           (Water flea)
          Length = 171

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/59 (42%), Positives = 34/59 (57%)
 Frame = +3

Query: 291 MMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           ++ KQI  E +   QYLA+ A++  D V   GF+K F ++A EE  H  KLI Y   RG
Sbjct: 16  LVNKQINIEQSLYYQYLALSAFYDRDDVAMIGFSKYFQESAEEEGGHVRKLIKYQNRRG 74


>UniRef50_Q95MP7 Cluster: Ferritin heavy chain; n=58; Coelomata|Rep:
           Ferritin heavy chain - Canis familiaris (Dog)
          Length = 183

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>UniRef50_Q6MCM0 Cluster: Probable ferritin; n=1; Candidatus
           Protochlamydia amoebophila UWE25|Rep: Probable ferritin
           - Protochlamydia amoebophila (strain UWE25)
          Length = 162

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/65 (36%), Positives = 35/65 (53%)
 Frame = +3

Query: 270 MEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLID 449
           M    Y  + +QI+ E  +S  YL++ +YF  D +   GFAK F   A EE EH  K  +
Sbjct: 1   MNDKIYTALNEQIKHEFYSSYLYLSIASYF--DNIPLDGFAKWFRKQAEEEHEHGMKFYN 58

Query: 450 YLLMR 464
           Y++ R
Sbjct: 59  YIIDR 63


>UniRef50_Q8LRU1 Cluster: Pre-apoferritin; n=1; Chlamydomonas
           reinhardtii|Rep: Pre-apoferritin - Chlamydomonas
           reinhardtii
          Length = 249

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 25/62 (40%), Positives = 32/62 (51%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   + +Q+  E   S  Y A+ AYF  D V  PG A  F   + EEREHA  L++Y   
Sbjct: 80  CEAAINEQVNIEYNVSYLYHALWAYFDRDNVALPGLAAFFKAGSEEEREHAELLMEYQNR 139

Query: 462 RG 467
           RG
Sbjct: 140 RG 141


>UniRef50_A2VCJ5 Cluster: Ferritin; n=1; Clonorchis sinensis|Rep:
           Ferritin - Clonorchis sinensis
          Length = 168

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 24/62 (38%), Positives = 31/62 (50%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   + KQI  E+ AS  Y A  +++  DTV  P  A+ F   + EE EHA K   Y   
Sbjct: 8   CEAAINKQINMELEASYAYFAFASFYDQDTVALPNVAEFFRKMSHEETEHAKKFAHYQNQ 67

Query: 462 RG 467
           RG
Sbjct: 68  RG 69


>UniRef50_A1SHK2 Cluster: Ferritin, Dps family protein; n=1;
           Nocardioides sp. JS614|Rep: Ferritin, Dps family protein
           - Nocardioides sp. (strain BAA-499 / JS614)
          Length = 174

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/57 (42%), Positives = 31/57 (54%)
 Frame = +3

Query: 288 NMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLL 458
           + +  QI  E+AA  QYLA   Y+  D +  P  A  F+  A EER HA  +I YLL
Sbjct: 8   DQLNAQIGNELAAHNQYLACAVYY--DALTMPRMAAFFYAQAVEERAHAAMMIQYLL 62


>UniRef50_Q5D9N3 Cluster: SJCHGC02278 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC02278 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 135

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 315 EVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           E+ AS  Y+ M  +F  D V   GF K F + + EER+HA KL+ Y  MRG
Sbjct: 2   ELYASYVYMTMAFHFHRDDVALNGFYKFFLNESEEERQHAIKLMTYQNMRG 52


>UniRef50_Q2YDI9 Cluster: Ferritin, mitochondrial precursor; n=16;
           Sarcopterygii|Rep: Ferritin, mitochondrial precursor -
           Bos taurus (Bovine)
          Length = 242

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 26/60 (43%), Positives = 33/60 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKL 473
           + +QI  E+ AS  YL+M  YFS D V    FA+ F   + EE EHA KL+     RG L
Sbjct: 80  INRQINLELYASYVYLSMAYYFSRDDVALHNFARYFLRLSREEAEHAEKLMRLQNQRGGL 139


>UniRef50_Q9XFY2 Cluster: Putative ferritin; n=1; Auxenochlorella
           protothecoides|Rep: Putative ferritin - Chlorella
           protothecoides (Green microalga)
           (Auxenochlorellaprotothecoides)
          Length = 256

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/77 (33%), Positives = 37/77 (48%)
 Frame = +3

Query: 237 QPRHHQDEWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAAT 416
           +P H    + T  +T    + +QI  E   S  Y A+  YF  D V+  G A+ F + + 
Sbjct: 67  RPEHSFARYSTWTETVEAAVNEQINVEYNISYVYHAISTYFDRDNVSLHGIAEYFRNESE 126

Query: 417 EEREHATKLIDYLLMRG 467
           EE+ HA  LID    RG
Sbjct: 127 EEKSHAQYLIDLQNTRG 143


>UniRef50_Q1ASD6 Cluster: Ferritin and Dps; n=1; Rubrobacter
           xylanophilus DSM 9941|Rep: Ferritin and Dps -
           Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)
          Length = 168

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = +3

Query: 270 MEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLID 449
           M+    + + +Q+  E  A+  YL+M   F +   N PGFA    + + EE EHA K  D
Sbjct: 9   MKTAVRDAIEEQVGREFYAAYLYLSMAGSFEV--ANLPGFAHWMREQSKEELEHAMKFFD 66

Query: 450 YLLMRGK 470
           +LL RG+
Sbjct: 67  FLLDRGE 73


>UniRef50_Q8N4E7 Cluster: Ferritin, mitochondrial precursor; n=91;
           Metazoa|Rep: Ferritin, mitochondrial precursor - Homo
           sapiens (Human)
          Length = 242

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/58 (41%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YFS D V    F++ F   + EE EHA KL+     RG
Sbjct: 80  INRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRG 137


>UniRef50_UPI0000D55E75 Cluster: PREDICTED: similar to D1037.3; n=1;
           Tribolium castaneum|Rep: PREDICTED: similar to D1037.3 -
           Tribolium castaneum
          Length = 242

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 303 QIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           QI  E+ AS+ YL+M  Y+    +  PG    F     EE++HA + I Y LMRG
Sbjct: 74  QILSELNASMVYLSMFCYYGRTDIALPGCQSYFRAMYQEEQDHALEFIQYQLMRG 128


>UniRef50_UPI00005A2E21 Cluster: PREDICTED: similar to Ferritin
           light chain 1 (Ferritin L subunit 1); n=3; Eutheria|Rep:
           PREDICTED: similar to Ferritin light chain 1 (Ferritin L
           subunit 1) - Canis familiaris
          Length = 328

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = +2

Query: 461 EGKADRLRNRPHHVQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFN-DYHL 637
           E  A  + +    VQ P+   W     A+E AL LE  +  ++ +    C  S + D HL
Sbjct: 220 EENAAAVPSSSQDVQKPSQDEWGKTLDAMEAALLLEKSLNQALLDSGSACLGSAHMDPHL 279

Query: 638 VDYLSGEFLDEQYK 679
            D+L   FLDE+ K
Sbjct: 280 CDFLENHFLDEEVK 293


>UniRef50_Q2NG12 Cluster: Predicted ferritin; n=1; Methanosphaera
           stadtmanae DSM 3091|Rep: Predicted ferritin -
           Methanosphaera stadtmanae (strain DSM 3091)
          Length = 168

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 21/58 (36%), Positives = 31/58 (53%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           +  Q+  E+A+   YL+M  YF  +  + PGF       A EE +HA K  DY+L +G
Sbjct: 10  LNDQLNAEMASGYLYLSMATYF--EDKDLPGFGNALRVHAQEELDHAMKFYDYILRKG 65


>UniRef50_Q9KDT7 Cluster: Ferritin; n=6; Firmicutes|Rep: Ferritin -
           Bacillus halodurans
          Length = 169

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 22/59 (37%), Positives = 34/59 (57%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGK 470
           + KQ+  E+ A+  YLAM AY S ++++  GFA  F   A EER H  K  +++   G+
Sbjct: 10  LNKQMNYEMYAAHSYLAMAAYCSAESLD--GFANFFMVQAEEERFHGMKFYNFINAMGE 66


>UniRef50_Q8MUW9 Cluster: Ferritin 2; n=3; Cucujiformia|Rep:
           Ferritin 2 - Apriona germari
          Length = 224

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           ++K + +    S  YL M  +F     NRPGF KLF   + +  E   +LI Y+  RG
Sbjct: 60  LQKFVNDHFTLSFHYLLMATHFDNYNKNRPGFEKLFRGLSDDTWEDGIELIKYITKRG 117


>UniRef50_A0CYK8 Cluster: Chromosome undetermined scaffold_31, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_31,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 183

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 21/60 (35%), Positives = 33/60 (55%)
 Frame = +3

Query: 288 NMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           N++ +Q   E+ +S  YL    +F  D  N  G  K F   + EER+H+ ++ DYL +RG
Sbjct: 14  NLLSRQAHVELQSSFLYLQYAYWF--DNNNFEGIGKFFKAESEEERKHSVQIFDYLNVRG 71


>UniRef50_Q81XE2 Cluster: Ferritin; n=14; Bacteria|Rep: Ferritin -
           Bacillus anthracis
          Length = 168

 Score = 41.1 bits (92), Expect = 0.026
 Identities = 22/67 (32%), Positives = 38/67 (56%)
 Frame = +3

Query: 270 MEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLID 449
           + +  ++ +  Q+  E  ++  Y+AM AY + ++ +  GFA  F   A EER HA KL +
Sbjct: 2   LSKKLHDALNDQMNFEFYSAHAYMAMAAYCTAESYD--GFANFFLVQAEEERFHAMKLYN 59

Query: 450 YLLMRGK 470
           Y+  RG+
Sbjct: 60  YINDRGE 66


>UniRef50_A4XMZ6 Cluster: Ferritin, Dps family protein; n=2;
           Clostridiales|Rep: Ferritin, Dps family protein -
           Caldicellulosiruptor saccharolyticus (strain ATCC 43494
           / DSM 8903)
          Length = 172

 Score = 40.7 bits (91), Expect = 0.034
 Identities = 21/60 (35%), Positives = 34/60 (56%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           Q   +M+ +Q+ +E+ ++  Y AM AYFS  + N  GFA  F     EE +HA  + +Y+
Sbjct: 4   QKIIDMLNEQLNKELFSAYFYTAMEAYFS--SQNLDGFAHFFMVQTKEELDHARLIFNYI 61


>UniRef50_P07798 Cluster: Ferritin, middle subunit; n=16;
           Sarcopterygii|Rep: Ferritin, middle subunit - Rana
           catesbeiana (Bull frog)
          Length = 176

 Score = 40.7 bits (91), Expect = 0.034
 Identities = 22/62 (35%), Positives = 32/62 (51%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   + + +  E+ AS  Y +M A+F  D V     A+ F + + EEREHA K + Y   
Sbjct: 13  CEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNK 72

Query: 462 RG 467
           RG
Sbjct: 73  RG 74



 Score = 39.5 bits (88), Expect = 0.078
 Identities = 19/60 (31%), Positives = 32/60 (53%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ P    W +   A++ AL+LE  V  ++ ++ K       D HL D+L  E+L+EQ K
Sbjct: 82  IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKV-DPHLCDFLESEYLEEQVK 140


>UniRef50_UPI0000F20869 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 207

 Score = 40.3 bits (90), Expect = 0.045
 Identities = 19/38 (50%), Positives = 23/38 (60%)
 Frame = +3

Query: 354 YFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           YF  D V  PGFAK F   + EEREHA K +++   RG
Sbjct: 70  YFKRDDVALPGFAKFFNKNSEEEREHAEKFMEFQNKRG 107



 Score = 39.5 bits (88), Expect = 0.078
 Identities = 19/58 (32%), Positives = 33/58 (56%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQ 673
           ++ P    W +G  A++ AL+LE +V  ++ ++ K   +   D HL D+L   +LDEQ
Sbjct: 115 IKKPDRDVWGNGLIAIQCALQLEKNVNQALLDLHKLA-TEMGDPHLCDFLETHYLDEQ 171


>UniRef50_Q49YT7 Cluster: Ferritin; n=17; Bacillales|Rep: Ferritin -
           Staphylococcus saprophyticus subsp. saprophyticus
           (strain ATCC 15305 /DSM 20229)
          Length = 167

 Score = 40.3 bits (90), Expect = 0.045
 Identities = 21/59 (35%), Positives = 32/59 (54%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGK 470
           + +Q+  E  A+  Y+AM A+   D  +  GFA  +   A EER H  K+ DY+  RG+
Sbjct: 10  LNEQMNHEFYAAHAYMAMAAF--CDDNSYEGFANFYIQQAKEERFHGKKIYDYINDRGE 66


>UniRef50_O83010 Cluster: Ferritin; n=5; Bacteroidales|Rep: Ferritin
           - Porphyromonas gingivalis (Bacteroides gingivalis)
          Length = 160

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 23/55 (41%), Positives = 32/55 (58%)
 Frame = +3

Query: 303 QIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           QI+ E+ +S  YL+M  +F+   V   GFA      + EE EHA  ++DYLL RG
Sbjct: 14  QIKAEMWSSNLYLSMSVHFA--QVGYNGFAHWLKKQSLEEMEHAYDMMDYLLKRG 66


>UniRef50_Q0IB83 Cluster: Ferritin; n=11; Cyanobacteria|Rep:
           Ferritin - Synechococcus sp. (strain CC9311)
          Length = 195

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 25/83 (30%), Positives = 40/83 (48%)
 Frame = +3

Query: 267 TMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLI 446
           TM Q     ++  +  E  +S  Y A   +F+   +   GFA+   +   +E+EHA K  
Sbjct: 26  TMTQEMVEQLQAHLNLERQSSAAYFAAAIWFAERELT--GFAEYLRNEGKQEQEHAAKFA 83

Query: 447 DYLLMRGKLTGSVTDLITYRAPQ 515
           DYL+ RG+      +L T  AP+
Sbjct: 84  DYLISRGQ----TVELDTIEAPR 102


>UniRef50_UPI0000E21C9F Cluster: PREDICTED: similar to FTH1 protein;
           n=1; Pan troglodytes|Rep: PREDICTED: similar to FTH1
           protein - Pan troglodytes
          Length = 250

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 24/55 (43%), Positives = 28/55 (50%)
 Frame = +3

Query: 303 QIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           QI  E+ AS  YL+M   F  D V    FA  F   + EEREHA KL+     RG
Sbjct: 127 QINLELYASYVYLSMSHNFDRDDVALRNFATYFLHQSHEEREHAEKLMKLQNHRG 181


>UniRef50_Q6AMM6 Cluster: Probable ferritin; n=1; Desulfotalea
           psychrophila|Rep: Probable ferritin - Desulfotalea
           psychrophila
          Length = 169

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 27/72 (37%), Positives = 39/72 (54%)
 Frame = +3

Query: 303 QIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKLTGS 482
           QI  E  +S  YL+M A+  + + N  GF+      A EE  HATK+ DY++ RG   G 
Sbjct: 13  QINAEFFSSYLYLSMSAW--LGSKNLTGFSSWMRAQAQEELFHATKMYDYVIERG---GE 67

Query: 483 VTDLITYRAPQT 518
           V +L T   P++
Sbjct: 68  V-ELFTIEQPKS 78


>UniRef50_Q73QJ4 Cluster: Ferritin, putative; n=1; Treponema
           denticola|Rep: Ferritin, putative - Treponema denticola
          Length = 160

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 21/66 (31%), Positives = 33/66 (50%)
 Frame = +3

Query: 270 MEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLID 449
           M +     + +QI +E+ ++  YL M  +F  + +   GFA    + A EE EHA K+  
Sbjct: 1   MNEKITKALNEQINKEMESAYLYLGMAVHFETEALT--GFAHWMQEQAKEEMEHALKIYR 58

Query: 450 YLLMRG 467
           YL   G
Sbjct: 59  YLFEIG 64


>UniRef50_Q9U0S3 Cluster: Ferritin subunit (Glycosylated) precursor;
           n=1; Nilaparvata lugens|Rep: Ferritin subunit
           (Glycosylated) precursor - Nilaparvata lugens (Brown
           planthopper)
          Length = 236

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 18/58 (31%), Positives = 31/58 (53%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           +++ +  ++  S Q+L M   F     NRPGF KL+   A +  E + +L+ Y+  RG
Sbjct: 60  LQQFVVTQIEQSFQFLTMATKFGNYKSNRPGFEKLYRGLADKSWEESIELMKYITSRG 117


>UniRef50_O77232 Cluster: Apoferritin-2; n=1; Schistosoma
           japonicum|Rep: Apoferritin-2 - Schistosoma japonicum
           (Blood fluke)
          Length = 192

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 22/57 (38%), Positives = 28/57 (49%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMR 464
           +  QI  E  A   Y  M +Y S   V   GFAK F + A EE EHA K  +++  R
Sbjct: 41  LNDQILYEYEAFYIYDHMASYLSRPEVGLSGFAKFFRECANEELEHARKFSEFVNKR 97


>UniRef50_O29424 Cluster: Ferritin, putative; n=12; cellular
           organisms|Rep: Ferritin, putative - Archaeoglobus
           fulgidus
          Length = 173

 Score = 37.5 bits (83), Expect = 0.32
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ ++  YL+M +YF  D++   GF+        EE  HA K+ D++  RG
Sbjct: 12  LNRQINAEIYSAYLYLSMASYF--DSIGLKGFSNWMRVQWQEELMHAMKMFDFVSERG 67


>UniRef50_P28733 Cluster: Ferritin; n=5; Bacteroides|Rep: Ferritin -
           Bacteroides fragilis
          Length = 159

 Score = 37.1 bits (82), Expect = 0.42
 Identities = 21/60 (35%), Positives = 32/60 (53%)
 Frame = +3

Query: 288 NMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           N + +QI  E+ +S  YL+M  YF  +  +  GFA      + EE  HA  + DY++ RG
Sbjct: 8   NAINEQISAEMWSSNLYLSMSFYFEREGFS--GFAHWMKKQSQEEMGHAYAMADYIIKRG 65


>UniRef50_UPI00005860CA Cluster: PREDICTED: similar to snail soma
           ferritin; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to snail soma ferritin -
           Strongylocentrotus purpuratus
          Length = 176

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 20/62 (32%), Positives = 28/62 (45%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   + K I  ++ +S  YLAM  +F    V   GF   F   +  +R HA  L+ Y   
Sbjct: 15  CEAAINKTINHQLTSSYSYLAMAFHFDRADVALKGFQNYFEAMSDSKRSHAMMLLKYQNE 74

Query: 462 RG 467
           RG
Sbjct: 75  RG 76


>UniRef50_Q9N2P3 Cluster: Ferritin precursor; n=7; Obtectomera|Rep:
           Ferritin precursor - Manduca sexta (Tobacco hawkmoth)
           (Tobacco hornworm)
          Length = 232

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +3

Query: 327 SIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           S +YL   +YF+    NR GF+KLF   + +  E    LI ++ MRG
Sbjct: 71  SYEYLLSSSYFNNYQTNRAGFSKLFRKLSDDAWEKTIDLIKHITMRG 117


>UniRef50_A7T946 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 277

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 29/69 (42%), Positives = 34/69 (49%), Gaps = 2/69 (2%)
 Frame = +1

Query: 487 PTSSRTGPRKHVVGERR--ISPRARPQAGE*RHQQHPGGHQDLREQLQRLPPGRLFVRGI 660
           P   R GPR+H  G RR    PR R Q G  RHQ+ P  HQ+   + Q  P  R    G 
Sbjct: 83  PRRHREGPRRHQEGPRRHQEGPR-RHQEGPRRHQEGPRRHQEGPRRHQEGP--RRHQEG- 138

Query: 661 PRRTVQGQR 687
           PRR  +G R
Sbjct: 139 PRRHRKGPR 147



 Score = 33.9 bits (74), Expect = 3.9
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 2/69 (2%)
 Frame = +1

Query: 487 PTSSRTGPRKHVVGER--RISPRARPQAGE*RHQQHPGGHQDLREQLQRLPPGRLFVRGI 660
           P   R GPR+H  G R  R  PR R + G  RH++ P  HQ+   + Q  P  R    G 
Sbjct: 55  PRRHREGPRRHREGPRRHREGPR-RHREGPRRHREGPRRHQEGPRRHQEGP--RRHQEG- 110

Query: 661 PRRTVQGQR 687
           PRR  +G R
Sbjct: 111 PRRHQEGPR 119


>UniRef50_P02792 Cluster: Ferritin light chain; n=102; cellular
           organisms|Rep: Ferritin light chain - Homo sapiens
           (Human)
          Length = 175

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 5.1
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>UniRef50_Q9BXU8 Cluster: Ferritin heavy polypeptide-like 17; n=3;
           Catarrhini|Rep: Ferritin heavy polypeptide-like 17 -
           Homo sapiens (Human)
          Length = 183

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +3

Query: 273 EQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDY 452
           +  C   +   I  E+  S  YL+M  YF+ D V    F + F   + ++ EHA KL+  
Sbjct: 14  DTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRL 73

Query: 453 LLMRG 467
             +RG
Sbjct: 74  QNLRG 78


>UniRef50_Q67S14 Cluster: Ferritin; n=6; Bacteria|Rep: Ferritin -
           Symbiobacterium thermophilum
          Length = 161

 Score = 36.3 bits (80), Expect = 0.73
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI+ E+ ++  YL M AY   ++ N PG A      A EE EHA K+  ++  RG
Sbjct: 9   LNEQIKLELHSAYTYLGMAAY--CESTNLPGMAHWLELQAKEELEHAMKIYGHVNDRG 64


>UniRef50_A4ANB4 Cluster: RsgA; n=3; Flavobacteriales|Rep: RsgA -
           Flavobacteriales bacterium HTCC2170
          Length = 173

 Score = 36.3 bits (80), Expect = 0.73
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           +  QIQ E  +S  YL+M ++  +  +   G A   +D + EER H  KLI ++  RG
Sbjct: 10  LNTQIQIEAESSQVYLSMASWAEVKGLE--GIATFMYDQSDEERMHMLKLIKFVNERG 65


>UniRef50_Q5QBK7 Cluster: Ferritin light chain-like; n=1; Culicoides
           sonorensis|Rep: Ferritin light chain-like - Culicoides
           sonorensis
          Length = 236

 Score = 36.3 bits (80), Expect = 0.73
 Identities = 16/52 (30%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 EEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           +++ AS  +L +   F   T +RPGF KL+   + +  E A +++ Y+  RG
Sbjct: 64  DQIVASYDHLLLSVNFDTYTKDRPGFEKLYRGLSDKAWEKAVEVLKYVAKRG 115


>UniRef50_Q0PKG1 Cluster: Ferritin subunit 1; n=1; Haliotis discus
           discus|Rep: Ferritin subunit 1 - Haliotis discus discus
          Length = 207

 Score = 36.3 bits (80), Expect = 0.73
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +2

Query: 518 TSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLD 667
           T W  G  A+E+AL +E D+    + ++KT   + ND H+  +L   FL+
Sbjct: 125 TVWRDGLKAMEYALGMEKDLN---KNMLKTHTVASNDPHVTHFLEDRFLE 171



 Score = 35.9 bits (79), Expect = 0.96
 Identities = 18/60 (30%), Positives = 30/60 (50%)
 Frame = +3

Query: 288 NMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           N +  ++   + AS  YL+M  +F    +  PGF K F  A+ + R  A  ++ Y+  RG
Sbjct: 53  NELNDRLNGSLVASYVYLSMAYWFDRADMALPGFHKYFLAASHKARNEAEAIMKYINRRG 112


>UniRef50_Q4RUA6 Cluster: Chromosome 1 SCAF14995, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 1 SCAF14995, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 424

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 24/66 (36%), Positives = 28/66 (42%), Gaps = 2/66 (3%)
 Frame = +1

Query: 505 GPRKHVVGERRISPRARPQAGE*RHQQHPGGHQDLREQLQRLPPGRLFVR--GIPRRTVQ 678
           GPR H  GERR++P  R  A   RHQ   GG         +LP     VR   +P     
Sbjct: 105 GPRDHQRGERRVAPGGRRHAAVPRHQGRGGGVPGEEPAPVQLPGHDAAVRRPPVPAAVRA 164

Query: 679 GQRDSP 696
           G  D P
Sbjct: 165 GLEDVP 170


>UniRef50_Q7VC60 Cluster: Ferritin family protein; n=5;
           Prochlorococcus marinus|Rep: Ferritin family protein -
           Prochlorococcus marinus
          Length = 181

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 20/67 (29%), Positives = 33/67 (49%)
 Frame = +3

Query: 270 MEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLID 449
           M+     M+   +  E  AS QY A+  +F    +   GF+  F   +  E EH++K  +
Sbjct: 24  MDPALVEMLYHHLTMERNASAQYFAISIWFLERDLR--GFSDYFKKESLSEHEHSSKFAN 81

Query: 450 YLLMRGK 470
           YL+ RG+
Sbjct: 82  YLVARGQ 88



 Score = 33.5 bits (73), Expect = 5.1
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = +2

Query: 494 HHVQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESS 619
           H +  P    WES    +  + +LESDVT S++++  T E S
Sbjct: 93  HDLAAPKQ-EWESIEEVISDSFQLESDVTTSVQQIYSTAERS 133


>UniRef50_A0ND34 Cluster: ENSANGP00000030559; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000030559 - Anopheles gambiae
           str. PEST
          Length = 233

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 19/64 (29%), Positives = 34/64 (53%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           +T  N +++   + V  S  +L M + F+  +++RPGF KL+   + +    A +LI Y 
Sbjct: 49  KTVENDLKQYTSQLVDKSFHFLMMSSAFNKHSLDRPGFEKLYRKISDKAWADAIELIKYQ 108

Query: 456 LMRG 467
             RG
Sbjct: 109 SRRG 112


>UniRef50_Q7SH18 Cluster: Predicted protein; n=1; Neurospora
           crassa|Rep: Predicted protein - Neurospora crassa
          Length = 312

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 21/70 (30%), Positives = 41/70 (58%)
 Frame = +1

Query: 478 AP*PTSSRTGPRKHVVGERRISPRARPQAGE*RHQQHPGGHQDLREQLQRLPPGRLFVRG 657
           AP  +++ +  R  VVGE   + +++ Q  + + QQ   GHQ   +QL++LPPG+  +  
Sbjct: 143 APSRSATASVDRDSVVGE---TTQSQQQDQQQQQQQQELGHQQQHKQLRKLPPGQKELPQ 199

Query: 658 IPRRTVQGQR 687
           +P++  + Q+
Sbjct: 200 VPQQQGRQQQ 209


>UniRef50_P52093 Cluster: Ferritin; n=11; Bacteria|Rep: Ferritin -
           Helicobacter pylori (Campylobacter pylori)
          Length = 167

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 18/55 (32%), Positives = 33/55 (60%)
 Frame = +3

Query: 291 MMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           ++ +Q+ +E+ +S  Y++M ++    +++  G     FD A EE EHA KLI +L
Sbjct: 9   LLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGL--FLFDHAAEEYEHAKKLIVFL 61


>UniRef50_Q8RB64 Cluster: Ferritin-like protein; n=8; cellular
           organisms|Rep: Ferritin-like protein -
           Thermoanaerobacter tengcongensis
          Length = 173

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 1/62 (1%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLL-MRGK 470
           + KQ+  E+ ++  Y+AM  YF     N  GFA  F     EE  HA    +Y+  M GK
Sbjct: 10  LNKQLNYEIYSAYLYVAMENYFQ--EKNLEGFANFFKVQMEEELSHARIFYEYIYRMGGK 67

Query: 471 LT 476
           +T
Sbjct: 68  VT 69


>UniRef50_A6EKF4 Cluster: Ferritin-like protein; n=1; Pedobacter sp.
           BAL39|Rep: Ferritin-like protein - Pedobacter sp. BAL39
          Length = 176

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 5/73 (6%)
 Frame = +3

Query: 291 MMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGF---AKLFFDAATEEREHATKLIDYLLM 461
           ++ +QI++E  +S  YL+M ++      NR G+   +  FF  A EER H  K   Y+L 
Sbjct: 18  LLNQQIKKEALSSSIYLSMASW-----CNRNGYDFSSDYFFKQAEEERHHQLKFYKYVLD 72

Query: 462 RG--KLTGSVTDL 494
            G   ++  VTD+
Sbjct: 73  MGGNAISPEVTDI 85


>UniRef50_A5I2Q6 Cluster: Ferritin; n=8; Clostridium|Rep: Ferritin -
           Clostridium botulinum A str. ATCC 3502
          Length = 171

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 22/58 (37%), Positives = 29/58 (50%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           +  QI  E  +S  YLAM +Y   ++ +  GFA  F   A EE  HA K  DY+   G
Sbjct: 10  LNNQINFEFYSSYIYLAMASY--AESEDLAGFANFFRVQAQEEIFHAMKFYDYVNQMG 65


>UniRef50_P38874 Cluster: Elongator complex protein 5; n=5;
           Saccharomycetales|Rep: Elongator complex protein 5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 309

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = +3

Query: 267 TMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATK-L 443
           ++ QT Y ++++ + +  +   +Y  +  Y S +TVN+P +   F DA   +  H  K +
Sbjct: 30  SIAQTSYKLIQEFVHQSKSKGNEYPIV--YISFETVNKPSYCTQFIDATQMDFVHLVKQI 87

Query: 444 IDYL 455
           I YL
Sbjct: 88  ISYL 91


>UniRef50_Q8AYG9 Cluster: Ferritoid; n=1; Gallus gallus|Rep:
           Ferritoid - Gallus gallus (Chicken)
          Length = 273

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 21/51 (41%), Positives = 27/51 (52%)
 Frame = +3

Query: 315 EVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           E+A S+Q  A+G YF    V  P  +K F   A EER+ A  L+ Y   RG
Sbjct: 48  ELAYSLQ--ALGEYFDQSHVALPNVSKFFLHQALEERKAAEALMKYQQERG 96


>UniRef50_A3YZ65 Cluster: Ferritin; n=1; Synechococcus sp. WH
           5701|Rep: Ferritin - Synechococcus sp. WH 5701
          Length = 192

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 20/67 (29%), Positives = 33/67 (49%)
 Frame = +3

Query: 270 MEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLID 449
           ME   +  +   +Q E+ AS  Y ++  +F+   +N  GFA      +  ER HA   +D
Sbjct: 27  MEAELHQGLCNHLQMELMASYTYFSLAVWFTQRELN--GFAAFARAESDGERAHAGLFVD 84

Query: 450 YLLMRGK 470
           YL+ R +
Sbjct: 85  YLVARSQ 91


>UniRef50_Q29226 Cluster: Ferritin light chain; n=6;
           Laurasiatheria|Rep: Ferritin light chain - Sus scrofa
           (Pig)
          Length = 71

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 17/51 (33%), Positives = 29/51 (56%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLI 446
           + + I   + AS  YL++G YF+ D V   G +  F + A E+RE + +L+
Sbjct: 17  VNRLINMHLQASYTYLSLGFYFNRDDVALEGVSXFFRELAEEKREGSERLL 67


>UniRef50_Q9U4U2 Cluster: Ferritin 2 light chain homolog; n=5;
           Schizophora|Rep: Ferritin 2 light chain homolog -
           Drosophila melanogaster (Fruit fly)
          Length = 227

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 18/58 (31%), Positives = 28/58 (48%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           ++  I   +A S  YL +  +F+    NRPGF KL+   +    E +  LI  +  RG
Sbjct: 58  IQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRG 115


>UniRef50_A7HD23 Cluster: Ferritin Dps family protein; n=1;
           Anaeromyxobacter sp. Fw109-5|Rep: Ferritin Dps family
           protein - Anaeromyxobacter sp. Fw109-5
          Length = 165

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + + +Q E+ ++  YL M A+         GFA+       EE EHA + +D+LL RG
Sbjct: 10  LNRHVQAELYSAHLYLGMSAWCEAHVWK--GFARWLRAQHAEELEHARRSLDFLLARG 65


>UniRef50_A7CSI5 Cluster: Ferritin Dps family protein; n=1;
           Opitutaceae bacterium TAV2|Rep: Ferritin Dps family
           protein - Opitutaceae bacterium TAV2
          Length = 166

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 21/56 (37%), Positives = 29/56 (51%)
 Frame = +3

Query: 300 KQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           +Q   E   S+ +LA+  Y++ +T    GFAK F   A EE  HA K   +L  RG
Sbjct: 11  QQANREHYTSLMFLAL-KYWA-ETEQHAGFAKFFALQAEEEESHAKKFYQHLTDRG 64


>UniRef50_Q172H3 Cluster: Secreted ferritin G subunit, putative;
           n=6; Aedes aegypti|Rep: Secreted ferritin G subunit,
           putative - Aedes aegypti (Yellowfever mosquito)
          Length = 221

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +3

Query: 288 NMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           N ++    +++  S  +L +   F    ++RPGF KL+   + +  E   KLI Y   RG
Sbjct: 40  NDLQTFTSQQLEKSFDFLLLAFNFDQYMIDRPGFEKLYRKISDKAWEDTEKLIKYQSKRG 99

Query: 468 KLTGSVTDL 494
            LT  + DL
Sbjct: 100 -LTVELKDL 107


>UniRef50_UPI0000DA1EA4 Cluster: PREDICTED: similar to Ferritin
           light chain 1 (Ferritin L subunit 1); n=1; Rattus
           norvegicus|Rep: PREDICTED: similar to Ferritin light
           chain 1 (Ferritin L subunit 1) - Rattus norvegicus
          Length = 284

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 18/60 (30%), Positives = 29/60 (48%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           VQ P+   W      +E AL  E ++   +   + +  S+  D HL D+L   FLD++ K
Sbjct: 157 VQKPSQDEWSKTQETMEAALAPEKNLNQDLLG-LHSLGSAGTDPHLCDFLERHFLDKEVK 215


>UniRef50_UPI00005548EA Cluster: hypothetical protein
           PdenDRAFT_1764; n=1; Paracoccus denitrificans
           PD1222|Rep: hypothetical protein PdenDRAFT_1764 -
           Paracoccus denitrificans PD1222
          Length = 279

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 1/51 (1%)
 Frame = +1

Query: 520 VVGERRISPRARP-QAGE*RHQQHPGGHQDLREQLQRLPPGRLFVRGIPRR 669
           V  +RRI P  +P Q G    Q H G  QD RE      PGRL  R +  R
Sbjct: 12  VRADRRIQPLGQPDQVGNGARQHHAGARQDHREPRLGEQPGRLGHRPLAAR 62


>UniRef50_Q8KBP5 Cluster: Ferritin; n=2; Chlorobiaceae|Rep: Ferritin
           - Chlorobium tepidum
          Length = 203

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 20/68 (29%), Positives = 33/68 (48%)
 Frame = +3

Query: 270 MEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLID 449
           + +T  + +  Q+  E A++  YL M A+    +++    A  F   A EE+ H  KL D
Sbjct: 2   LSKTILDKLNHQVNFEAASAHLYLQMSAWLLTQSLDST--AAFFRAHAEEEKAHMMKLFD 59

Query: 450 YLLMRGKL 473
           Y+   G L
Sbjct: 60  YINETGSL 67


>UniRef50_UPI00001C63B6 Cluster: PREDICTED: similar to ferritin
           heavy chain; n=6; Murinae|Rep: PREDICTED: similar to
           ferritin heavy chain - Mus musculus
          Length = 215

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 19/65 (29%), Positives = 31/65 (47%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   + +Q+Q +++ S  YL+M  YF  D V    F+  F + + E   +A K +     
Sbjct: 50  CEVAINRQVQLQLSTSYVYLSMAFYFDRDDVALEKFSSFFLNKSHECTANAEKFLVLQNQ 109

Query: 462 RGKLT 476
           RG  T
Sbjct: 110 RGGRT 114


>UniRef50_Q31JA0 Cluster: Putative uncharacterized protein; n=1;
           Thiomicrospira crunogena XCL-2|Rep: Putative
           uncharacterized protein - Thiomicrospira crunogena
           (strain XCL-2)
          Length = 166

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 291 MMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           ++ KQ+  E  AS  YL + A+   +     G A  F   + EER H  K+ DY+
Sbjct: 9   LLNKQVNAEYYASSVYLQLSAW--CENAGLEGAALFFRGHSMEERTHMDKIFDYM 61


>UniRef50_Q6NW17 Cluster: Ferritin; n=17; Coelomata|Rep: Ferritin -
           Homo sapiens (Human)
          Length = 107

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>UniRef50_Q9HI00 Cluster: Vng6149h; n=1; Halobacterium
           salinarum|Rep: Vng6149h - Halobacterium salinarium
           (Halobacterium halobium)
          Length = 842

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 21/53 (39%), Positives = 26/53 (49%)
 Frame = +3

Query: 405 DAATEEREHATKLIDYLLMRGKLTGSVTDLITYRAPQTRRGRAAHQPSSTPSS 563
           D  TE+   AT   DY L+ G  + SV DLI    P    G A + P +T SS
Sbjct: 545 DPDTEDNTQATPFDDYELVEGGSSESVDDLIEDHVPDF-TGDATYTPDTTRSS 596


>UniRef50_UPI0000DA3E22 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 272

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 26/69 (37%), Positives = 33/69 (47%), Gaps = 2/69 (2%)
 Frame = +1

Query: 499 RTGPRKHVVGERRISPRARPQAGE*RHQQHPGG-HQDLREQLQRLPPGRLFVRGI-PRRT 672
           R G    +  E+  + RAR + G  R Q  PGG     R +L   P GR  V+   PRR 
Sbjct: 50  RKGGPLQLAAEQSNAGRARVRRGRARVQMSPGGAAAGSRAELPDAPTGRAGVKAARPRRP 109

Query: 673 VQGQRDSPA 699
             GQR +PA
Sbjct: 110 SPGQR-APA 117


>UniRef50_A0D7I6 Cluster: Chromosome undetermined scaffold_4, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_4,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 688

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +3

Query: 270 MEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNR 380
           +EQ C N++ K +QE    +IQ + M  YF +D  NR
Sbjct: 189 LEQLCVNIV-KHVQEVSGGNIQIIRMVLYFKVDQENR 224


>UniRef50_Q7S840 Cluster: Predicted protein; n=1; Neurospora
           crassa|Rep: Predicted protein - Neurospora crassa
          Length = 684

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 21/66 (31%), Positives = 32/66 (48%)
 Frame = +1

Query: 499 RTGPRKHVVGERRISPRARPQAGE*RHQQHPGGHQDLREQLQRLPPGRLFVRGIPRRTVQ 678
           R  P +   G+R IS  A       R  +    H+D+R+Q++ LPP    +R I R ++ 
Sbjct: 220 RRWPVQDPTGDRYISLLATAFRNGHRQTKIEDIHRDVRQQMEVLPPLCRLLREIERVSIP 279

Query: 679 GQRDSP 696
           GQ   P
Sbjct: 280 GQLPEP 285


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 655,281,032
Number of Sequences: 1657284
Number of extensions: 13067019
Number of successful extensions: 36808
Number of sequences better than 10.0: 90
Number of HSP's better than 10.0 without gapping: 35449
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36762
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55785129165
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -