SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20037
         (718 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=23...   165   1e-39
UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931; roo...   162   9e-39
UniRef50_UPI00005A2730 Cluster: PREDICTED: similar to heat shock...   140   2e-32
UniRef50_UPI00005A1D5B Cluster: PREDICTED: similar to heat shock...   136   5e-31
UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago...   135   9e-31
UniRef50_P02826 Cluster: Heat shock 70 kDa protein cognate 1; n=...   126   4e-28
UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precur...   122   7e-27
UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome sho...   122   9e-27
UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep: ...   117   3e-25
UniRef50_Q4P629 Cluster: Putative uncharacterized protein; n=1; ...   116   6e-25
UniRef50_Q7YUE0 Cluster: Hsp70 protein; n=1; Milnesium tardigrad...   113   4e-24
UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago...   111   1e-23
UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n...   107   2e-22
UniRef50_Q3UYY6 Cluster: 13 days embryo forelimb cDNA, RIKEN ful...   106   5e-22
UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella nata...   106   5e-22
UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2; ...   104   2e-21
UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular ...   104   2e-21
UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia stip...   104   3e-21
UniRef50_Q2VA67 Cluster: Putative heat schock protein 70; n=1; T...   103   3e-21
UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular...   102   8e-21
UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|R...   102   1e-20
UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole gen...   102   1e-20
UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular ...   102   1e-20
UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial precur...   101   2e-20
UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock...   101   2e-20
UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 7...   101   2e-20
UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular...   101   2e-20
UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellula...   100   7e-20
UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular...    99   1e-19
UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock...    97   4e-19
UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG070...    97   5e-19
UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia stip...    96   7e-19
UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9; ...    95   2e-18
UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial ...    95   2e-18
UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38; Bacteria|...    94   4e-18
UniRef50_Q9UQC1 Cluster: Heat shock protein 72; n=10; Fungi/Meta...    93   5e-18
UniRef50_A7HBX9 Cluster: 2-alkenal reductase precursor; n=7; Cys...    91   2e-17
UniRef50_A3CIL0 Cluster: Putative uncharacterized protein; n=2; ...    91   2e-17
UniRef50_Q1CWT5 Cluster: DnaK family protein; n=2; Cystobacterin...    91   3e-17
UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1; ...    91   3e-17
UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein...    91   3e-17
UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone...    91   3e-17
UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3; Planctomyc...    91   3e-17
UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    89   1e-16
UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella natan...    88   2e-16
UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular ...    88   2e-16
UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena t...    88   2e-16
UniRef50_UPI0000DC15CB Cluster: UPI0000DC15CB related cluster; n...    87   3e-16
UniRef50_Q3SD91 Cluster: Cytosol-type hsp70; n=1; Paramecium tet...    87   3e-16
UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n...    87   4e-16
UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gamb...    87   4e-16
UniRef50_A0CZG2 Cluster: Chromosome undetermined scaffold_32, wh...    87   4e-16
UniRef50_UPI0000D56BFD Cluster: PREDICTED: similar to CG8937-PA,...    87   5e-16
UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonosp...    86   7e-16
UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas vaginali...    86   9e-16
UniRef50_A0DHP4 Cluster: Chromosome undetermined scaffold_50, wh...    86   9e-16
UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3; ...    84   3e-15
UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2; Anaeromyxob...    84   4e-15
UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:...    83   7e-15
UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1; Aca...    83   7e-15
UniRef50_Q7YW35 Cluster: ER-type hsp70; n=1; Paramecium multimic...    83   9e-15
UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock...    82   1e-14
UniRef50_A7RF55 Cluster: Predicted protein; n=1; Nematostella ve...    82   1e-14
UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2; Enta...    81   4e-14
UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: Dna...    81   4e-14
UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus ...    80   6e-14
UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock...    79   8e-14
UniRef50_Q1D211 Cluster: DnaK family protein; n=1; Myxococcus xa...    79   8e-14
UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila aurari...    79   8e-14
UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Re...    79   1e-13
UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodosp...    78   2e-13
UniRef50_UPI0000F2C215 Cluster: PREDICTED: hypothetical protein;...    78   2e-13
UniRef50_Q1CY00 Cluster: DnaK family protein; n=2; Cystobacterin...    78   2e-13
UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    77   3e-13
UniRef50_A4QNX8 Cluster: Zgc:162281 protein; n=6; Eumetazoa|Rep:...    77   4e-13
UniRef50_O14992 Cluster: HS24/P52; n=8; Eutheria|Rep: HS24/P52 -...    77   4e-13
UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter ...    76   1e-12
UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter ...    76   1e-12
UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1; Syntroph...    75   1e-12
UniRef50_Q9Y4L1 Cluster: Hypoxia up-regulated protein 1 precurso...    75   1e-12
UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA...    75   2e-12
UniRef50_UPI0000E474BD Cluster: PREDICTED: hypothetical protein;...    75   2e-12
UniRef50_A2VD43 Cluster: Heat shock protein 14; n=3; Clupeocepha...    75   2e-12
UniRef50_A4J964 Cluster: Heat shock protein 70; n=2; Clostridial...    74   3e-12
UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1; ...    74   3e-12
UniRef50_Q1E6G2 Cluster: Heat shock protein 70 homolog; n=17; Pe...    74   3e-12
UniRef50_Q4RM18 Cluster: Chromosome 10 SCAF15019, whole genome s...    73   5e-12
UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2; Panspora...    73   5e-12
UniRef50_P48723 Cluster: Stress 70 protein chaperone microsome-a...    73   5e-12
UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4; Planctomyc...    73   7e-12
UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168, w...    73   7e-12
UniRef50_Q0RWC8 Cluster: Probable chaperone protein DnaK; n=1; R...    73   9e-12
UniRef50_Q9SAB1 Cluster: F25C20.19 protein; n=3; core eudicotyle...    73   9e-12
UniRef50_Q73CC4 Cluster: Dnak protein, truncation; n=1; Bacillus...    72   1e-11
UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus...    72   1e-11
UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular or...    72   1e-11
UniRef50_Q20752 Cluster: Putative uncharacterized protein stc-1;...    72   1e-11
UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    72   1e-11
UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacif...    72   2e-11
UniRef50_A6C7U8 Cluster: DnaK protein (Heat shock protein), C-te...    72   2e-11
UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1; Planctom...    72   2e-11
UniRef50_Q0WM51 Cluster: HSP like protein; n=11; Magnoliophyta|R...    72   2e-11
UniRef50_O23508 Cluster: Growth regulator like protein; n=6; Mag...    72   2e-11
UniRef50_O59838 Cluster: Heat shock protein homolog pss1; n=21; ...    72   2e-11
UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera a...    72   2e-11
UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum fer...    71   3e-11
UniRef50_Q92598 Cluster: Heat shock protein 105 kDa; n=92; Eumet...    71   4e-11
UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26; Bacteria|...    70   5e-11
UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2; Actinomy...    70   5e-11
UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena ...    70   5e-11
UniRef50_Q54GD7 Cluster: Heat shock protein Hsp70 family protein...    70   5e-11
UniRef50_UPI0000F1F58C Cluster: PREDICTED: similar to Heat shock...    70   7e-11
UniRef50_Q7ZUM5 Cluster: Heat shock protein 4; n=20; Euteleostom...    70   7e-11
UniRef50_A2FKE2 Cluster: DnaK protein; n=3; Trichomonas vaginali...    70   7e-11
UniRef50_A3LND0 Cluster: Lumen HSP Seventy; n=2; Saccharomycetal...    70   7e-11
UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1; Enta...    69   9e-11
UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera aphi...    69   9e-11
UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1; Saccharo...    69   1e-10
UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    69   2e-10
UniRef50_Q2H062 Cluster: Putative uncharacterized protein; n=2; ...    69   2e-10
UniRef50_Q06068 Cluster: 97 kDa heat shock protein; n=3; Strongy...    69   2e-10
UniRef50_Q0VDF9 Cluster: Heat shock 70 kDa protein 14; n=25; Eut...    69   2e-10
UniRef50_P32590 Cluster: Heat shock protein homolog SSE2; n=20; ...    69   2e-10
UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera a...    69   2e-10
UniRef50_Q96269 Cluster: Heat-shock protein; n=14; Magnoliophyta...    68   2e-10
UniRef50_A2DWC1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    68   2e-10
UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1; Methanospir...    68   2e-10
UniRef50_Q10061 Cluster: Heat shock protein 70 homolog precursor...    68   2e-10
UniRef50_UPI00005A5FFD Cluster: PREDICTED: similar to heat shock...    68   3e-10
UniRef50_A7SM46 Cluster: Predicted protein; n=1; Nematostella ve...    67   4e-10
UniRef50_Q6CII0 Cluster: Similar to sp|P36016 Saccharomyces cere...    67   4e-10
UniRef50_A6R6X7 Cluster: Putative uncharacterized protein; n=1; ...    67   4e-10
UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative g...    67   5e-10
UniRef50_Q2QXK2 Cluster: DnaK protein, expressed; n=2; Oryza sat...    67   5e-10
UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginali...    67   5e-10
UniRef50_P38788 Cluster: Ribosome-associated complex subunit SSZ...    67   5e-10
UniRef50_A7PR73 Cluster: Chromosome chr14 scaffold_26, whole gen...    66   6e-10
UniRef50_A2E407 Cluster: DnaK protein; n=1; Trichomonas vaginali...    66   6e-10
UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein), C-te...    66   8e-10
UniRef50_A0C553 Cluster: Chromosome undetermined scaffold_15, wh...    66   8e-10
UniRef50_A2YAM2 Cluster: Putative uncharacterized protein; n=3; ...    66   1e-09
UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13; Rickett...    65   1e-09
UniRef50_A2G573 Cluster: DnaK protein; n=2; Trichomonas vaginali...    65   1e-09
UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n...    65   1e-09
UniRef50_UPI0000661593 Cluster: Homolog of Homo sapiens "Heat sh...    65   2e-09
UniRef50_Q5BSZ7 Cluster: SJCHGC03031 protein; n=1; Schistosoma j...    65   2e-09
UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein), HSP7...    64   2e-09
UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1; N...    64   2e-09
UniRef50_Q4P3F6 Cluster: Putative uncharacterized protein; n=1; ...    64   2e-09
UniRef50_O15797 Cluster: CG4; n=10; Plasmodium|Rep: CG4 - Plasmo...    64   3e-09
UniRef50_A2F432 Cluster: DnaK protein; n=1; Trichomonas vaginali...    64   3e-09
UniRef50_A2EPF1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    64   3e-09
UniRef50_Q06YR5 Cluster: Possibile polyglycylated protein 1; n=2...    64   4e-09
UniRef50_UPI0000D55C7E Cluster: PREDICTED: similar to CG2918-PA;...    63   6e-09
UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3; Psychrobacter...    63   6e-09
UniRef50_Q655N4 Cluster: Putative heat-shock protein; n=2; Oryza...    63   6e-09
UniRef50_A2ECF5 Cluster: DnaK protein; n=1; Trichomonas vaginali...    63   6e-09
UniRef50_Q8SWH2 Cluster: Similarity to HSP70-RELATED PROTEIN; n=...    63   6e-09
UniRef50_A5DUP7 Cluster: Putative uncharacterized protein; n=1; ...    63   6e-09
UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29; Proteobac...    63   6e-09
UniRef50_Q6F9S6 Cluster: Chaperone protein; n=2; Acinetobacter|R...    63   8e-09
UniRef50_A6EQS3 Cluster: Heat shock protein Hsp70; n=1; unidenti...    63   8e-09
UniRef50_O46067 Cluster: CG2918-PA; n=3; Diptera|Rep: CG2918-PA ...    63   8e-09
UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14; R...    62   1e-08
UniRef50_Q7M080 Cluster: DnaK-type molecular chaperone; n=1; Cri...    62   1e-08
UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma marg...    62   1e-08
UniRef50_A5N5I5 Cluster: DnaK1; n=1; Clostridium kluyveri DSM 55...    62   1e-08
UniRef50_A5MZQ7 Cluster: DnaK9; n=1; Clostridium kluyveri DSM 55...    62   1e-08
UniRef50_A2DR00 Cluster: DnaK protein; n=7; Trichomonas vaginali...    62   1e-08
UniRef50_A2DQ03 Cluster: DnaK protein; n=1; Trichomonas vaginali...    62   1e-08
UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188; Bacteria...    62   1e-08
UniRef50_UPI0000DB7485 Cluster: PREDICTED: similar to CG2918-PA;...    62   2e-08
UniRef50_Q22E65 Cluster: DnaK protein; n=1; Tetrahymena thermoph...    62   2e-08
UniRef50_Q55Y28 Cluster: Putative uncharacterized protein; n=2; ...    62   2e-08
UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep...    61   2e-08
UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2; Gammapro...    61   2e-08
UniRef50_Q010Y3 Cluster: DNAK_GLOVI Chaperone protein dnaK; n=1;...    61   2e-08
UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27; P...    61   2e-08
UniRef50_Q64YI6 Cluster: Chaperone protein DnaK; n=2; Bacteroide...    61   3e-08
UniRef50_A2EMY0 Cluster: DnaK protein; n=4; Trichomonas vaginali...    61   3e-08
UniRef50_Q22758 Cluster: Putative uncharacterized protein; n=2; ...    60   4e-08
UniRef50_P87142 Cluster: Heat shock protein 70 homolog C57A7.12;...    60   4e-08
UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas s...    60   5e-08
UniRef50_Q9VUC1 Cluster: CG6603-PA, isoform A; n=7; Endopterygot...    60   5e-08
UniRef50_Q6BJA2 Cluster: Debaryomyces hansenii chromosome G of s...    60   5e-08
UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=...    60   7e-08
UniRef50_UPI0000510557 Cluster: COG0443: Molecular chaperone; n=...    60   7e-08
UniRef50_UPI0000499681 Cluster: heat shock protein 70; n=1; Enta...    60   7e-08
UniRef50_Q6L4S6 Cluster: Putative uncharacterized protein P0663C...    60   7e-08
UniRef50_A7PZE7 Cluster: Chromosome chr15 scaffold_40, whole gen...    60   7e-08
UniRef50_A2F7Z8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    60   7e-08
UniRef50_P36016 Cluster: Heat shock protein 70 homolog LHS1 prec...    60   7e-08
UniRef50_P37092 Cluster: Heat shock protein 70 homolog; n=5; Clo...    60   7e-08
UniRef50_Q9VSI1 Cluster: CG7182-PA; n=2; Sophophora|Rep: CG7182-...    59   9e-08
UniRef50_A2ECV1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    59   9e-08
UniRef50_A2E4A6 Cluster: DnaK protein; n=2; Trichomonas vaginali...    59   9e-08
UniRef50_Q4PG59 Cluster: Putative uncharacterized protein; n=1; ...    59   9e-08
UniRef50_P77319 Cluster: Chaperone protein hscC; n=19; Gammaprot...    59   9e-08
UniRef50_A2EVQ1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    59   1e-07
UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone...    58   2e-07
UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lambl...    58   2e-07
UniRef50_A0DJC4 Cluster: Chromosome undetermined scaffold_53, wh...    58   2e-07
UniRef50_Q5KHV7 Cluster: Heat shock protein HSP60, putative; n=2...    58   2e-07
UniRef50_A6UND5 Cluster: 2-alkenal reductase; n=1; Methanococcus...    58   2e-07
UniRef50_UPI00006CA81B Cluster: dnaK protein; n=1; Tetrahymena t...    58   2e-07
UniRef50_UPI0000498B17 Cluster: hsp70 family protein; n=1; Entam...    58   2e-07
UniRef50_A7DID8 Cluster: Glutamate dehydrogenase; n=14; Alphapro...    58   2e-07
UniRef50_A7BR82 Cluster: Heat shock protein Hsp70; n=1; Beggiato...    58   2e-07
UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshime...    58   2e-07
UniRef50_Q86JV8 Cluster: Similar to heat shock protein; n=2; Dic...    58   2e-07
UniRef50_Q5DEW6 Cluster: SJCHGC09345 protein; n=1; Schistosoma j...    58   2e-07
UniRef50_UPI00015B551B Cluster: PREDICTED: similar to ENSANGP000...    58   3e-07
UniRef50_A7R204 Cluster: Chromosome undetermined scaffold_388, w...    58   3e-07
UniRef50_A2G8T1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    58   3e-07
UniRef50_Q05036 Cluster: Uncharacterized protein C30C11.4; n=2; ...    58   3e-07
UniRef50_Q5CTE6 Cluster: APG-1 like HSP70 domain containing prot...    57   4e-07
UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia bu...    57   5e-07
UniRef50_Q1VU26 Cluster: Heat shock protein Hsp70; n=2; Bacteroi...    57   5e-07
UniRef50_Q00YD5 Cluster: Heat shock protein 91-Arabidopsis thali...    57   5e-07
UniRef50_Q3W504 Cluster: Heat shock protein Hsp70; n=3; Actinomy...    56   7e-07
UniRef50_A6EMR6 Cluster: Heat shock protein Hsp70; n=1; unidenti...    56   7e-07
UniRef50_Q7SBZ8 Cluster: Putative uncharacterized protein NCU094...    56   7e-07
UniRef50_UPI0000499E28 Cluster: hsp70 family protein; n=1; Entam...    56   9e-07
UniRef50_A6CBP2 Cluster: Dnak protein, truncation; n=1; Planctom...    56   1e-06
UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;...    56   1e-06
UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM 55...    55   2e-06
UniRef50_A0MBW7 Cluster: HSP 70h; n=6; Closterovirus|Rep: HSP 70...    55   2e-06
UniRef50_A4RY30 Cluster: Heat Shock Protein 70, ER lumen; n=2; O...    55   2e-06
UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia intest...    55   2e-06
UniRef50_A2R006 Cluster: Contig An12c0210, complete genome; n=1;...    55   2e-06
UniRef50_A4FEW4 Cluster: Putative surface layer protein; n=1; Sa...    54   3e-06
UniRef50_A4HIH9 Cluster: Heat shock 70-related protein 1, mitoch...    54   3e-06
UniRef50_P34935 Cluster: 78 kDa glucose-regulated protein; n=13;...    54   3e-06
UniRef50_Q52V38 Cluster: Heat shock protein 70-like; n=4; Mint v...    54   4e-06
UniRef50_Q3WFH0 Cluster: Heat shock protein Hsp70; n=1; Frankia ...    54   4e-06
UniRef50_A6C7U7 Cluster: DnaK protein (Heat shock protein), HSP7...    54   4e-06
UniRef50_A7PZ39 Cluster: Chromosome chr4 scaffold_39, whole geno...    54   4e-06
UniRef50_A1XM67 Cluster: Heat shock protein Hsp70-6; n=1; Blasto...    54   4e-06
UniRef50_Q9XZM1 Cluster: Heat shock protein HSP70-2; n=3; Entamo...    54   5e-06
UniRef50_Q57VU9 Cluster: Heat shock 70 kDa protein, putative; n=...    54   5e-06
UniRef50_Q22515 Cluster: Putative uncharacterized protein; n=3; ...    54   5e-06
UniRef50_Q1NQZ1 Cluster: Glutamate dehydrogenase precursor; n=1;...    53   6e-06
UniRef50_A5MZQ6 Cluster: DnaK8; n=2; Clostridium kluyveri DSM 55...    53   6e-06
UniRef50_A2EAK8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    53   6e-06
UniRef50_A7U5U4 Cluster: Hsp70; n=4; Pezizomycotina|Rep: Hsp70 -...    53   6e-06
UniRef50_A4ZIR9 Cluster: Heat shock protein 70; n=12; Closterovi...    53   8e-06
UniRef50_A6GJQ9 Cluster: Heat shock protein Hsp70; n=1; Plesiocy...    53   8e-06
UniRef50_UPI0000499AA8 Cluster: hsp70 family protein; n=1; Entam...    52   1e-05
UniRef50_Q66239 Cluster: 65-kDa protein; n=19; Citrus tristeza v...    52   1e-05
UniRef50_A4EA23 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q9ZU03 Cluster: Heat shock protein 70-related protein; ...    52   1e-05
UniRef50_UPI000038E267 Cluster: hypothetical protein Faci_030017...    52   1e-05
UniRef50_Q8NN35 Cluster: Molecular chaperone; n=3; Corynebacteri...    52   1e-05
UniRef50_A7CRR2 Cluster: Glutamate dehydrogenase; n=1; Opitutace...    52   1e-05
UniRef50_Q25552 Cluster: Heat-shock protein SSE1 homolog; n=1; N...    52   2e-05
UniRef50_A2DQX2 Cluster: DnaK protein; n=1; Trichomonas vaginali...    52   2e-05
UniRef50_Q759Z5 Cluster: ADR128Cp; n=1; Eremothecium gossypii|Re...    52   2e-05
UniRef50_UPI0000498BE2 Cluster: chaperone protein dnaK; n=2; Ent...    51   2e-05
UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM 55...    51   2e-05
UniRef50_A3BBU4 Cluster: Putative uncharacterized protein; n=2; ...    51   2e-05
UniRef50_Q7RDM0 Cluster: Putative HSP protein; n=9; Plasmodium|R...    51   2e-05
UniRef50_A6SIT8 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_Q8YNT4 Cluster: DnaK-type molecular chaperone; n=2; Nos...    51   3e-05
UniRef50_Q0V0K5 Cluster: Putative uncharacterized protein; n=1; ...    51   3e-05
UniRef50_Q9SKY8 Cluster: 70kD heat shock protein; n=6; Magnoliop...    50   4e-05
UniRef50_Q4SW20 Cluster: Chromosome undetermined SCAF13693, whol...    38   5e-05
UniRef50_Q599L2 Cluster: Chaperone protein HscA; n=1; Shewanella...    50   6e-05
UniRef50_A7BCD2 Cluster: Putative uncharacterized protein; n=1; ...    50   8e-05
UniRef50_A6NYB9 Cluster: Putative uncharacterized protein; n=1; ...    50   8e-05
UniRef50_Q6FU50 Cluster: Heat shock protein 70 homolog LHS1 prec...    50   8e-05
UniRef50_Q98159 Cluster: ORF1 protein; n=2; Little cherry virus ...    49   1e-04
UniRef50_Q2AM05 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q1YJU7 Cluster: Possible chaperone protein; n=1; Aurant...    49   1e-04
UniRef50_Q0LE46 Cluster: Molecular chaperone; n=4; Chloroflexi (...    49   1e-04
UniRef50_Q4Q9A4 Cluster: Heat shock 70 protein-like protein; n=3...    49   1e-04
UniRef50_Q1E2H7 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_UPI00005A5F54 Cluster: PREDICTED: similar to Stress-70 ...    49   1e-04
UniRef50_Q805J2 Cluster: Heat shock protein 70-like protein; n=1...    49   1e-04
UniRef50_A6FX30 Cluster: Chaperone protein DnaK; n=1; Plesiocyst...    49   1e-04
UniRef50_Q4DGL0 Cluster: DNAK protein, putative; n=2; Trypanosom...    49   1e-04
UniRef50_A7TP95 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_A4FJJ3 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_Q01M68 Cluster: OSIGBa0114M03.5 protein; n=4; Oryza sat...    48   2e-04
UniRef50_Q9GYV8 Cluster: 70-kDa heat shock protein; n=5; Entamoe...    48   2e-04
UniRef50_Q4QDQ2 Cluster: Heat shock protein, putative; n=5; Tryp...    48   2e-04
UniRef50_UPI000150A7D6 Cluster: dnaK protein; n=1; Tetrahymena t...    48   2e-04
UniRef50_A2F0R7 Cluster: DnaK protein; n=2; Trichomonas vaginali...    48   2e-04
UniRef50_UPI000049A5EA Cluster: hsp70 family protein; n=1; Entam...    48   3e-04
UniRef50_Q9Q6Q1 Cluster: HSP70-like protein; n=47; Grapevine lea...    48   3e-04
UniRef50_Q2A073 Cluster: Heat shock protein 70; n=11; Viruses|Re...    48   3e-04
UniRef50_A1R9R9 Cluster: Putative DnaK family protein; n=1; Arth...    48   3e-04
UniRef50_A2FS75 Cluster: DnaK protein; n=1; Trichomonas vaginali...    48   3e-04
UniRef50_Q7T733 Cluster: P60; n=2; Little cherry virus 2|Rep: P6...    47   4e-04
UniRef50_O71192 Cluster: 59 kDa protein; n=26; Grapevine leafrol...    47   4e-04
UniRef50_Q4JX13 Cluster: Molecular chaperone protein; n=1; Coryn...    47   4e-04
UniRef50_Q6CFA8 Cluster: Yarrowia lipolytica chromosome B of str...    47   4e-04
UniRef50_Q3VZ88 Cluster: Heat shock protein Hsp70; n=1; Frankia ...    47   5e-04
UniRef50_A0PTC6 Cluster: Chaperone protein DnaK1; n=3; Mycobacte...    47   5e-04
UniRef50_A2EFJ4 Cluster: DnaK protein; n=1; Trichomonas vaginali...    47   5e-04
UniRef50_Q1D082 Cluster: DnaK family protein; n=2; Cystobacterin...    46   7e-04
UniRef50_Q0RLI8 Cluster: Putative uncharacterized protein; n=2; ...    46   7e-04
UniRef50_A5AG28 Cluster: Malic enzyme; n=1; Vitis vinifera|Rep: ...    46   7e-04
UniRef50_Q670L1 Cluster: Heat shock cognate protein 71; n=12; Fu...    46   7e-04
UniRef50_Q2INJ2 Cluster: Putative NAD-specific glutamate dehydro...    46   0.001
UniRef50_Q0EST2 Cluster: Heat shock protein 70; n=3; Thermoanaer...    46   0.001
UniRef50_Q89QH6 Cluster: Hsp70 family molecular chaperone; n=2; ...    46   0.001
UniRef50_A5VT75 Cluster: Putative NAD-specific glutamate dehydro...    46   0.001
UniRef50_A1G644 Cluster: Heat shock protein 70; n=2; Salinispora...    46   0.001
UniRef50_A2DZ76 Cluster: DnaK protein; n=1; Trichomonas vaginali...    46   0.001
UniRef50_Q9QCV8 Cluster: Heat shock 70 protein; n=2; Plum bark n...    45   0.002
UniRef50_Q1EWS0 Cluster: Heat shock protein Hsp70; n=1; Clostrid...    45   0.002
UniRef50_A0NRW0 Cluster: Heat shock protein Hsp70; n=1; Stappia ...    45   0.002
UniRef50_UPI0000498597 Cluster: chaperone protein dnaK; n=1; Ent...    45   0.002
UniRef50_A7AWJ8 Cluster: Tetratricopeptide repeat domain contain...    45   0.002
UniRef50_A4FPH4 Cluster: Molecular chaperone; n=1; Saccharopolys...    44   0.003
UniRef50_A3FQM0 Cluster: Heat shock 105kD; heat shock 105kD alph...    44   0.004
UniRef50_Q6QCI1 Cluster: HSP70h; n=1; Mint vein banding virus|Re...    44   0.005
UniRef50_A4FAH5 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_A5AT06 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_Q4CS27 Cluster: Putative uncharacterized protein; n=3; ...    44   0.005
UniRef50_UPI000049A3E9 Cluster: 70 kDa heat shock protein; n=2; ...    43   0.009
UniRef50_Q38F93 Cluster: Heat shock protein, putative; n=1; Tryp...    43   0.009
UniRef50_A5N5I8 Cluster: DnaK4; n=1; Clostridium kluyveri DSM 55...    42   0.011
UniRef50_A7QEL0 Cluster: Chromosome chr17 scaffold_85, whole gen...    42   0.011
UniRef50_A0D4W7 Cluster: Chromosome undetermined scaffold_38, wh...    42   0.011
UniRef50_Q4E175 Cluster: Heat shock protein 70 (HSP70), putative...    42   0.015
UniRef50_Q114Z4 Cluster: TPR repeat; n=1; Trichodesmium erythrae...    42   0.020
UniRef50_A2DHP3 Cluster: Heat shock protein, putative; n=1; Tric...    42   0.020
UniRef50_Q1NCH4 Cluster: Putative NAD-specific glutamate dehydro...    41   0.027
UniRef50_Q6UNN5 Cluster: HSP 70 family protein-like protein; n=1...    41   0.027
UniRef50_Q1NR74 Cluster: Heat shock protein Hsp70; n=3; Proteoba...    41   0.035
UniRef50_A0UQH1 Cluster: Glutamate dehydrogenase; n=14; Proteoba...    41   0.035
UniRef50_A1FNI8 Cluster: Glutamate dehydrogenase; n=1; Pseudomon...    40   0.046
UniRef50_Q6MI83 Cluster: Molecular chaperone, Hsp70 family; n=1;...    40   0.061
UniRef50_Q388G4 Cluster: Putative uncharacterized protein; n=1; ...    40   0.061
UniRef50_UPI0000499107 Cluster: 70 kDa heat shock protein; n=1; ...    40   0.081
UniRef50_Q2JG83 Cluster: WD-40 repeat protein; n=3; Frankia|Rep:...    39   0.14 
UniRef50_Q0RG01 Cluster: Putative uncharacterized protein; n=1; ...    39   0.14 
UniRef50_A4F6G8 Cluster: Chaperone protein HscC; n=1; Saccharopo...    38   0.19 
UniRef50_A7P6P9 Cluster: Chromosome chr9 scaffold_7, whole genom...    38   0.19 
UniRef50_Q08P77 Cluster: Chaperone protein DnaK, putative; n=1; ...    38   0.25 
UniRef50_A2ED93 Cluster: Putative uncharacterized protein; n=1; ...    38   0.25 
UniRef50_Q6MB40 Cluster: Putative heat shock protein 70, dnaK; n...    38   0.33 
UniRef50_Q3DYB3 Cluster: Putative uncharacterized protein; n=1; ...    38   0.33 
UniRef50_Q1JTE8 Cluster: Putative uncharacterized protein; n=1; ...    38   0.33 
UniRef50_A4IC10 Cluster: Putative uncharacterized protein; n=3; ...    38   0.33 
UniRef50_A2FVJ6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    38   0.33 
UniRef50_Q7VA80 Cluster: Molecular chaperone DnaK; n=4; Prochlor...    31   0.42 
UniRef50_A4QN42 Cluster: Si:dkey-61p9.6 protein; n=10; Danio rer...    37   0.43 
UniRef50_A6DQF5 Cluster: Putative heat shock protein 70, dnaK; n...    37   0.43 
UniRef50_A0W7A3 Cluster: Heat shock protein, HSP70 family; n=4; ...    37   0.43 
UniRef50_A2F4A7 Cluster: Putative uncharacterized protein; n=1; ...    37   0.43 
UniRef50_A2E1V3 Cluster: DnaK protein; n=1; Trichomonas vaginali...    37   0.43 
UniRef50_UPI0000D9ECF5 Cluster: PREDICTED: hypothetical protein;...    37   0.57 
UniRef50_Q7D073 Cluster: AGR_C_1814p; n=7; Alphaproteobacteria|R...    37   0.57 
UniRef50_A6DQF6 Cluster: Molecular chaperone; n=1; Lentisphaera ...    37   0.57 
UniRef50_A4Z1V1 Cluster: Putative chaperone protein; n=2; Bradyr...    36   0.76 
UniRef50_UPI00015B634E Cluster: PREDICTED: similar to conserved ...    36   1.00 
UniRef50_UPI0000660A37 Cluster: Centrosomal protein Cep290 (Neph...    36   1.00 
UniRef50_Q9DQ89 Cluster: Heat shock protein 70; n=3; Ampelovirus...    36   1.00 
UniRef50_Q8G2E7 Cluster: Heat shock protein, Hsp70 family; n=6; ...    36   1.00 
UniRef50_Q5FPD0 Cluster: Chaperone protein DnaK; n=1; Gluconobac...    36   1.00 
UniRef50_A7BVW1 Cluster: Heat shock protein, Hsp70 family protei...    36   1.00 
UniRef50_A7AN53 Cluster: DnaK family protein; n=1; Babesia bovis...    36   1.00 
UniRef50_UPI0000DA3FE5 Cluster: PREDICTED: similar to heat shock...    36   1.3  
UniRef50_Q5P643 Cluster: DnaK-related protein; n=15; Bacteria|Re...    36   1.3  
UniRef50_Q0C4T8 Cluster: Heat shock protein, Hsp70 family; n=1; ...    36   1.3  
UniRef50_Q09AQ1 Cluster: Molecular chaperone; n=2; Cystobacterin...    36   1.3  
UniRef50_UPI000058412F Cluster: PREDICTED: similar to Peroxisome...    35   1.7  
UniRef50_UPI00004999A1 Cluster: 70 kDa heat shock protein; n=4; ...    35   1.7  
UniRef50_A2TZ62 Cluster: Chaperone protein dnaK; n=1; Polaribact...    35   1.7  
UniRef50_A0VAV7 Cluster: Molecular chaperone, HSP70 class; n=4; ...    35   1.7  
UniRef50_Q9KDT7 Cluster: Ferritin; n=6; Firmicutes|Rep: Ferritin...    35   2.3  
UniRef50_Q98BE0 Cluster: DnaK-type molecular chaperone; DnaK; n=...    35   2.3  
UniRef50_Q1VK01 Cluster: Actin-like ATPase involved in cell divi...    35   2.3  
UniRef50_A6DB88 Cluster: S-ADENOSYLMETHIONINE-DEPENDENT METHYLTR...    35   2.3  
UniRef50_A4A0F9 Cluster: Probable chaperone protein DnaK; n=1; B...    35   2.3  
UniRef50_UPI00004999C9 Cluster: chaperone protein dnaK; n=1; Ent...    34   3.0  
UniRef50_Q1GHW3 Cluster: Molecular chaperone DnaK; n=15; Bacteri...    34   3.0  
UniRef50_A7HAM6 Cluster: Molecular chaperone-like protein precur...    34   3.0  
UniRef50_Q4N5P7 Cluster: Heat shock protein 110, putative; n=2; ...    34   3.0  
UniRef50_A0C707 Cluster: Chromosome undetermined scaffold_153, w...    34   3.0  
UniRef50_Q7URC4 Cluster: Probable chaperone protein DnaK; n=2; P...    34   4.0  
UniRef50_A1FI48 Cluster: Transcriptional regulator, AraC family;...    34   4.0  
UniRef50_A0M4M3 Cluster: Putative uncharacterized protein; n=1; ...    34   4.0  
UniRef50_A0GV00 Cluster: Putative NAD-specific glutamate dehydro...    34   4.0  
UniRef50_Q5KFW7 Cluster: Gamma-aminobutyric acid transporter, pu...    34   4.0  
UniRef50_UPI0000E473D3 Cluster: PREDICTED: similar to oxygen reg...    33   5.3  
UniRef50_A7AWL8 Cluster: DnaK family domain containing protein; ...    33   5.3  
UniRef50_Q2UAN0 Cluster: Predicted protein; n=1; Aspergillus ory...    33   5.3  
UniRef50_Q6MDN4 Cluster: Putative heat shock protein 70; n=1; Ca...    33   7.0  
UniRef50_Q609D0 Cluster: DnaK-related protein; n=48; cellular or...    33   7.0  
UniRef50_Q2VZ67 Cluster: Molecular chaperone; n=3; Rhodospirilla...    33   7.0  
UniRef50_A3PTH5 Cluster: Conserved hypothetical proline and thre...    33   7.0  
UniRef50_A0LF41 Cluster: DnaK-related protein; n=1; Syntrophobac...    33   7.0  
UniRef50_A5AXV7 Cluster: Putative uncharacterized protein; n=1; ...    33   7.0  
UniRef50_A7RNL3 Cluster: Predicted protein; n=1; Nematostella ve...    33   7.0  
UniRef50_Q9HHC0 Cluster: Putative glutamate dehydrogenase; n=1; ...    33   7.0  
UniRef50_Q894U0 Cluster: Ethanolamine utilization protein eutJ; ...    33   9.3  
UniRef50_Q6A8S1 Cluster: Molecular chaperone; n=1; Propionibacte...    33   9.3  
UniRef50_Q5E4N4 Cluster: Heat shock protein 70; n=7; Proteobacte...    33   9.3  
UniRef50_A1SY38 Cluster: Heat shock protein 70; n=1; Psychromona...    33   9.3  
UniRef50_A1I8W6 Cluster: Molecular chaperone-like; n=1; Candidat...    33   9.3  
UniRef50_A0YV37 Cluster: Heat shock protein 70; n=2; Oscillatori...    33   9.3  
UniRef50_Q6H7J9 Cluster: Putative wall-associated kinase 4; n=4;...    33   9.3  
UniRef50_A3A9B7 Cluster: Putative uncharacterized protein; n=1; ...    33   9.3  
UniRef50_Q9VK08 Cluster: CG6108-PA; n=1; Drosophila melanogaster...    33   9.3  
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    33   9.3  

>UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=239;
           Eukaryota|Rep: Heat shock cognate 71 kDa protein - Homo
           sapiens (Human)
          Length = 646

 Score =  165 bits (401), Expect = 1e-39
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EGIDFYTSITRARFEELNADLFR T++PVEK+LRDAK+DK+Q
Sbjct: 271 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 331 IHDIVLVGGSTRIPKIQKLLQDFFNGKE 358



 Score =  164 bits (398), Expect = 2e-39
 Identities = 75/84 (89%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+
Sbjct: 190 GAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKH 249

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD++ NKRA+RRLRTACERAKRT
Sbjct: 250 KKDISENKRAVRRLRTACERAKRT 273



 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 357 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKR 416

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 417 NTTIPTKQTQTF 428


>UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931;
           root|Rep: Heat shock 70 kDa protein 1 - Homo sapiens
           (Human)
          Length = 641

 Score =  162 bits (393), Expect = 9e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 5e-38
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>UniRef50_UPI00005A2730 Cluster: PREDICTED: similar to heat shock
           protein 8; n=2; Canis lupus familiaris|Rep: PREDICTED:
           similar to heat shock protein 8 - Canis familiaris
          Length = 476

 Score =  140 bits (340), Expect = 2e-32
 Identities = 64/84 (76%), Positives = 73/84 (86%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVS+ TIE+GIFEVKSTAGDTHLGGEDFDN++VN F+ EFKRK 
Sbjct: 165 GAERNVLIFDLGGGTFDVSVPTIENGIFEVKSTAGDTHLGGEDFDNQIVNRFIAEFKRKC 224

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD+  NKR +R L+TAC+RAK T
Sbjct: 225 KKDIHENKRTVRHLQTACKRAKHT 248



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 35/66 (53%), Positives = 37/66 (56%)
 Frame = +3

Query: 516 SINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIP 695
           SI+PDE           IL GDKSE VQD           G ETAGGVM  LIK +TTIP
Sbjct: 290 SISPDEAVAYGTAVKIAILSGDKSENVQDSLLLDVTPLSLGFETAGGVMMVLIKCDTTIP 349

Query: 696 TKQTQT 713
           TKQ QT
Sbjct: 350 TKQMQT 355



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/43 (53%), Positives = 32/43 (74%)
 Frame = +1

Query: 313 YTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVL 441
           +T  +  +  +LNADLF  T++P+EK+L DAK+DK QI DIVL
Sbjct: 247 HTLSSSTQASKLNADLFHGTLDPIEKALWDAKLDKPQIDDIVL 289


>UniRef50_UPI00005A1D5B Cluster: PREDICTED: similar to heat shock
           protein 8; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to heat shock protein 8 - Canis familiaris
          Length = 348

 Score =  136 bits (329), Expect = 5e-31
 Identities = 64/84 (76%), Positives = 76/84 (90%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           +SSTQASIEI SL+EG +F+TSIT A+FEELNADLF  T++PVEK+L+DAK+DK+QIHDI
Sbjct: 114 TSSTQASIEIGSLYEGNNFFTSITCAQFEELNADLFHGTLDPVEKALQDAKLDKSQIHDI 173

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            LVG ST IPK+QKLLQDFFNGKE
Sbjct: 174 FLVGDSTHIPKIQKLLQDFFNGKE 197



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 42/72 (58%), Positives = 42/72 (58%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVM  LIK 
Sbjct: 196 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMIVLIKH 255

Query: 681 NTTIPTKQTQTF 716
           N TIPTKQTQTF
Sbjct: 256 NITIPTKQTQTF 267


>UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 599

 Score =  135 bits (327), Expect = 9e-31
 Identities = 60/81 (74%), Positives = 72/81 (88%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RN+ IFDLGGGTFDVS+LTI++ +F VK+TAGDTHLGGED DNR+V +FV EFKRK+ KD
Sbjct: 171 RNIFIFDLGGGTFDVSLLTIKNNVFVVKATAGDTHLGGEDLDNRIVKYFVDEFKRKHNKD 230

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ N +ALRRLRTACERAKRT
Sbjct: 231 ISGNPKALRRLRTACERAKRT 251



 Score =  116 bits (278), Expect = 8e-25
 Identities = 53/88 (60%), Positives = 70/88 (79%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS   +A+I+ID+L+EGIDF +S+TRA+FE+LN DLF   ME VE  L DAKM+K+ 
Sbjct: 249 KRTLSFDIEAAIDIDALYEGIDFNSSVTRAKFEQLNMDLFEKCMETVESCLTDAKMNKSS 308

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           + D+VL+GGS+RIPKVQ+LLQ FFN K+
Sbjct: 309 VDDVVLIGGSSRIPKVQELLQHFFNWKD 336



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 28/86 (32%), Positives = 34/86 (39%), Gaps = 1/86 (1%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXIL-HGDKSEEVQDXXXXXXXXXXXG 638
           P+  E    F  WK    SINPDE           +L  G KS    D           G
Sbjct: 322 PKVQELLQHFFNWKDLCVSINPDEAVAYGAAVKAALLCEGTKSS--LDLVLQDVTPLSLG 379

Query: 639 IETAGGVMTTLIKRNTTIPTKQTQTF 716
               G VM  +I RNT IP K+T+ +
Sbjct: 380 KSIRGDVMDIVIPRNTPIPVKKTKNY 405


>UniRef50_P02826 Cluster: Heat shock 70 kDa protein cognate 1; n=2;
           melanogaster subgroup|Rep: Heat shock 70 kDa protein
           cognate 1 - Drosophila simulans (Fruit fly)
          Length = 214

 Score =  126 bits (305), Expect = 4e-28
 Identities = 60/71 (84%), Positives = 65/71 (91%)
 Frame = +2

Query: 41  GTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRR 220
           GTFDVS+LTIEDG FEVK+TAGDTHLG EDFDNR+VNH VQEF+RK+ KDL  NKRALRR
Sbjct: 105 GTFDVSVLTIEDG-FEVKATAGDTHLGREDFDNRLVNHLVQEFQRKHGKDLGQNKRALRR 163

Query: 221 LRTACERAKRT 253
           LRTACERAKRT
Sbjct: 164 LRTACERAKRT 174



 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 37/43 (86%), Positives = 39/43 (90%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRST 372
           K  LSSSTQASIEIDSLFEG+DFYTS+TRARFEELN DLFR T
Sbjct: 172 KRTLSSSTQASIEIDSLFEGVDFYTSVTRARFEELNGDLFRGT 214


>UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78); n=736;
           root|Rep: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78) - Homo
           sapiens (Human)
          Length = 654

 Score =  122 bits (295), Expect = 7e-27
 Identities = 57/91 (62%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LSS  QA IEI+S +EG DF  ++TRA+FEELN DLFRSTM+PV+K L D+ + K
Sbjct: 294 KAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKK 353

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + I +IVLVGGSTRIPK+Q+L+++FFNGKEP
Sbjct: 354 SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEP 384



 Score =  114 bits (274), Expect = 2e-24
 Identities = 48/87 (55%), Positives = 69/87 (79%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ HF++ +K+K  KD
Sbjct: 218 KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKD 277

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           +  + RA+++LR   E+AKR     H+
Sbjct: 278 VRKDNRAVQKLRREVEKAKRALSSQHQ 304



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 31/85 (36%), Positives = 41/85 (48%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           +L GD  ++  D           GI
Sbjct: 369 PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD--QDTGDLVLLDVCPLTLGI 426

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI RNT +PTK++Q F
Sbjct: 427 ETVGGVMTKLIPRNTVVPTKKSQIF 451


>UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome
           shotgun sequence; n=3; Fungi/Metazoa group|Rep:
           Chromosome 3 SCAF9564, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 414

 Score =  122 bits (294), Expect = 9e-27
 Identities = 60/84 (71%), Positives = 71/84 (84%), Gaps = 1/84 (1%)
 Frame = +1

Query: 259 SSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPV-EKSLRDAKMDKAQIHDI 435
           + +QASIEIDSLFEGIDFYTSITRARFEEL  DLF+  +  +  K LRD K+DK  I+DI
Sbjct: 167 AGSQASIEIDSLFEGIDFYTSITRARFEELCGDLFQVQLWNLWRKPLRDTKLDKGHINDI 226

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
           VLVGGSTRIP++QKLL+DFFNG+E
Sbjct: 227 VLVGGSTRIPRIQKLLRDFFNGRE 250



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 41/69 (59%), Positives = 41/69 (59%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GD S  VQD           GIETAGGVMT LIKRNTT
Sbjct: 252 NKSINPDEAVAYGAAVQAAILTGDTSGNVQDLLLQDVAPLSLGIETAGGVMTALIKRNTT 311

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 312 IPTKQTQIF 320


>UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep:
           GLP_623_6850_8883 - Giardia lamblia ATCC 50803
          Length = 677

 Score =  117 bits (281), Expect = 3e-25
 Identities = 52/88 (59%), Positives = 71/88 (80%)
 Frame = +1

Query: 241 GKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKA 420
           GK  LS+++   I +DSL +GIDF  S+TRA+FEELN DLF+ +++PVE+ LRDAK+   
Sbjct: 315 GKRQLSTASSVQIVVDSLIDGIDFSESLTRAKFEELNIDLFKKSIKPVEQVLRDAKLKTT 374

Query: 421 QIHDIVLVGGSTRIPKVQKLLQDFFNGK 504
            I ++VLVGGSTRIPK+++LLQD+FNGK
Sbjct: 375 DIDEVVLVGGSTRIPKIRQLLQDYFNGK 402



 Score = 95.9 bits (228), Expect = 9e-19
 Identities = 48/94 (51%), Positives = 65/94 (69%), Gaps = 11/94 (11%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +N+L+FD GGGT DVSIL+++ G+FEV +TAG+THLGGEDFD R+++HF+  FK+K 
Sbjct: 224 GKAKNILVFDCGGGTHDVSILSVDSGVFEVLATAGNTHLGGEDFDRRLLDHFIAIFKKKN 283

Query: 182 KKDLA-TN----------KRALRRLRTACERAKR 250
             DL+ TN          K+A+ RLR   E  KR
Sbjct: 284 NIDLSITNTGDKAKDMAVKKAISRLRREIEAGKR 317



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 28/72 (38%), Positives = 35/72 (48%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NK IN DE           IL G K  +V             GIET GG+MT LI+R
Sbjct: 402 KALNKDINADEAVAWGAAVQASILSGAKDHDV---LLIDVTPLTLGIETQGGIMTPLIER 458

Query: 681 NTTIPTKQTQTF 716
           N+ IP K+++ F
Sbjct: 459 NSYIPVKKSKIF 470


>UniRef50_Q4P629 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 417

 Score =  116 bits (279), Expect = 6e-25
 Identities = 51/88 (57%), Positives = 70/88 (79%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS TQ ++E+DSLF+G+DF  +ITRARFEE+NA  F+ T+EPV K L+D+K+   +
Sbjct: 89  KRTLSSVTQTTVEVDSLFQGVDFQANITRARFEEINAAAFKGTIEPVAKVLKDSKIPADK 148

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           + DIVLVGGSTRIPK+Q L+ +FF G++
Sbjct: 149 VDDIVLVGGSTRIPKIQSLISEFFGGRQ 176



 Score =  106 bits (254), Expect = 6e-22
 Identities = 47/70 (67%), Positives = 60/70 (85%)
 Frame = +2

Query: 44  TFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRL 223
           TFDVS+L I  G+F VK+TAGDTHLGGEDFDN +++HF +EF+RK K D++ + RA+RRL
Sbjct: 22  TFDVSLLNITGGVFAVKATAGDTHLGGEDFDNALLDHFKKEFERKNKLDISGDARAVRRL 81

Query: 224 RTACERAKRT 253
           R+ACERAKRT
Sbjct: 82  RSACERAKRT 91



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 21/69 (30%), Positives = 29/69 (42%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           +L    S++  D           G+   G V   ++ RNT 
Sbjct: 178 NKSINPDE--------AAAVLTNQTSDKTADLLLLDVAPLSLGVAMQGDVFGVVVPRNTP 229

Query: 690 IPTKQTQTF 716
           IP  +T+ F
Sbjct: 230 IPCNKTRVF 238


>UniRef50_Q7YUE0 Cluster: Hsp70 protein; n=1; Milnesium
           tardigradum|Rep: Hsp70 protein - Milnesium tardigradum
          Length = 203

 Score =  113 bits (272), Expect = 4e-24
 Identities = 49/82 (59%), Positives = 66/82 (80%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           T + +L++DLGGGTFDVSILT+EDGIFEVK+  GD+HLGGEDFDN +V+  + E KR++ 
Sbjct: 26  TEKTILVYDLGGGTFDVSILTMEDGIFEVKAVNGDSHLGGEDFDNNVVSFLISEIKREHD 85

Query: 185 KDLATNKRALRRLRTACERAKR 250
            DL+ +KRA+ +LR A E AK+
Sbjct: 86  VDLSKDKRAIGKLRAAAENAKK 107


>UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 592

 Score =  111 bits (268), Expect = 1e-23
 Identities = 52/87 (59%), Positives = 67/87 (77%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS +   +IEIDSLF+G D ++SITRA+FEE+N DLF   +E V+    D +MDK+ 
Sbjct: 255 KRILSFAVITTIEIDSLFQGFDLFSSITRAKFEEINMDLFTECLETVKSCFADVEMDKSA 314

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           IHD+VLVGGS+RIPKVQ+LLQ+FF GK
Sbjct: 315 IHDVVLVGGSSRIPKVQQLLQEFFAGK 341



 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 42/59 (71%), Positives = 52/59 (88%)
 Frame = +2

Query: 74  DGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRLRTACERAKR 250
           D +F+VK+ AG+THLGGEDFDNRMVN+F +EFK+K K D++ N RALRRL+TACERAKR
Sbjct: 198 DKVFQVKAIAGNTHLGGEDFDNRMVNYFAREFKKKNKVDISENSRALRRLKTACERAKR 256



 Score = 36.3 bits (80), Expect = 0.76
 Identities = 22/67 (32%), Positives = 31/67 (46%)
 Frame = +3

Query: 516 SINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIP 695
           SINPDE           +L  D  + V +           GIE  G +M  +I RNT+IP
Sbjct: 346 SINPDEAVAYGAAVQAALLSED-FKNVPNLVVQDVAPLSLGIEVIGDIMGVVIARNTSIP 404

Query: 696 TKQTQTF 716
            K+T+ +
Sbjct: 405 IKKTKGY 411


>UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n=2;
           Trichomonas vaginalis|Rep: Heat shock cognate protein,
           putative - Trichomonas vaginalis G3
          Length = 622

 Score =  107 bits (258), Expect = 2e-22
 Identities = 47/86 (54%), Positives = 62/86 (72%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           N+L++DLGGGTFD+S+LT+ED  FEV +T+GDTHLGGEDFD R+V HF   F+RK  K+ 
Sbjct: 206 NILVYDLGGGTFDISLLTVEDSFFEVLATSGDTHLGGEDFDIRLVEHFADVFQRKTGKNP 265

Query: 194 ATNKRALRRLRTACERAKRTCHRPHK 271
             N R++  L+  CE AKR     H+
Sbjct: 266 RNNPRSMAILKRECEHAKRVLTFEHQ 291



 Score =  100 bits (240), Expect = 3e-20
 Identities = 51/112 (45%), Positives = 71/112 (63%)
 Frame = +1

Query: 169 QEEIQKGPRYQQESS*AFAYCM*EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEEL 348
           Q +  K PR    S           K  L+   Q  IEI++ +EG+ F   +TRARFEEL
Sbjct: 258 QRKTGKNPRNNPRSMAILKRECEHAKRVLTFEHQTQIEIENFYEGLSFSEPLTRARFEEL 317

Query: 349 NADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           N DLFR T++P+ + L DA + K +I +IVLVGGSTRI K+Q+L++++FNGK
Sbjct: 318 NMDLFRKTIQPITQVLDDANLMKHEIDEIVLVGGSTRIIKIQQLVREYFNGK 369



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 27/72 (37%), Positives = 34/72 (47%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K   KSINPDE           IL+ +      D           GIET GG+M+ +I R
Sbjct: 369 KSLCKSINPDEAVANGAAVEGAILNNEV-----DILLHNINPLTLGIETVGGLMSEVIPR 423

Query: 681 NTTIPTKQTQTF 716
           NT IP  +T+TF
Sbjct: 424 NTRIPVTKTRTF 435


>UniRef50_Q3UYY6 Cluster: 13 days embryo forelimb cDNA, RIKEN
           full-length enriched library, clone:5930424B19
           product:hypothetical protein, full insert sequence; n=3;
           Murinae|Rep: 13 days embryo forelimb cDNA, RIKEN
           full-length enriched library, clone:5930424B19
           product:hypothetical protein, full insert sequence - Mus
           musculus (Mouse)
          Length = 101

 Score =  106 bits (255), Expect = 5e-22
 Identities = 55/81 (67%), Positives = 59/81 (72%)
 Frame = -2

Query: 252 VLFALSHXXXXXXXXXXXXXRSFLYFLLNSWTKWLTMRLSKSSPPKWVSPAVDFTSKIPS 73
           VL ALSH              SFL FLLNS TKWLT RLSKSSPP+ VSPAV FTSK+PS
Sbjct: 19  VLLALSHAVRSRRTARLFWLMSFLCFLLNSSTKWLTSRLSKSSPPRCVSPAVAFTSKMPS 78

Query: 72  SMVRMDTSKVPPPRSKISTFR 10
           S+VRMDTS VPPPRSK+ST R
Sbjct: 79  SIVRMDTSNVPPPRSKMSTCR 99


>UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella
           natans|Rep: Chaperone HSP70 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 610

 Score =  106 bits (255), Expect = 5e-22
 Identities = 49/82 (59%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY-KK 187
           R+VLIFDLGGGTFDVSIL I+ G+FEVK+T G+THLGGEDFD  + ++ + EF++K+   
Sbjct: 177 RSVLIFDLGGGTFDVSILCIDGGVFEVKATHGNTHLGGEDFDRALADYIISEFEKKHPNT 236

Query: 188 DLATNKRALRRLRTACERAKRT 253
           +L  + RA RR+++A ERAKRT
Sbjct: 237 NLRKDDRAYRRIKSASERAKRT 258



 Score =   99 bits (238), Expect = 5e-20
 Identities = 49/88 (55%), Positives = 62/88 (70%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS T A IE+D+L +GIDF   +TRARFEE+   LF+  ++PV   +RDA   K +
Sbjct: 256 KRTLSSKTSAQIELDALIDGIDFSLMLTRARFEEICEPLFKKLVDPVLNCIRDAGYAKKK 315

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIP V+ LL + F G+E
Sbjct: 316 IHDIVLVGGSTRIPAVRDLLAEQFKGRE 343



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 21/69 (30%), Positives = 30/69 (43%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           + +INPDE           IL G + + V             GIET G     ++ +N+T
Sbjct: 345 SNNINPDEAVAYGAAIQGAILAGLEDDTVNQLLLLDVIPLSLGIETEGRFNEVVVPKNST 404

Query: 690 IPTKQTQTF 716
           IPT + Q F
Sbjct: 405 IPTTRDQMF 413


>UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2;
           Ostreococcus|Rep: Heat Shock Protein 70, cytosolic -
           Ostreococcus lucimarinus CCE9901
          Length = 711

 Score =  104 bits (250), Expect = 2e-21
 Identities = 47/79 (59%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           +L+FDLGGGTFDVS+L ++DG+FEV STAGDTHLGGEDFD  +     +E +++   D+ 
Sbjct: 365 ILVFDLGGGTFDVSLLNLQDGVFEVLSTAGDTHLGGEDFDTSLAAFAQKEIEKERGADIF 424

Query: 197 T-NKRALRRLRTACERAKR 250
           T +++ALR+LRTACE+AKR
Sbjct: 425 TGDEKALRKLRTACEKAKR 443



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 36/90 (40%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEG-IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMD 414
           + K +LS +  A+IE    F G I+    ITR +FE++    F+  ++ V++ L DA   
Sbjct: 440 KAKRELSVANHANIEC---FIGEIEINMKITREQFEKVCEPTFQRCLDSVKRVLSDAGKK 496

Query: 415 KAQIHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           K ++ +IVLVGGSTR+P+VQ +L ++F+GK
Sbjct: 497 KEEVDEIVLVGGSTRVPRVQGILTEYFDGK 526



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/72 (27%), Positives = 30/72 (41%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKS++PDE           IL G + ++              G+E  G     +++R
Sbjct: 526 KTLNKSVHPDEAVAYGAAVQGAILAGVRDKQTSRVLLMDVVPLSLGVECEGRQFAKVVQR 585

Query: 681 NTTIPTKQTQTF 716
           NT IP K+   F
Sbjct: 586 NTAIPCKKKSEF 597


>UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular
           organisms|Rep: Chaperone protein dnaK1 - Streptomyces
           avermitilis
          Length = 622

 Score =  104 bits (250), Expect = 2e-21
 Identities = 47/79 (59%), Positives = 63/79 (79%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + +L+FDLGGGTFDVS+L I DG+ EVK+T GD HLGG+D+D R+V++ VQ+FK  +  D
Sbjct: 162 QTILVFDLGGGTFDVSLLEIGDGVVEVKATNGDNHLGGDDWDQRVVDYLVQQFKAGHGVD 221

Query: 191 LATNKRALRRLRTACERAK 247
           LA +K AL+RLR A E+AK
Sbjct: 222 LAKDKMALQRLREAAEKAK 240



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 35/94 (37%), Positives = 58/94 (61%), Gaps = 4/94 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIE---IDSLFEG-IDFYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSST+ SI    I +  EG +     +TRA+F++L ADL      P    ++DA
Sbjct: 238 KAKIELSSSTETSINLPYITASAEGPLHLDEKLTRAQFQQLTADLLERCKTPFHNVIKDA 297

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
            ++ ++I  +VLVGGSTR+P V +L+++   G++
Sbjct: 298 GINLSEIDHVVLVGGSTRMPAVAELVKELTGGQD 331



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 34/85 (40%), Positives = 43/85 (50%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P  AE        + ANK +NPDE           +L G    EV+D           GI
Sbjct: 317 PAVAELVKELTGGQDANKGVNPDEVVAIGAALQAGVLKG----EVKDVLLLDVTPLSLGI 372

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GG+MT LI+RNTTIPTK+++ F
Sbjct: 373 ETKGGIMTKLIERNTTIPTKRSEIF 397


>UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 593

 Score =  104 bits (249), Expect = 3e-21
 Identities = 44/78 (56%), Positives = 62/78 (79%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NVL++DLGGGT DVS+L + +G F VK+TAG +HLGGEDFD+++VN+ V +  +++K+D+
Sbjct: 186 NVLVYDLGGGTLDVSLLEVTEGKFTVKATAGISHLGGEDFDDQLVNYLVSDINKQFKEDI 245

Query: 194 ATNKRALRRLRTACERAK 247
             N R L RL+ ACERAK
Sbjct: 246 LRNPRVLMRLKLACERAK 263



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 34/84 (40%), Positives = 60/84 (71%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS+ +Q +IE+DSL  G D+   +TRA+FE L   LF+ T++P+++ LR+   ++  + +
Sbjct: 266 LSAYSQTTIELDSLVGGHDYSVIVTRAKFENLCLGLFKRTLDPIKQVLRE--NNECHVDE 323

Query: 433 IVLVGGSTRIPKVQKLLQDFFNGK 504
           IV+VGGS++IPK+Q+++  +F  K
Sbjct: 324 IVMVGGSSKIPKIQEIVSSYFGNK 347


>UniRef50_Q2VA67 Cluster: Putative heat schock protein 70; n=1;
           Theileria sp. China|Rep: Putative heat schock protein 70
           - Theileria sp. China
          Length = 372

 Score =  103 bits (248), Expect = 3e-21
 Identities = 47/58 (81%), Positives = 52/58 (89%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKR 175
           G  +NVLIFDLGGGTFDVSILTIEDGIFEVK+TAGDTHLGGEDFDN +V H V++F R
Sbjct: 46  GGEKNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNLLVEHCVRDFMR 103


>UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular
           organisms|Rep: Chaperone protein dnaK - Brucella
           melitensis
          Length = 637

 Score =  102 bits (245), Expect = 8e-21
 Identities = 47/79 (59%), Positives = 61/79 (77%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + + ++DLGGGTFDVS+L I DG+FEVKST GDT LGGEDFD R+V + V EFK++   D
Sbjct: 187 KTIAVYDLGGGTFDVSVLEIGDGVFEVKSTNGDTFLGGEDFDIRLVEYLVAEFKKESGID 246

Query: 191 LATNKRALRRLRTACERAK 247
           L  +K AL+RL+ A E+AK
Sbjct: 247 LKNDKLALQRLKEAAEKAK 265



 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 37/95 (38%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSS Q  I +  +             ++RA+FE L  DL + T+EP + +L+DA
Sbjct: 263 KAKIELSSSQQTEINLPFITADQTGPKHLAIKLSRAKFESLVDDLVQRTVEPCKAALKDA 322

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            +   +I ++VLVGG TR+PK+Q++++ FF GKEP
Sbjct: 323 GLKAGEIDEVVLVGGMTRMPKIQEVVKAFF-GKEP 356



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 32/72 (44%), Positives = 39/72 (54%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  +K +NPDE           +L GD    V+D           GIET GGV T LI+R
Sbjct: 354 KEPHKGVNPDEVVAMGAAIQGGVLQGD----VKDVLLLDVTPLSLGIETLGGVFTRLIER 409

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++QTF
Sbjct: 410 NTTIPTKKSQTF 421


>UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|Rep:
           Chaperone protein DnaK - Roseiflexus sp. RS-1
          Length = 624

 Score =  102 bits (244), Expect = 1e-20
 Identities = 43/77 (55%), Positives = 62/77 (80%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           +L+FDLGGGTFDVS+L + DG+ EVK+T GDTHLGG+D+D R+VN  + EF++    DL+
Sbjct: 189 ILVFDLGGGTFDVSVLEVGDGVVEVKATNGDTHLGGDDYDQRIVNWLIDEFRKDQGIDLS 248

Query: 197 TNKRALRRLRTACERAK 247
            +++AL+RL+ A E+AK
Sbjct: 249 KDRQALQRLKEAAEKAK 265



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 30/72 (41%), Positives = 40/72 (55%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N+S+NPDE           +L GD    V+D           G+ET GGVMT LI+R
Sbjct: 354 KEPNRSVNPDEVVAIGAAIQAGVLGGD----VKDVVLLDVTPLSLGVETLGGVMTKLIER 409

Query: 681 NTTIPTKQTQTF 716
           NTTIPT++++ F
Sbjct: 410 NTTIPTRKSEIF 421



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 27/63 (42%), Positives = 41/63 (65%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           ++RA+FE+L ADL      P  ++L+DA +    + ++VLVGGSTR+P V  L++    G
Sbjct: 295 LSRAKFEQLTADLTERLKGPFFQALKDAGLKPGDLDEVVLVGGSTRMPVVIDLVRK-LTG 353

Query: 502 KEP 510
           KEP
Sbjct: 354 KEP 356


>UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole genome
           shotgun sequence; n=3; core eudicotyledons|Rep:
           Chromosome chr18 scaffold_24, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 667

 Score =  102 bits (244), Expect = 1e-20
 Identities = 46/77 (59%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           +L+FDLGGGTFDVS+L + DG+FEV ST+GDTHLGG+DFD R+V+   Q FKR    DL 
Sbjct: 222 ILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDWLAQNFKRDEGIDLL 281

Query: 197 TNKRALRRLRTACERAK 247
            +K+AL+RL    E+AK
Sbjct: 282 KDKQALQRLTETAEKAK 298



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIE---IDSLFEGIDFY-TSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS TQ +I    I +  EG     T++TRA+FEEL +DL      PVE +LRDA
Sbjct: 296 KAKIELSSLTQTNISLPFITATSEGPKHIETTLTRAKFEELCSDLLDRLRTPVETALRDA 355

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           K+    + +++LVGGSTRIP VQ L++    GKEP
Sbjct: 356 KLSFKDLDEVILVGGSTRIPAVQDLVRK-MTGKEP 389



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 27/72 (37%), Positives = 36/72 (50%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N ++NPDE           +L GD S  V             G+ET GGVMT +I R
Sbjct: 387 KEPNVTVNPDEVVALGAAVQAGVLAGDVSNIV----LLDVTPLSLGLETLGGVMTKIIPR 442

Query: 681 NTTIPTKQTQTF 716
           NTT+PT +++ F
Sbjct: 443 NTTLPTSKSEVF 454


>UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular
           organisms|Rep: Chaperone protein dnaK - Lactobacillus
           johnsonii
          Length = 624

 Score =  102 bits (244), Expect = 1e-20
 Identities = 45/78 (57%), Positives = 62/78 (79%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           VL++DLGGGTFDVSIL + DG+F+V ST GDTHLGG+DFD R+++  +Q FK +   DL+
Sbjct: 165 VLVYDLGGGTFDVSILQLGDGVFQVLSTNGDTHLGGDDFDQRIMDWLIQNFKEENGVDLS 224

Query: 197 TNKRALRRLRTACERAKR 250
            +K AL+RL+ A E+AK+
Sbjct: 225 NDKMALQRLKDAAEKAKK 242



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 39/95 (41%), Positives = 55/95 (57%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLS--SSTQASIEIDSLFEG--IDFYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K+DLS  SST  S+   S  E   +     +TRA+F+EL  DL + T    + +L DA
Sbjct: 239 KAKKDLSGVSSTHISLPFISAGEAGPLHLEADLTRAKFDELTDDLVQKTKVAFDNALSDA 298

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            +    I  ++L GGSTRIP VQK ++D + GKEP
Sbjct: 299 GLTVNDIDKVILNGGSTRIPAVQKAVKD-WAGKEP 332



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 30/72 (41%), Positives = 36/72 (50%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  + SINPDE           ++ GD    V+D           GIET GGV T LI R
Sbjct: 330 KEPDHSINPDEAVALGAAIQGGVISGD----VKDIVLLDVTPLSLGIETMGGVFTKLIDR 385

Query: 681 NTTIPTKQTQTF 716
           NTTIPT ++Q F
Sbjct: 386 NTTIPTSKSQIF 397


>UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial
           precursor; n=291; root|Rep: Stress-70 protein,
           mitochondrial precursor - Homo sapiens (Human)
          Length = 679

 Score =  101 bits (242), Expect = 2e-20
 Identities = 45/77 (58%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFD+SIL I+ G+FEVKST GDT LGGEDFD  ++ H V+EFKR+   DL 
Sbjct: 240 IAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLT 299

Query: 197 TNKRALRRLRTACERAK 247
            +  AL+R+R A E+AK
Sbjct: 300 KDNMALQRVREAAEKAK 316



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSS Q  I +  L             +TRA+FE +  DL R T+ P +K+++DA
Sbjct: 314 KAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDA 373

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           ++ K+ I +++LVGG TR+PKVQ+ +QD F G+ P
Sbjct: 374 EVSKSDIGEVILVGGMTRMPKVQQTVQDLF-GRAP 407



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           +  +K++NPDE           +L GD    V D           GIET GGV T LI R
Sbjct: 405 RAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINR 460

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 461 NTTIPTKKSQVF 472


>UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock
           protein protein; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 502

 Score =  101 bits (241), Expect = 2e-20
 Identities = 50/91 (54%), Positives = 68/91 (74%), Gaps = 4/91 (4%)
 Frame = +1

Query: 247 EDLSSSTQASIEIDS----LFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMD 414
           E  SSST   IE+      LFEG++FYTSI+R + EEL +DLF+  ++PVE+ L +AK+D
Sbjct: 204 ERASSSTHCCIEVIFSKLYLFEGLNFYTSISRTKIEELCSDLFQKCLQPVERVLLNAKID 263

Query: 415 KAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           K +I  ++LVG STRIPK+QKLLQ+F +GKE
Sbjct: 264 KKRIDTVILVGASTRIPKIQKLLQEFLDGKE 294



 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 45/70 (64%), Positives = 53/70 (75%)
 Frame = +2

Query: 50  DVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRLRT 229
           DVS+L IEDGIFEV +TAGD H GGEDFD+R+V+H V+EFK + K DL TN  AL RLR 
Sbjct: 142 DVSLLVIEDGIFEVLTTAGDAHFGGEDFDSRLVSHLVEEFKSRNKIDLMTNCIALHRLRK 201

Query: 230 ACERAKRTCH 259
           A ERA  + H
Sbjct: 202 AVERASSSTH 211



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 28/76 (36%), Positives = 35/76 (46%)
 Frame = +3

Query: 489 FL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTT 668
           FL  K  N SINP+E            LH     E+Q            GIETA   MT+
Sbjct: 289 FLDGKEFNMSINPEEVVAHGAA-----LHAVTVSEIQVFACFHVAPLSLGIETAAVSMTS 343

Query: 669 LIKRNTTIPTKQTQTF 716
           +I RNT +PT+ +Q F
Sbjct: 344 IIDRNTMVPTRVSQRF 359


>UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 70;
           n=11; Entamoeba histolytica|Rep: Mitochondrial-type heat
           shock protein 70 - Entamoeba histolytica
          Length = 598

 Score =  101 bits (241), Expect = 2e-20
 Identities = 42/79 (53%), Positives = 60/79 (75%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+ ++DLGGGTFD+SIL I  GIF+VK+T GDT LGGEDFD  +  +  +EF+RKYK++
Sbjct: 192 KNIAVYDLGGGTFDISILNINKGIFQVKATNGDTMLGGEDFDKAICQYIEKEFERKYKRN 251

Query: 191 LATNKRALRRLRTACERAK 247
           L  NK+ + R++ A E+ K
Sbjct: 252 LQRNKKGISRIKEAAEKVK 270



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 33/89 (37%), Positives = 53/89 (59%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K +LSSS ++ I +  L        +I+R + E+L   + + T  P  + ++DAK+ K  
Sbjct: 270 KCELSSSEESVISLPYLDGQDSLEITISRRKIEQLRKGICKRTEYPCLQCMKDAKLRKKD 329

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I D+VLVGG TR+P +Q  +Q+ F GK+P
Sbjct: 330 ISDVVLVGGMTRMPLIQNTVQEIF-GKKP 357



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 29/72 (40%), Positives = 36/72 (50%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  +K++NPDE           I+ G K    +D           GIET GGVMT LI R
Sbjct: 355 KKPSKNVNPDEAVAIGAAIQASIIEGKK----KDIILVDVTPLTLGIETYGGVMTPLINR 410

Query: 681 NTTIPTKQTQTF 716
           NTTIPT  ++ F
Sbjct: 411 NTTIPTSVSKEF 422


>UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular
           organisms|Rep: Chaperone protein dnaK1 - Synechocystis
           sp. (strain PCC 6803)
          Length = 692

 Score =  101 bits (241), Expect = 2e-20
 Identities = 45/81 (55%), Positives = 62/81 (76%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           T   +L+FDLGGGTFDVS+L + +G+FEV ST+G+ HLGG+DFDN +V    + FK+K  
Sbjct: 184 TEELILVFDLGGGTFDVSLLQLGNGVFEVLSTSGNNHLGGDDFDNCVVQWMAESFKQKEN 243

Query: 185 KDLATNKRALRRLRTACERAK 247
            DL+T+K A++RLR A E+AK
Sbjct: 244 IDLSTDKMAIQRLREAAEKAK 264



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 24/58 (41%), Positives = 41/58 (70%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFF 495
           + R++FEEL   L   T  P+ ++L D ++  + +H ++LVGGSTRIP +Q+++Q+FF
Sbjct: 294 LARSQFEELTKQLLEDTRVPLTQALDDGEIRASDVHRVILVGGSTRIPAIQRVIQEFF 351



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/68 (35%), Positives = 35/68 (51%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           +S+NPDE           ++ G    EV+D           G+ET G V T +I+RNTTI
Sbjct: 358 RSVNPDEAVALGAAIQAGVIGG----EVEDVLLLDVTPLSLGLETLGEVTTKIIERNTTI 413

Query: 693 PTKQTQTF 716
           PT +++ F
Sbjct: 414 PTSRSEVF 421


>UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellular
           organisms|Rep: Chaperone protein dnaK3 - Synechocystis
           sp. (strain PCC 6803)
          Length = 771

 Score = 99.5 bits (237), Expect = 7e-20
 Identities = 45/82 (54%), Positives = 61/82 (74%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  + +L+FDLGGGTFDVS+L + DGIFEVK+T+GDT LGG DFD R+V+   ++F    
Sbjct: 184 GRIQKILVFDLGGGTFDVSVLEVGDGIFEVKATSGDTQLGGNDFDRRIVDWLAEKFLEAE 243

Query: 182 KKDLATNKRALRRLRTACERAK 247
           K DL  +++AL+RL  A E+AK
Sbjct: 244 KVDLRQDRQALQRLTEAAEKAK 265



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 27/65 (41%), Positives = 43/65 (66%)
 Frame = +1

Query: 316 TSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFF 495
           T ++R+ FE+L  DL      PV++ L+DA +   QI ++VLVGG TR+P V+ L++ F 
Sbjct: 293 TQLSRSEFEDLCGDLVTRLQRPVKRVLKDAGLSPVQIDEVVLVGGGTRMPMVKGLVRSFI 352

Query: 496 NGKEP 510
           + +EP
Sbjct: 353 D-REP 356



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 26/69 (37%), Positives = 35/69 (50%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           N+++NPDE           IL G    EV+D           G+ET GGVM  L+ RNTT
Sbjct: 357 NENVNPDEVVAIGAAIQAGILDG----EVKDILLLDVTPLSFGLETIGGVMKKLLPRNTT 412

Query: 690 IPTKQTQTF 716
           IP +++  F
Sbjct: 413 IPVRKSDIF 421


>UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular
           organisms|Rep: Chaperone protein dnaK - Chlamydophila
           caviae
          Length = 664

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 43/79 (54%), Positives = 60/79 (75%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + + +FDLGGGTFD+SIL I DG+FEV ST GDTHLGG+DFD  ++   ++EFK++   D
Sbjct: 190 KKIAVFDLGGGTFDISILEIGDGVFEVLSTNGDTHLGGDDFDEVIIKWMIEEFKKQEGID 249

Query: 191 LATNKRALRRLRTACERAK 247
           L+ +  AL+RL+ A E+AK
Sbjct: 250 LSKDNMALQRLKDAAEKAK 268



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 29/64 (45%), Positives = 45/64 (70%)
 Frame = +1

Query: 319 SITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFN 498
           ++TRA FE+L + L   T  P +K+L DAK+  + I D++LVGG +R+P VQ++++  F 
Sbjct: 297 TLTRAHFEKLASTLLERTKAPCQKALADAKLSASDIDDVLLVGGMSRMPAVQEVVKSIF- 355

Query: 499 GKEP 510
           GKEP
Sbjct: 356 GKEP 359



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 31/72 (43%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NK +NPDE           +L G    EV+D           GIET GGVMT L++R
Sbjct: 357 KEPNKGVNPDEVVAIGAAIQGGVLGG----EVKDVLLLDVIPLSLGIETLGGVMTPLVER 412

Query: 681 NTTIPTKQTQTF 716
           NTTIPT++ Q F
Sbjct: 413 NTTIPTQKKQIF 424


>UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to heat shock protein - Nasonia vitripennis
          Length = 523

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 42/77 (54%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           VLIFDLGGGTFDVS++T+++ I  V++T+GD HLGGEDF N ++ HF +EF  KY  ++ 
Sbjct: 205 VLIFDLGGGTFDVSVVTMQNDILIVEATSGDQHLGGEDFTNILLEHFTKEFNSKYDCEIQ 264

Query: 197 TNKRALRRLRTACERAK 247
            N+ +++RL  ACE AK
Sbjct: 265 VNEVSVKRLYNACENAK 281



 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 47/88 (53%), Positives = 64/88 (72%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K +LS S  A+I+  +LF+G DF  +ITR +FEEL  +LF+  ++ VE  L DAK+ K+ 
Sbjct: 281 KLELSDSASANIDEFALFDGHDFCATITRDKFEELCDNLFQKILKSVELVLSDAKVQKSD 340

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I +IVLVGGSTRI K+Q +L+DFF GKE
Sbjct: 341 IKNIVLVGGSTRILKIQDMLKDFF-GKE 367



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 19/72 (26%), Positives = 33/72 (45%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  +KSINPDE           ++HG+    +++           G++     M+ LIKR
Sbjct: 366 KELDKSINPDEAVAYGAALQASMIHGN----MENLLLVDVTPLSLGVQVGENEMSILIKR 421

Query: 681 NTTIPTKQTQTF 716
           NT +P  + + +
Sbjct: 422 NTRLPFSKARNY 433


>UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG07033;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG07033 - Caenorhabditis
           briggsae
          Length = 547

 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 43/83 (51%), Positives = 61/83 (73%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           +RRN+LI+DLGGGTFDV+++ +E     VK+  GDTHLGG+D DN ++   ++EFKR++ 
Sbjct: 149 SRRNILIYDLGGGTFDVAVVNVEGPRITVKAKGGDTHLGGQDIDNIIMIKIIEEFKRRHG 208

Query: 185 KDLATNKRALRRLRTACERAKRT 253
            DL  N RAL+R+R + E AK T
Sbjct: 209 MDLKGNYRALKRVRKSAETAKIT 231


>UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 946

 Score = 96.3 bits (229), Expect = 7e-19
 Identities = 43/86 (50%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RN+L++DLGGGTFDVS++T    ++EV+++ GD+HLGGEDFDN +V++F  EF   Y  +
Sbjct: 192 RNLLVYDLGGGTFDVSLVTHCKDVYEVRASDGDSHLGGEDFDNILVDYFASEFIESYPCN 251

Query: 191 LATNKRALRRLRTACERAK-RTCHRP 265
           L ++K ++ +LR  CE AK R C  P
Sbjct: 252 LKSDKTSMAKLRKECESAKRRLCASP 277



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 36/86 (41%), Positives = 53/86 (61%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  L +S    IEI SL++G  F + ++RA+F+EL  DL   TM  V+  +    + K+ 
Sbjct: 270 KRRLCASPSTDIEISSLYDGKAFKSKLSRAKFDELCGDLIMKTMNTVKAVIEAGGIIKSD 329

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNG 501
           + +++LVGGSTRIP VQK +  FF G
Sbjct: 330 VDEVLLVGGSTRIPMVQKEVAKFFEG 355



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 18/86 (20%), Positives = 37/86 (43%)
 Frame = +1

Query: 244  KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
            KE      + +  I    +  DF   I++ +   +  + F      + + L+  ++D  +
Sbjct: 806  KESFGDKDEVTANIYDFLDSTDFVRLISKDKLIAILKNSFNELRRAISEKLKIERVD--E 863

Query: 424  IHDIVLVGGSTRIPKVQKLLQDFFNG 501
            I +IVL G +  +P +Q  +   F G
Sbjct: 864  IDEIVLAGRAANVPGLQNFITRAFKG 889


>UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9;
           Trypanosomatidae|Rep: Heat shock cognate HSP70 protein -
           Trypanosoma brucei brucei
          Length = 676

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 41/84 (48%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVL+FD GGGTFDVSI+++  G+FEVK+T GDTHLGGED D  ++ H + + + +Y
Sbjct: 192 GKERNVLVFDFGGGTFDVSIISVSGGVFEVKATNGDTHLGGEDVDAALLEHALADIRNRY 251

Query: 182 KKDLAT-NKRALRRLRTACERAKR 250
             +  + +++ L +LR+ CE  KR
Sbjct: 252 GIEQGSLSQKMLSKLRSRCEEVKR 275



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 45/111 (40%), Positives = 65/111 (58%), Gaps = 1/111 (0%)
 Frame = +1

Query: 178 IQKGPRYQQESS*AFAYCM*EGKEDLSSSTQASIEIDSLF-EGIDFYTSITRARFEELNA 354
           I++G   Q+  S   + C  E K  LS ST   I +D L  +G ++   +TRAR EEL  
Sbjct: 253 IEQGSLSQKMLSKLRSRCE-EVKRVLSHSTVGEIALDGLLPDGEEYVLKLTRARLEELCT 311

Query: 355 DLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
            +F   +  V+++L+DA M    I D+VLVGGS+RIP VQ  L++ F GK+
Sbjct: 312 KIFARCLSVVQRALKDASMKVEDIEDVVLVGGSSRIPAVQAQLRELFRGKQ 362


>UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial
           precursor; n=18; Ascomycota|Rep: Heat shock protein
           SSQ1, mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 657

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 42/81 (51%), Positives = 60/81 (74%), Gaps = 4/81 (4%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH----FVQEFKRKYK 184
           + ++DLGGGTFD+SIL IEDG+FEV++T GDTHLGGEDFDN +VN+    F+ E     +
Sbjct: 230 IAVYDLGGGTFDISILDIEDGVFEVRATNGDTHLGGEDFDNVIVNYIIDTFIHENPEITR 289

Query: 185 KDLATNKRALRRLRTACERAK 247
           +++  N+  ++RL+   ERAK
Sbjct: 290 EEITKNRETMQRLKDVSERAK 310



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/89 (31%), Positives = 52/89 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K DLS   +  IE+  +++       +T    + +   L   T+ PV+++L+DA ++   
Sbjct: 310 KIDLSHVKKTFIELPFVYKSKHLRVPMTEEELDNMTLSLINRTIPPVKQALKDADIEPED 369

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I +++LVGG TR+PK++ +++D F GK P
Sbjct: 370 IDEVILVGGMTRMPKIRSVVKDLF-GKSP 397



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/72 (37%), Positives = 35/72 (48%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N S+NPDE           IL G    E+++           GIET GG  + LI R
Sbjct: 395 KSPNSSVNPDETVALGAAIQGGILSG----EIKNVLLLDVTPLTLGIETFGGAFSPLIPR 450

Query: 681 NTTIPTKQTQTF 716
           NTT+P K+T+ F
Sbjct: 451 NTTVPVKKTEIF 462


>UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38;
           Bacteria|Rep: Chaperone protein dnaK - Ureaplasma parvum
           (Ureaplasma urealyticum biotype 1)
          Length = 603

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 40/79 (50%), Positives = 59/79 (74%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + +L+FDLGGGTFDVS+L + DG FEV ST+GD HLGG+D+D  ++N  ++    ++  D
Sbjct: 164 QKILVFDLGGGTFDVSVLDMADGTFEVLSTSGDNHLGGDDWDQVIINWLLKSIADEFNID 223

Query: 191 LATNKRALRRLRTACERAK 247
           L+ NK A++RL+ A E+AK
Sbjct: 224 LSKNKMAMQRLKDAAEKAK 242



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 48/78 (61%)
 Frame = +1

Query: 277 IEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGST 456
           I +DS  + I+F   + RA F+ L  +L     +PV  +++++K+    I  +++VGGST
Sbjct: 258 IAMDSSGQPINFEKELNRATFDNLTKNLIERLKKPVLDAMKESKLSLVDIDQVLMVGGST 317

Query: 457 RIPKVQKLLQDFFNGKEP 510
           R+P VQ L+++   GKEP
Sbjct: 318 RMPAVQNLVKE-LTGKEP 334



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 27/72 (37%), Positives = 32/72 (44%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N S+NPDE           +L G    E+ D            IET GGV T LI R
Sbjct: 332 KEPNHSLNPDEVVAIGAAIQGGVLAG----EIDDILLLDVTPLTLSIETMGGVATPLIPR 387

Query: 681 NTTIPTKQTQTF 716
           NT IP  ++Q F
Sbjct: 388 NTKIPVSKSQIF 399


>UniRef50_Q9UQC1 Cluster: Heat shock protein 72; n=10; Fungi/Metazoa
           group|Rep: Heat shock protein 72 - Homo sapiens (Human)
          Length = 151

 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 42/44 (95%), Positives = 44/44 (100%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 142
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR
Sbjct: 107 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNR 150


>UniRef50_A7HBX9 Cluster: 2-alkenal reductase precursor; n=7;
           Cystobacterineae|Rep: 2-alkenal reductase precursor -
           Anaeromyxobacter sp. Fw109-5
          Length = 542

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 38/79 (48%), Positives = 61/79 (77%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + +L++DLGGGTFDVS+L ++  +FEV +T GDT LGG DFDNR++++ +++F R++K D
Sbjct: 192 QKILVYDLGGGTFDVSVLQLQGNVFEVLATGGDTFLGGVDFDNRIIDYVLEDFWRQHKID 251

Query: 191 LATNKRALRRLRTACERAK 247
           LA +  A++R++   E AK
Sbjct: 252 LAGSPIAMQRVKKGAEAAK 270



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 4/93 (4%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEG----IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKM 411
           K DLS     +I++  + E     +D    ++R + ++L  DL   T E  ++ L + ++
Sbjct: 270 KIDLSLIPNVTIDLPFIEEKKGRPLDVRVPLSRQQLDDLCLDLVDRTFEICDQVLAEKRL 329

Query: 412 DKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
               I +I+LVGG +R+P VQ+ +Q  F GK P
Sbjct: 330 RPQDIDEIILVGGQSRMPLVQQKIQQHF-GKPP 361


>UniRef50_A3CIL0 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 382

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 48/78 (61%), Positives = 59/78 (75%)
 Frame = +1

Query: 274 SIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGS 453
           +IEIDSL+EGIDFY++IT ARFEEL  DLFR  M    +  +D +  +A     +LVGGS
Sbjct: 282 TIEIDSLYEGIDFYSNITCARFEELTMDLFRKCM----RGYQDGQ--RAACTMFILVGGS 335

Query: 454 TRIPKVQKLLQDFFNGKE 507
           TRIP+VQ+LLQDFFNGKE
Sbjct: 336 TRIPRVQQLLQDFFNGKE 353



 Score = 46.4 bits (105), Expect(2) = 9e-08
 Identities = 23/37 (62%), Positives = 25/37 (67%)
 Frame = +2

Query: 164 EFKRKYKKDLATNKRALRRLRTACERAKRTCHRPHKR 274
           EFKRK KKD+  N R + RLRTACE AKRT   P  R
Sbjct: 243 EFKRKSKKDITGNPRPVGRLRTACEWAKRTLSPPLPR 279



 Score = 32.7 bits (71), Expect(2) = 9e-08
 Identities = 13/14 (92%), Positives = 14/14 (100%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFD 52
           +NVLIFDLGGGTFD
Sbjct: 229 KNVLIFDLGGGTFD 242


>UniRef50_Q1CWT5 Cluster: DnaK family protein; n=2;
           Cystobacterineae|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 608

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 41/83 (49%), Positives = 58/83 (69%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G   N L+FDLGGGTFDVSIL ++ G+FEV++T GD  LGGEDFD R+V   + +   + 
Sbjct: 185 GFEGNALVFDLGGGTFDVSILEVKSGVFEVRATGGDPRLGGEDFDQRIVQWLLAQVDDEL 244

Query: 182 KKDLATNKRALRRLRTACERAKR 250
           +  ++ + ++LRRL+ A E AKR
Sbjct: 245 RHVVSQDAQSLRRLKVAAESAKR 267



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 34/96 (35%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEG-------IDFYTSITRARFEELNADLFRSTMEPVEKSLRD 402
           K +L+   +ASI +  L +         +  T +TR+ FE L+  L R  ++  E  +R+
Sbjct: 266 KRELTEKEEASIYVAGLGDHSAPGKRMAELETVLTRSFFETLSEPLSRRCLDVCESVMRE 325

Query: 403 AKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           AKMD   +  ++LVGG TR+P V++L+ DFF G+ P
Sbjct: 326 AKMDPHAVDVVLLVGGMTRVPLVRRLVADFF-GRAP 360


>UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 607

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 42/83 (50%), Positives = 59/83 (71%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           +RRN+LI+DLGGGTFDV+ + ++     VK+  GDTHLGG+D DN ++   ++EFK ++ 
Sbjct: 188 SRRNILIYDLGGGTFDVAAVNVDGPRITVKAKGGDTHLGGQDIDNIIMIKMLEEFKNRHG 247

Query: 185 KDLATNKRALRRLRTACERAKRT 253
            DL  N RAL+R+R A E AK T
Sbjct: 248 IDLKGNYRALKRIRKAAEVAKIT 270



 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 37/84 (44%), Positives = 57/84 (67%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+S+ A IE++ L  GIDF   I+R  FE    +L  +T+  VE+ +R+A + K+Q
Sbjct: 268 KITLSASSVARIELECLHLGIDFIMRISRTDFESWIENLLMATVIHVERVIREANLKKSQ 327

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           I++IVLVGGSTRIP ++ +++  F
Sbjct: 328 INEIVLVGGSTRIPILKNIIKQSF 351



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 21/68 (30%), Positives = 31/68 (45%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           +SI+PDE           +L G  +EEVQD           G++     M+ LIK+ T  
Sbjct: 359 ESIHPDEAVAYGAAIMAAVLSG--AEEVQDMRLIDVIPMSIGVQCNRDYMSVLIKKGTVF 416

Query: 693 PTKQTQTF 716
           P  + +TF
Sbjct: 417 PCTKRKTF 424


>UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein;
           n=1; Dictyostelium discoideum AX4|Rep: Heat shock
           protein Hsp70 family protein - Dictyostelium discoideum
           AX4
          Length = 517

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 40/90 (44%), Positives = 65/90 (72%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K +LS+ TQA++EIDSL++G DF+T+ITRARFE++ + L + ++  V + L    M K
Sbjct: 281 KAKRNLSNMTQAALEIDSLYDGRDFFTNITRARFEDMASGLIKGSINAVSQLLEKCNMTK 340

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
            Q+  ++LVGG++RIP VQ  L +FF+ ++
Sbjct: 341 EQVDKVLLVGGASRIPSVQNQLLNFFDNRQ 370



 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 37/89 (41%), Positives = 54/89 (60%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV++FDLGG     S++ +   +FE+     D  + GE FD+ +V HF QEF RKY+ DL
Sbjct: 206 NVMVFDLGGSGVSASMIRVRSKLFEMIGNVSDHTVSGEHFDHVLVQHFTQEFNRKYRCDL 265

Query: 194 ATNKRALRRLRTACERAKRTCHRPHKRAL 280
             N R+  +L++ACE+AKR      + AL
Sbjct: 266 TDNARSKAKLKSACEKAKRNLSNMTQAAL 294


>UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 586

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 40/78 (51%), Positives = 58/78 (74%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           +L++DLGGGTFDVS++ +E+G+ EV ++ GDT LGG+DFD  + NH +Q FK+++  DL 
Sbjct: 164 LLVYDLGGGTFDVSLVVVENGVVEVLASHGDTKLGGDDFDQLLFNHVLQVFKKEHGVDLN 223

Query: 197 TNKRALRRLRTACERAKR 250
            + RA RRL    E+AKR
Sbjct: 224 EDIRARRRLLNTLEKAKR 241



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/82 (28%), Positives = 42/82 (51%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K +LS    A I  + + + +     I+R  +E +   L + T++ +   L+DA    
Sbjct: 238 KAKRELSDHPFAKIREEFISKELHLEMEISRNDYESMIRPLLQKTLDCIHMCLKDASFIP 297

Query: 418 AQIHDIVLVGGSTRIPKVQKLL 483
             I  ++LVGGSTR P V +++
Sbjct: 298 GDIDKVILVGGSTRTPLVHEII 319


>UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3;
           Planctomycetaceae|Rep: Chaperone protein dnaK -
           Rhodopirellula baltica
          Length = 645

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 41/87 (47%), Positives = 61/87 (70%), Gaps = 8/87 (9%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDG--------IFEVKSTAGDTHLGGEDFDNRMVNHFVQEF 169
           ++++FDLGGGTFDVS+L + D         +F+V ST+GDTHLGG+DFD  ++N+   EF
Sbjct: 189 SIIVFDLGGGTFDVSVLEVADSGDEEQESRVFQVVSTSGDTHLGGDDFDEALINYVASEF 248

Query: 170 KRKYKKDLATNKRALRRLRTACERAKR 250
           ++    DL  +  AL+RL+ ACE+AK+
Sbjct: 249 QKDNGIDLRNDAMALQRLQEACEKAKK 275



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 31/63 (49%), Positives = 45/63 (71%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           ITR++FEEL   L      PV ++L+DA MD   I ++VLVGGSTR+PKV+++++  F G
Sbjct: 304 ITRSKFEELIDALVERCRGPVLQALKDAGMDPKDIDEVVLVGGSTRVPKVREVVKSIF-G 362

Query: 502 KEP 510
           K+P
Sbjct: 363 KDP 365



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/72 (36%), Positives = 36/72 (50%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  ++ +NPDE           +L GD++    D           GIET GGVMT L++R
Sbjct: 363 KDPHQGVNPDEVVAVGAAIQGSVLAGDRN----DVLLLDVTPLTLGIETEGGVMTALVER 418

Query: 681 NTTIPTKQTQTF 716
           NTTIP ++   F
Sbjct: 419 NTTIPAEKKNVF 430


>UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 509

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 38/77 (49%), Positives = 57/77 (74%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           VL++DLGGGTFDVSI+ I D +FEVK+T GD  LGG DFD+ ++ H + +F+ K+  DL+
Sbjct: 195 VLVYDLGGGTFDVSIIEIRDRVFEVKATGGDIFLGGIDFDDAIIRHVLDDFRAKHGIDLS 254

Query: 197 TNKRALRRLRTACERAK 247
           ++  A++R++   ER K
Sbjct: 255 SDPVAMQRIKDLAERTK 271



 Score = 37.1 bits (82), Expect = 0.43
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 5/94 (5%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLF-----EGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAK 408
           K DLS+  +A   I  +      + ++      R   E L   L   +++ +   + DA 
Sbjct: 271 KMDLSARNEAPFSIPFITMTPQGQPLNLDVRFDRKLLEALTQHLVDRSLKIMGGVMVDAG 330

Query: 409 MDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +    I +I+LVGG TR+P +Q+ L  FF GK P
Sbjct: 331 ITAKDIDEIMLVGGQTRMPIIQERLARFF-GKPP 363


>UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella
           natans|Rep: Chaperone DnaK - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 653

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 37/77 (48%), Positives = 55/77 (71%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + +FD GGGTFDVS+L   DG+FEV  T GD+ LGG+D DN+++N   + F++KY  DL 
Sbjct: 251 IFVFDAGGGTFDVSLLEAGDGVFEVIQTGGDSSLGGDDIDNKIMNWLCRGFQKKYNIDLR 310

Query: 197 TNKRALRRLRTACERAK 247
            + + ++RL+ A E+AK
Sbjct: 311 DDPKTIQRLKEAAEKAK 327



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 4/117 (3%)
 Frame = +1

Query: 154 LCPGVQEEIQKGPRYQQESS*AFAYCM*EGKEDLSSSTQASIEIDSLFEG----IDFYTS 321
           LC G Q++     R   ++         + K +LSS + A I +  +           T 
Sbjct: 297 LCRGFQKKYNIDLRDDPKTIQRLKEAAEKAKLELSSVSSAPINLPFIANDGGKPRHLLTQ 356

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDF 492
           ++R    EL A L      P+ + L +A +  + I  ++LVGG+TRIP +Q+L+Q +
Sbjct: 357 LSRETLNELIASLILKFKAPMVEVLSEANLSPSDIDHVILVGGTTRIPIIQELVQKY 413



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 26/70 (37%), Positives = 34/70 (48%)
 Frame = +3

Query: 507 ANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNT 686
           AN +INPDE           ++ G  S    D           G+ET GGV T LI RNT
Sbjct: 418 ANCTINPDEVVALGAAIQASVIGGVTS----DIVLIDVTPLSLGLETLGGVNTKLIPRNT 473

Query: 687 TIPTKQTQTF 716
           ++PT +T+ F
Sbjct: 474 SLPTSKTEVF 483


>UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular
           organisms|Rep: Chaperone protein dnaK - Bordetella
           bronchiseptica (Alcaligenes bronchisepticus)
          Length = 641

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 43/83 (51%), Positives = 60/83 (72%), Gaps = 4/83 (4%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGI----FEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRK 178
           R ++++DLGGGTFDVSI+ I D      FEV ST GDT LGGEDFD R++++ + EFK++
Sbjct: 189 RKIVVYDLGGGTFDVSIIEIADVDGEMQFEVLSTNGDTFLGGEDFDQRIIDYIISEFKKE 248

Query: 179 YKKDLATNKRALRRLRTACERAK 247
              DL+ +  AL+RL+ A E+AK
Sbjct: 249 QGVDLSKDVLALQRLKEAAEKAK 271



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 36/95 (37%), Positives = 55/95 (57%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSS Q  I +  +             ITRA+ E L  +L   T+EP   +++DA
Sbjct: 269 KAKIELSSSQQTEINLPYITADASGPKHLNLKITRAKLEALVEELIERTIEPCRVAIKDA 328

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            +  + I D++LVGG TR+PKVQ  +++FF G+EP
Sbjct: 329 GVKVSDIDDVILVGGMTRMPKVQDKVKEFF-GREP 362



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 27/68 (39%), Positives = 37/68 (54%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           K +NPDE           +L G++    +D           GIET GGVMT +I++NTTI
Sbjct: 364 KDVNPDEAVAAGAAIQGSVLSGER----KDVLLLDVTPLSLGIETLGGVMTKMIQKNTTI 419

Query: 693 PTKQTQTF 716
           PT+ +QTF
Sbjct: 420 PTRYSQTF 427


>UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena
           thermophila SB210|Rep: dnaK protein - Tetrahymena
           thermophila SB210
          Length = 1213

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 39/89 (43%), Positives = 63/89 (70%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LSS  ++ I+I +L +G+DF   +TR +FEE+N DLF+     +++ L  + ++K  
Sbjct: 288 KKQLSSLLKSQIKIQNLVDGLDFSEELTREKFEEINTDLFQKVTNTIQEVLNQSGLNKID 347

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I +I+L+GGST IPK++K +Q+FF GKEP
Sbjct: 348 IDNIILIGGSTYIPKIRKSIQEFF-GKEP 375



 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 39/89 (43%), Positives = 61/89 (68%)
 Frame = +1

Query: 244  KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
            K+ LSS  +  I+I +L +G+DF   +TR +FEE+N DLF+     ++  L  + ++K  
Sbjct: 867  KKQLSSLLKTQIKIQNLVDGLDFSEELTREKFEEINTDLFQKVTNTIQDVLNKSGLNKID 926

Query: 424  IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            I +I+L+GGST IPK++K +Q+FF GKEP
Sbjct: 927  IDNIILIGGSTYIPKIRKSIQEFF-GKEP 954



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 33/80 (41%), Positives = 55/80 (68%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N L+F LGG T +VSIL I++G+ +  ++  D + GGE FD R+V +F++   +KY KD
Sbjct: 210 KNALVFHLGGATMEVSILNIDEGVIDNIASCSDINFGGEVFDQRVVEYFIKLILQKYGKD 269

Query: 191 LATNKRALRRLRTACERAKR 250
           ++ ++ AL++LR   E AK+
Sbjct: 270 ISIDQIALQKLRIEVEAAKK 289



 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 32/80 (40%), Positives = 54/80 (67%)
 Frame = +2

Query: 11   RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
            +N L+F LGG T +VSIL I+ G+ +  ++  D + GGE FD R+V +F++   +KY KD
Sbjct: 789  KNALVFHLGGATMEVSILNIDYGVIDNIASCSDINFGGEVFDQRVVEYFIKLILQKYGKD 848

Query: 191  LATNKRALRRLRTACERAKR 250
            ++ ++ A+++LR   E AK+
Sbjct: 849  ISIDQIAIQKLRIEVEAAKK 868


>UniRef50_UPI0000DC15CB Cluster: UPI0000DC15CB related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC15CB UniRef100 entry -
           Rattus norvegicus
          Length = 490

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 43/78 (55%), Positives = 56/78 (71%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           +L FDL   TF+V +LTI  G+ EVK+T+GDTHLGG    N+M+N+F+++F+RK  KD  
Sbjct: 137 LLFFDLSRSTFNV-VLTILAGVIEVKATSGDTHLGGGGLSNQMLNNFMKDFRRKRWKDGN 195

Query: 197 TNKRALRRLRTACERAKR 250
            NK  L RL T CERAKR
Sbjct: 196 GNKMTLHRLCTVCERAKR 213



 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 46/88 (52%), Positives = 61/88 (69%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS TQ+++E+DS F+G+  YTSI  A FEEL +DLF S +EPVEK+L   K+ KAQ
Sbjct: 212 KRMLSSRTQSTLEVDSFFQGVGVYTSIISAHFEELCSDLFCSPLEPVEKALSAVKLAKAQ 271

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IH+++LV GS+ I         FF+GKE
Sbjct: 272 IHEVILVDGSSCI--------YFFSGKE 291


>UniRef50_Q3SD91 Cluster: Cytosol-type hsp70; n=1; Paramecium
           tetraurelia|Rep: Cytosol-type hsp70 - Paramecium
           tetraurelia
          Length = 604

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 40/81 (49%), Positives = 57/81 (70%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R +LIF+LGGG+  VS   IE  I E+ ST+G+ +LGGE+FDN +VNH  Q F+++Y  D
Sbjct: 196 RTILIFNLGGGSITVSAGDIEFSIIEITSTSGNRNLGGEEFDNLLVNHCCQMFQQQYGID 255

Query: 191 LATNKRALRRLRTACERAKRT 253
           L  N RA+ RL+  C+++K T
Sbjct: 256 LRQNARAMSRLKIQCQKSKET 276



 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 36/90 (40%), Positives = 61/90 (67%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + KE LSS  Q +IE++ + +  +    ITR  FE +  DLF+  +  VE+ L++  + +
Sbjct: 272 KSKETLSSVNQTTIEVEFIAQDKNLSIQITRETFEMICQDLFKRCISYVEEVLKEGCLTQ 331

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
             ++ I+LVGGS+RIPK+Q+LL+++FNGK+
Sbjct: 332 NSLNQIILVGGSSRIPKIQELLKEYFNGKQ 361


>UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n=2;
           Cystobacterineae|Rep: Heat shock protein 70 family
           protein - Myxococcus xanthus (strain DK 1622)
          Length = 535

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 39/79 (49%), Positives = 57/79 (72%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + V+++DLGGGTFDVSIL I   +FEV +TAGDT+LGG+DFD+R++     +F  + + D
Sbjct: 189 QRVVVYDLGGGTFDVSILEIGKDVFEVLATAGDTYLGGDDFDDRIMTWLADDFLARTRLD 248

Query: 191 LATNKRALRRLRTACERAK 247
           +  NK  L+ L+ A E+AK
Sbjct: 249 VRQNKFCLQMLKEAAEKAK 267



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/69 (28%), Positives = 41/69 (59%)
 Frame = +1

Query: 304 IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           +D    + + +F  +  DL + T +  +++L+ A++  A I  ++LVGG TR+P ++  +
Sbjct: 292 MDLRGQLNQDQFNRMVMDLVQRTFKVCDEALQSARLTAADIDAVILVGGPTRLPIIRNSV 351

Query: 484 QDFFNGKEP 510
           + +F  KEP
Sbjct: 352 KHYFQ-KEP 359


>UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031574 - Anopheles gambiae
           str. PEST
          Length = 503

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 39/79 (49%), Positives = 57/79 (72%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           VL+   GGG  DVSI+TI +G+F+VK+++GDT LGG D D R+V++FV+E +     D+ 
Sbjct: 174 VLVCSFGGGFLDVSIVTIYNGVFQVKASSGDTRLGGVDIDKRLVDYFVKELQDTQSLDIT 233

Query: 197 TNKRALRRLRTACERAKRT 253
            +  A+R+LR  CE+AKRT
Sbjct: 234 RDCIAMRKLRKTCEQAKRT 252



 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 35/87 (40%), Positives = 58/87 (66%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LS ++Q ++EID L +G    +++T+   +EL  DLF   +  VE +LR A+ D+
Sbjct: 248 QAKRTLSYTSQVTVEIDDLLDGHKLSSTLTKDNVDELCKDLFERVILHVETALRRARKDR 307

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFN 498
             +H+I+LVG S+RIP+VQ +L +FF+
Sbjct: 308 FAMHEIMLVGESSRIPRVQIMLSEFFD 334


>UniRef50_A0CZG2 Cluster: Chromosome undetermined scaffold_32, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_32,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 232

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 39/83 (46%), Positives = 58/83 (69%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           +LIFDLG GT DVS+L+IE G+ EV++TAGD   GG+DFDN+++ +   EF +K   D+ 
Sbjct: 68  ILIFDLGSGTLDVSLLSIEVGVVEVRATAGDIDFGGDDFDNKLIQYCCNEFLQKKGIDIK 127

Query: 197 TNKRALRRLRTACERAKRTCHRP 265
            N  +LRRLR   + ++R  ++P
Sbjct: 128 GNPSSLRRLRIQFKSSRRVFNQP 150


>UniRef50_UPI0000D56BFD Cluster: PREDICTED: similar to CG8937-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8937-PA, isoform A - Tribolium castaneum
          Length = 767

 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R +LI+DLGGGTFDVSI+  E+G  +V S  GDTHLGG+DF NR+V+H V   + K+   
Sbjct: 193 RVILIYDLGGGTFDVSIVRTENGTIKVLSVDGDTHLGGQDFLNRLVDHVVDYVQTKHGIK 252

Query: 191 LATNKRALRRLRTACERAKR 250
           +  NKR +  +  +CE+ K+
Sbjct: 253 VRENKRLMMNILNSCEKTKK 272



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 32/85 (37%), Positives = 58/85 (68%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ L+S+ +  I ++  F G      +TR +FEELN DLF  T++ ++  +R+ +M K +
Sbjct: 271 KKILTSANRTVIPLE--FSGHFDQLEVTREQFEELNRDLFAKTVKILDNCIRNRRMSKEE 328

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFN 498
           I +++LVGGS+RIP+++ LL+ +F+
Sbjct: 329 IDEVLLVGGSSRIPRIETLLKAYFD 353


>UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonospora
           locustae|Rep: Mitochondrial-type HSP70 - Antonospora
           locustae (Nosema locustae)
          Length = 622

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 42/95 (44%), Positives = 63/95 (66%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + +FDLGGGTFD+SIL I+DGIFEVKST G+THLGGED D  +V++ +++   ++K    
Sbjct: 220 IAVFDLGGGTFDISILEIKDGIFEVKSTNGNTHLGGEDIDAEIVDYVIEKAGLRHKAG-N 278

Query: 197 TNKRALRRLRTACERAKRTCHRPHKRALR*ILSLR 301
            +   L+R+R A E AK    +     ++ ++ LR
Sbjct: 279 MSAGTLKRIRRAAEAAKIELSQADSTRIKALVELR 313



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 23/61 (37%), Positives = 40/61 (65%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           +TR   E++   +   T+EP +K+++DAK+D   I  ++LVGG TR+P VQ++++  F  
Sbjct: 338 LTRNELEDIAEKIVNKTIEPCKKAIKDAKVDLKDIQHVILVGGMTRMPLVQRVVEKIFKR 397

Query: 502 K 504
           K
Sbjct: 398 K 398



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/66 (34%), Positives = 33/66 (50%)
 Frame = +3

Query: 519 INPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIPT 698
           ++P+E           IL GD    V +           GIET GG+ + +I+RNTT+P 
Sbjct: 403 VDPEEAVAKGAAVQGGILSGD----VNNMLLLDVASLSLGIETVGGIFSPIIRRNTTLPV 458

Query: 699 KQTQTF 716
           K+TQ F
Sbjct: 459 KETQVF 464


>UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas
           vaginalis|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 617

 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 38/77 (49%), Positives = 51/77 (66%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           V+++DLGGGTFDVS+LT++   F+V +T GDTHLGGEDFD   V   +  F      D +
Sbjct: 201 VIVYDLGGGTFDVSLLTLDKDYFQVVATGGDTHLGGEDFDEMCVQQMITRFMNATGSDCS 260

Query: 197 TNKRALRRLRTACERAK 247
            +  AL RL+ +CE AK
Sbjct: 261 RDPIALARLKKSCEAAK 277



 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 30/85 (35%), Positives = 53/85 (62%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS   +  IEI + FEG D   + TR +F +   +L + T+  ++  + DA + K  I D
Sbjct: 280 LSDELETEIEIPNFFEGQDLKETYTRKQFNDNIEELLQKTLRTIQGVIDDANLTKEDISD 339

Query: 433 IVLVGGSTRIPKVQKLLQDFFNGKE 507
           +V++GGSTR P+V++++ ++F GK+
Sbjct: 340 VVMIGGSTRSPRVREIVSEYFGGKK 364



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 30/92 (32%), Positives = 42/92 (45%)
 Frame = +3

Query: 441 GGWLHSYPQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXX 620
           GG   S P+  E  + +   K     INPDE           I+    S E  D      
Sbjct: 344 GGSTRS-PRVREIVSEYFGGKKLCTEINPDEAVAYGAAIQGEII----SSENFDVVVVDV 398

Query: 621 XXXXXGIETAGGVMTTLIKRNTTIPTKQTQTF 716
                G+ET GG+M+ +IKRNT IP ++T+T+
Sbjct: 399 YPLTLGVETRGGLMSPIIKRNTRIPCRRTKTY 430


>UniRef50_A0DHP4 Cluster: Chromosome undetermined scaffold_50, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_50,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 598

 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 35/80 (43%), Positives = 61/80 (76%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           + N++IFDLGGGT+DVSI++I+DG  +V +T+G T+ GGEDFD R++ + ++   +K  +
Sbjct: 210 KENLVIFDLGGGTYDVSIVSIDDGDIQVIATSGITNFGGEDFDQRLIGYLIKVIYKKINQ 269

Query: 188 DLATNKRALRRLRTACERAK 247
           D++ +KRA+++L+    +AK
Sbjct: 270 DISGDKRAIQKLKKEVVKAK 289



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 34/87 (39%), Positives = 59/87 (67%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LS   +  ++I  L +G  F  ++ R++FE+LNADLF    +P   SL+D+K+ +
Sbjct: 287 KAKIALSVFYETKLDIQDLVDGFHFQETLKRSKFEDLNADLFNKLAQPFILSLKDSKLTE 346

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFN 498
            +I +I+L+GGSTRIPKV+++++  F+
Sbjct: 347 EEISEIILIGGSTRIPKVRQIIEGLFS 373


>UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 623

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 37/72 (51%), Positives = 51/72 (70%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + V++FDLGG   DV+ L  +DG F+V +T GD +LGGE FD R+VNHFV   KRK+ +D
Sbjct: 226 KRVVVFDLGGENLDVTALVADDGFFDVLATNGDGYLGGEGFDQRVVNHFVDLIKRKHGRD 285

Query: 191 LATNKRALRRLR 226
           +  + RA+ RLR
Sbjct: 286 ITGDGRAMHRLR 297



 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 34/59 (57%), Positives = 49/59 (83%)
 Frame = +1

Query: 331 ARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           A+FEELN DLF  TM P+ K++ DA ++K  I++I+ VGGSTRIPKVQ+L++D+F+GK+
Sbjct: 300 AQFEELNDDLFARTMAPLRKTMADAGLEKGDINEIIHVGGSTRIPKVQQLIRDYFDGKK 358


>UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2;
           Anaeromyxobacter dehalogenans 2CP-C|Rep: Conserved
           region 2266 - Anaeromyxobacter dehalogenans (strain
           2CP-C)
          Length = 782

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 38/79 (48%), Positives = 54/79 (68%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + VL++DLGGGTFD S+L + D ++EV ST GDT LGG DFDNR+V+  +  ++  +   
Sbjct: 411 QRVLVYDLGGGTFDASVLELNDNVYEVVSTGGDTFLGGVDFDNRIVDRMLAAWEHTHGAP 470

Query: 191 LATNKRALRRLRTACERAK 247
            A ++ AL R+  A ERAK
Sbjct: 471 FAGDRVALSRMVDAAERAK 489



 Score = 37.1 bits (82), Expect = 0.43
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 4/90 (4%)
 Frame = +1

Query: 253 LSSSTQASIEID--SLFEGIDFYTSITRARFE--ELNADLFRSTMEPVEKSLRDAKMDKA 420
           LS  T+  +++   +L +G      +T +R E  EL   L   T+E     L    +   
Sbjct: 492 LSERTEHRVDLPFLALADGRPLSLEVTVSRDEVVELVGPLVDRTLEVCRDVLAARSLSTT 551

Query: 421 QIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            I +++LVGG +R+P V + + +FF G+ P
Sbjct: 552 DIDEVILVGGQSRMPLVHQKVGEFF-GRAP 580


>UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:
           2-alkenal reductase - Anaeromyxobacter sp. Fw109-5
          Length = 623

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY-K 184
           R  V++FDLGGGTFDVS+L +   +++V +  GDT+LGGEDFD R+++     F +++  
Sbjct: 190 RSKVVVFDLGGGTFDVSVLDVGRSVYDVVAVGGDTYLGGEDFDRRVMDWLTFGFAKEHGG 249

Query: 185 KDLATNKRALRRLRTACERAK 247
            DL  +K AL+R+R A ERAK
Sbjct: 250 VDLRQDKMALQRVRDAAERAK 270



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 36/95 (37%), Positives = 57/95 (60%), Gaps = 6/95 (6%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEG------IDFYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           K +LSS+T A I +  L  G      +     ++R   EEL  DL    +   E++LRDA
Sbjct: 270 KCELSSATSAPIHLPFLIGGGEGKGALHLDRQLSREGLEELTKDLVDRCIAVTERTLRDA 329

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            +  AQ+ +++LVGG TR+P+VQ+ +++FF G+EP
Sbjct: 330 GVRPAQVGEVILVGGMTRMPRVQRAVREFF-GREP 363



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = +3

Query: 636 GIETAGGVMTTLIKRNTTIPTKQTQTF 716
           G+   GG   T+I RNTT+PT QT  F
Sbjct: 404 GLLVVGGYFQTVIPRNTTVPTSQTHLF 430


>UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1;
           Acanthamoeba polyphaga mimivirus|Rep: Heat shock protein
           70 homolog - Mimivirus
          Length = 941

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 35/83 (42%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           T  NV+++DLG GT DVS++ I +G+F   +  G+THLGGEDFD  ++NH + +F++K++
Sbjct: 214 TGGNVIVYDLGAGTLDVSLMNISNGVFRTLAVGGNTHLGGEDFDYLIMNHILIDFRKKHR 273

Query: 185 -KDLATNKRALRRLRTACERAKR 250
            K+L  +K +  +L+ + E AK+
Sbjct: 274 IKELQMSKLSQLKLKNSVENAKK 296



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS+  +A + +D  + G   Y ++TR   E +  +LF   M+P++  L  + + +  
Sbjct: 295 KKLLSTVDKAVVCVDDFYNGKQLYFNLTREFMEMVCNELFIMCMKPLKDVLDSSGLTRQD 354

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I  ++LVGGSTRIPK+QKL+ DFF   +
Sbjct: 355 IDKVILVGGSTRIPKIQKLILDFFKNTQ 382



 Score = 36.3 bits (80), Expect = 0.76
 Identities = 21/67 (31%), Positives = 28/67 (41%)
 Frame = +3

Query: 516 SINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIP 695
           S+NPDE           I+         +           G+ET    MT +I RNT IP
Sbjct: 389 SLNPDEVVSAGASIYGYIITNKGDPFSDNLVLLDITPLSLGVETLQKQMTVIIPRNTVIP 448

Query: 696 TKQTQTF 716
           TK+T+ F
Sbjct: 449 TKKTKIF 455


>UniRef50_Q7YW35 Cluster: ER-type hsp70; n=1; Paramecium
           multimicronucleatum|Rep: ER-type hsp70 - Paramecium
           multimicronucleatum
          Length = 129

 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 38/85 (44%), Positives = 58/85 (68%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS++ +  IEI+ L +G+DF  ++TRA+ EELN DL +        S    +  K  IH+
Sbjct: 40  LSATLETKIEIEDLIDGLDFNEALTRAKCEELNGDLVQENHWTNVNSFGRLQFKKNDIHE 99

Query: 433 IVLVGGSTRIPKVQKLLQDFFNGKE 507
           IVLVGGS+R P+++++++DFFNGKE
Sbjct: 100 IVLVGGSSRYPQIRQIVKDFFNGKE 124


>UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock
           cognate 71 kDa protein (Heat shock 70 kDa protein 8);
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           Heat shock cognate 71 kDa protein (Heat shock 70 kDa
           protein 8) - Canis familiaris
          Length = 393

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 48/92 (52%), Positives = 51/92 (55%)
 Frame = +3

Query: 441 GGWLHSYPQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXX 620
           GG+ H  P+  +    F   K  NKS NPDE           IL GDKSE VQD      
Sbjct: 171 GGYTH-IPKIQKLLQDFFNGKELNKSNNPDEAVDYGTAVQAAILSGDKSENVQDLLLLGV 229

Query: 621 XXXXXGIETAGGVMTTLIKRNTTIPTKQTQTF 716
                GIETAGGVMT LIK NTTIPTKQTQTF
Sbjct: 230 TLLSRGIETAGGVMTVLIKYNTTIPTKQTQTF 261



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/33 (81%), Positives = 30/33 (90%)
 Frame = +1

Query: 409 MDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +DK+QI DIVLVGG T IPK+QKLLQDFFNGKE
Sbjct: 159 LDKSQIRDIVLVGGYTHIPKIQKLLQDFFNGKE 191



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 32/57 (56%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEV-KSTAGDTHLGGEDFDNRMVNHFVQEF 169
           G  RNVLIFDLGGGTFDVSIL IEDGIF + KS   D  L G       +   +Q+F
Sbjct: 130 GAERNVLIFDLGGGTFDVSILIIEDGIFALDKSQIRDIVLVGGYTHIPKIQKLLQDF 186


>UniRef50_A7RF55 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 391

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 38/88 (43%), Positives = 59/88 (67%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+   A+  +DSL EGIDF   ++RA+FE   + LF+  +  +EK L  A + K +
Sbjct: 266 KNILSTLESANCSVDSLCEGIDFQGQVSRAKFESSCSSLFQRCLGSIEKVLSSANVPKDE 325

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +  ++LVGG+TR PK+Q+LL+++F GKE
Sbjct: 326 VDKVILVGGATRTPKIQQLLKNYFVGKE 353



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/77 (38%), Positives = 54/77 (70%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           VL++ LGG + DV++L++ +G+++V +T  D  LGG +FD  +++    +FKR++K D  
Sbjct: 190 VLVYRLGGASHDVTLLSVINGMYKVLATEYDGALGGRNFDEVLLDLLANDFKRQWKIDPL 249

Query: 197 TNKRALRRLRTACERAK 247
           TNKR+  +L+T+ E+ K
Sbjct: 250 TNKRSKTKLQTSAEQCK 266


>UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 603

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 37/81 (45%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           + NVL+FDLGGGTFDV++L+I++G ++V +T GDTHLGG DFD +++   + ++K + K 
Sbjct: 189 KSNVLVFDLGGGTFDVTLLSIDNGEYKVIATDGDTHLGGNDFDTKLLELVLNKWKEEDKD 248

Query: 188 DL-ATNKRALRRLRTACERAK 247
            +   +K+ + +LR  CE AK
Sbjct: 249 FVEQLSKKQIFKLRKRCEIAK 269



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 26/63 (41%), Positives = 42/63 (66%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           ITR  FE +N +LF      VEK L+  ++    + ++VLVGGST+IPK+++++  FF G
Sbjct: 303 ITREEFENVNKELFSRCFISVEKVLQVTQVKAKDVSEVVLVGGSTKIPKIEQMVSQFF-G 361

Query: 502 KEP 510
           ++P
Sbjct: 362 RKP 364


>UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: DnaK
           protein - Clostridium perfringens
          Length = 575

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 35/81 (43%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           N++++D GGGTFDV+IL + +G+ +VK + G+ +LGG+D DN++++H V EF +     L
Sbjct: 166 NIIVYDFGGGTFDVTILEMFNGVLDVKVSRGNNYLGGKDIDNKLIDHVVNEFNKSTGVKL 225

Query: 194 AT-NKRALRRLRTACERAKRT 253
            T + R L RL+   E AK+T
Sbjct: 226 DTSDSRILARLKEGVEEAKKT 246



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEI-----DSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRD 402
           E K+ LS+S  A I +     D     I+    +TR  FE    ++  ST + V ++L D
Sbjct: 242 EAKKTLSTSKMAEIVLPYISADKDNNPINLEMVLTREEFEFNVKEIIDSTEDIVNEALED 301

Query: 403 AKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           A +   +I  ++LVGGS+RIP V+ +L+  F GK
Sbjct: 302 ANITDNEIDTVLLVGGSSRIPYVRNMLEKRFKGK 335


>UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus
           metalliredigens QYMF|Rep: 2-alkenal reductase -
           Alkaliphilus metalliredigens QYMF
          Length = 569

 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 31/81 (38%), Positives = 58/81 (71%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +++L++DLGGGT DV++L + +G+ EVK+++G+  LGG+DFD +++++    F  +Y  D
Sbjct: 164 QHILVYDLGGGTLDVTVLEMFEGVLEVKASSGNNQLGGKDFDQKLIDYLCDRFFEQYHID 223

Query: 191 LATNKRALRRLRTACERAKRT 253
           L ++ RA+ +L+ + E  K T
Sbjct: 224 LRSDLRAMAKLKKSAEECKIT 244



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/55 (40%), Positives = 39/55 (70%)
 Frame = +1

Query: 319 SITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           +ITR  FE L  ++ +ST++P+  +L+DAK+    +  I++VGGSTR+P V+ ++
Sbjct: 271 TITRQVFESLIEEIVQSTLKPITIALKDAKLTSKDLDLILMVGGSTRVPLVKSVV 325


>UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock
           protein 2; n=1; Pan troglodytes|Rep: PREDICTED: similar
           to heat shock protein 2 - Pan troglodytes
          Length = 640

 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 40/67 (59%), Positives = 43/67 (64%)
 Frame = +3

Query: 24  SLTSAAVPSTCPSLPSRMVSSR*NPPPATPTWEVRTLTIAWSTTLSRSSRGNTKRTSLPT 203
           SLT A   STCPS PSRM SSR +P PATPTW VRT T AW  T  RSS  +T+RT  PT
Sbjct: 200 SLTWAVALSTCPSXPSRMASSRXSPRPATPTWAVRTSTTAWXATWRRSSSASTRRTLGPT 259

Query: 204 RELLGVC 224
               G C
Sbjct: 260 SAPXGGC 266



 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 41/83 (49%), Positives = 44/83 (53%)
 Frame = +2

Query: 260 RPHKRALR*ILSLRVLTSTRQLLVLASRS*TPICSGLPWSQWRSLSVMPRWIRLKSTILY 439
           RP +RA R   S R  TS R     ASRS  P     PWS+WR     P W R KS    
Sbjct: 279 RPRRRASRSTRSTRAWTSIRPSRAPASRSSMPTSFAGPWSRWRRRCATPSWTRAKSRRSC 338

Query: 440 WWVAPLVSPRCRSSCKISLMERS 508
           WW APLVSPR RS C+IS   RS
Sbjct: 339 WWAAPLVSPRSRSCCRISSTARS 361


>UniRef50_Q1D211 Cluster: DnaK family protein; n=1; Myxococcus
           xanthus DK 1622|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 504

 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 37/91 (40%), Positives = 57/91 (62%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + V++FDLGGGTFD ++L +++ + +V +T GD  LGG +FD R+V   V +F++K+  D
Sbjct: 190 QTVMVFDLGGGTFDATLLAVQNKVVKVLATGGDAFLGGANFDERIVEMLVNDFQQKHGID 249

Query: 191 LATNKRALRRLRTACERAKRTCHRPHKRALR 283
           L  NK  ++RL  A E AK    +     LR
Sbjct: 250 LRGNKVVMQRLVFAAESAKMALSQRDATVLR 280



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/63 (38%), Positives = 35/63 (55%)
 Frame = +1

Query: 304 IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           IDF  ++TR R EE+   L   T    +  L  AK+   QI ++VLVGG TR+P +++  
Sbjct: 292 IDFDYTLTRKRLEEMAFQLIERTASACDDVLERAKLKADQIDELVLVGGQTRMPAIRQRF 351

Query: 484 QDF 492
             F
Sbjct: 352 SHF 354


>UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila
           auraria|Rep: LAC ORF protein - Drosophila auraria (Fruit
           fly)
          Length = 613

 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 37/76 (48%), Positives = 57/76 (75%)
 Frame = -2

Query: 504 LSIKEILQELLHLGDTSGATHQYNIVDLSLIHLGITERLLHWLHGRPEQIGVQLLEASTS 325
           L+++ +LQ+ L LGD SGA H++++VDL+L+HLG+ ERLLH L G  E++  QLLEA  +
Sbjct: 254 LAVEVLLQQGLDLGDASGAAHKHDVVDLALVHLGVGERLLHGLQGVAEEVCAQLLEAGAA 313

Query: 324 N*RVEVNTLKERIYLN 277
           +  VEV  L++R+ L+
Sbjct: 314 HLGVEVVALEQRVDLD 329



 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 38/80 (47%), Positives = 58/80 (72%), Gaps = 1/80 (1%)
 Frame = -1

Query: 247 LCPLTCSTQTPKSSLVGSEVLFVFPLELLDKVVDHAIVKVLTSQVGVAGGGFHLED-TIL 71
           LCPL+   +  + S VG+EVL    LEL+ +V D  +V+VLT+QV V+GGG  LE  +++
Sbjct: 340 LCPLSSRAEAAQGSGVGAEVLSELALELIGQVGDQPVVEVLTAQVRVSGGGPDLEQGSLV 399

Query: 70  DGKDGHVEGTAAEVKDKYIS 11
           DG+DG VEG AA+V+D++++
Sbjct: 400 DGQDGDVEGAAAQVEDEHVA 419



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 22/66 (33%), Positives = 37/66 (56%)
 Frame = -3

Query: 716 ECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCYIKQQQILHLLRLVTVQDSSLDSCTISY 537
           E L L + D +V LD+ GH  +  L+ E +G ++ QQ +L L  LV  +D  L   ++ +
Sbjct: 183 EGLRLLARDAAVALDQLGHHPAGGLDAEREGSHVHQQHVLDLSGLVAAEDRGLHGGSVGH 242

Query: 536 GLVRVN 519
            LV ++
Sbjct: 243 CLVGID 248


>UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Rep:
           Heat shock protein 70 - Acidobacteria bacterium (strain
           Ellin345)
          Length = 634

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 37/77 (48%), Positives = 50/77 (64%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           V ++DLGGGTFD+SIL + DGIFEV ST GDTHLGG+D DN +++  V +       D+ 
Sbjct: 191 VAVYDLGGGTFDISILKLHDGIFEVMSTNGDTHLGGDDIDNLLISTAVLDIAGDMGADIR 250

Query: 197 TNKRALRRLRTACERAK 247
               A++ +R A   AK
Sbjct: 251 HRAEAIQAVRKAVIDAK 267



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 35/85 (41%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYT-SITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIH 429
           ++ S+QAS +ID   +G   Y   I R +FE+L   + + T+ PV+++LRDA ++   + 
Sbjct: 268 IALSSQASTKIDVEIQGGKHYQREIARDQFEQLIEPVIQRTVGPVKQALRDAGLEPEDVD 327

Query: 430 DIVLVGGSTRIPKVQKLLQDFFNGK 504
           + VLVGGSTRIPKV+ L++  F  K
Sbjct: 328 EAVLVGGSTRIPKVRALVEKQFRRK 352



 Score = 40.3 bits (90), Expect = 0.046
 Identities = 23/69 (33%), Positives = 31/69 (44%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           +  +NPDE           IL G  SE  ++           GIE  GGV+  +I RN+T
Sbjct: 354 HSELNPDEVVALGAAVQANILSGG-SEATKEMLLLDVTPLSLGIEALGGVVAKIIHRNST 412

Query: 690 IPTKQTQTF 716
           IP   T+ F
Sbjct: 413 IPASATEHF 421


>UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodospira
           halophila SL1|Rep: Heat shock protein 70 -
           Halorhodospira halophila (strain DSM 244 / SL1)
           (Ectothiorhodospirahalophila (strain DSM 244 / SL1))
          Length = 577

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 36/80 (45%), Positives = 54/80 (67%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           RR++L++DLGGGTFDVS++ +E  + EV ++ G+ HLGG+DFD  +V+      K ++  
Sbjct: 162 RRHILVYDLGGGTFDVSVVRMEQDVVEVLASHGNNHLGGDDFDALIVDQLRAHVKDEHGI 221

Query: 188 DLATNKRALRRLRTACERAK 247
           D A + RA+ RLR   E AK
Sbjct: 222 DPADDPRAMARLRHTAEAAK 241



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 34/93 (36%), Positives = 54/93 (58%), Gaps = 4/93 (4%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEG----IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKM 411
           K +LSS+  A IE   L EG    ++    +TRA +E +   L   T+E V  +L DA++
Sbjct: 241 KMELSSAPIARIEEAYLLEGRNGPVNLSVDLTRADYEAMIEPLLDETLEAVRIALEDAEL 300

Query: 412 DKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
               + +IVLVGG+TR P++Q+ L++   G +P
Sbjct: 301 AVTDLDEIVLVGGTTRTPRIQQRLEELL-GLQP 332


>UniRef50_UPI0000F2C215 Cluster: PREDICTED: hypothetical protein;
           n=2; Theria|Rep: PREDICTED: hypothetical protein -
           Monodelphis domestica
          Length = 128

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 37/67 (55%), Positives = 45/67 (67%)
 Frame = +2

Query: 47  FDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRLR 226
           FD + LT  DGIFEVKS A D H+ GEDF + M NHF+ EFK K+KK +  NKRA+  + 
Sbjct: 8   FDANHLT--DGIFEVKSIAQDIHVSGEDFGSHMANHFIAEFKLKHKKIITENKRAVYHIH 65

Query: 227 TACERAK 247
           T CE  K
Sbjct: 66  TTCESIK 72



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 35/56 (62%), Positives = 43/56 (76%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKM 411
           K  L SS Q SIEI+SL+EGIDF+ SIT+A FE+LNADLF  TM  + K+LR AK+
Sbjct: 72  KHALFSSIQVSIEIESLYEGIDFFISITQANFEDLNADLFCDTMNTLGKALRGAKL 127


>UniRef50_Q1CY00 Cluster: DnaK family protein; n=2;
            Cystobacterineae|Rep: DnaK family protein - Myxococcus
            xanthus (strain DK 1622)
          Length = 1146

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 38/79 (48%), Positives = 50/79 (63%)
 Frame = +2

Query: 11   RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
            + VL++DLGGGTFD +IL IE  +FEV  T GD  LGG DFDN +V++ +  F+ K    
Sbjct: 788  KKVLVYDLGGGTFDATILKIEKNVFEVLGTGGDVFLGGIDFDNLIVDYLLARFQEKEGIA 847

Query: 191  LATNKRALRRLRTACERAK 247
               +  AL R+  A ERAK
Sbjct: 848  FTGDGIALSRVSDAAERAK 866



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/63 (34%), Positives = 36/63 (57%)
 Frame = +1

Query: 307  DFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQ 486
            D    ++R   E++   L   T++ V   L DAK+  A++ DI+LVGG +R+P V+  L+
Sbjct: 892  DLRVVLSRQELEKICEPLLSRTIDVVRDVLLDAKLKAAEVDDIILVGGMSRMPLVRDKLK 951

Query: 487  DFF 495
              F
Sbjct: 952  GLF 954


>UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 759

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 38/80 (47%), Positives = 51/80 (63%), Gaps = 1/80 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + VL++DLGGGTFD S+L + D ++EV ST GDT LGG DFDNR+V+  +  ++      
Sbjct: 376 QRVLVYDLGGGTFDASVLELSDNVYEVVSTGGDTFLGGVDFDNRIVDRLLARWEETTGAP 435

Query: 191 LATNKR-ALRRLRTACERAK 247
                R AL R+  A ERAK
Sbjct: 436 FPGEDRVALSRVVDAAERAK 455



 Score = 32.7 bits (71), Expect = 9.3
 Identities = 20/71 (28%), Positives = 34/71 (47%)
 Frame = +1

Query: 298 EGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQK 477
           E +     +TR     L A L   T++   + L    +    I +++LVGG +R+P V +
Sbjct: 477 EPVGLEALLTRDELVALAAPLVDRTLDVCREVLLAKGLGTKDIDEVLLVGGQSRMPLVHE 536

Query: 478 LLQDFFNGKEP 510
            +  FF G+ P
Sbjct: 537 KVAAFF-GRAP 546


>UniRef50_A4QNX8 Cluster: Zgc:162281 protein; n=6; Eumetazoa|Rep:
           Zgc:162281 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 438

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 35/71 (49%), Positives = 51/71 (71%)
 Frame = +1

Query: 298 EGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQK 477
           E + F   +TR  FEELNADLF+  + P+E  L +  +DK ++ +IVLVGGSTRIP++++
Sbjct: 324 EKVLFEEKLTRETFEELNADLFQKILAPIETVLVEGHLDKQEVDEIVLVGGSTRIPRIRQ 383

Query: 478 LLQDFFNGKEP 510
           L+  +F GKEP
Sbjct: 384 LISQYF-GKEP 393



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 34/86 (39%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NVL+ DLGGGT DVS+L  + G+F  ++ AG+  LGG+DF  R++ +  +  +++Y    
Sbjct: 220 NVLVVDLGGGTLDVSLLNKQGGMFLTRAMAGNNQLGGQDFTQRLLQYTTERVRQQYGVP- 278

Query: 194 ATNKRALRRLRTACERAK-RTCHRPH 268
            T K  +  LR A E AK      PH
Sbjct: 279 PTLKEDIHLLRQAVEAAKLNLTQEPH 304


>UniRef50_O14992 Cluster: HS24/P52; n=8; Eutheria|Rep: HS24/P52 -
           Homo sapiens (Human)
          Length = 474

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 36/80 (45%), Positives = 49/80 (61%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +TA DT LGG  FD  +VNHF +EF +KYK D
Sbjct: 196 RNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
           + +  RAL RL   CE+ K+
Sbjct: 256 IKSKIRALLRLSQECEKLKK 275



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/84 (29%), Positives = 45/84 (53%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D   ++ R +F E+  DL      P+   L   K+ K  I+ +
Sbjct: 279 ANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GKE
Sbjct: 339 EIVGGATRIPAVKEKISKFF-GKE 361


>UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter
           usitatus Ellin6076|Rep: Heat shock protein 70 -
           Solibacter usitatus (strain Ellin6076)
          Length = 619

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G+R  V+++DLGGGTFDVSI+TIE  + EV S+ G+  LGG+DFD+ +     +EF  ++
Sbjct: 160 GSRHTVMVYDLGGGTFDVSIVTIEGEVTEVLSSHGNNRLGGDDFDDLLAARLEREFLEQH 219

Query: 182 KKDLATNKRALR-RLRTACERAKR 250
              LA   +A R RL  A E AK+
Sbjct: 220 GIRLAAEDQAARARLWWAAETAKK 243



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQ 486
           I+R  +E +   L  ST++ V ++L DA     ++  I+LVGGSTR P V  +L+
Sbjct: 272 ISREEYEGMILPLVESTLDSVSQALDDAGKSAGELDAILLVGGSTRTPLVAHMLR 326


>UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter sp.
           BAL39|Rep: Heat shock protein 70 - Pedobacter sp. BAL39
          Length = 617

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 38/82 (46%), Positives = 57/82 (69%), Gaps = 1/82 (1%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           ++ + ++DLGGGTFDVSIL I++GIFEV ST G+T LGG+DFD  +V++++     K K 
Sbjct: 203 QQTIAVYDLGGGTFDVSILAIQNGIFEVLSTNGNTFLGGDDFDRAIVHYWID----KNKL 258

Query: 188 DLAT-NKRALRRLRTACERAKR 250
           D +T +   ++ LR   E AK+
Sbjct: 259 DQSTLDAATMQMLRLKAEEAKK 280



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 26/63 (41%), Positives = 40/63 (63%)
 Frame = +1

Query: 307 DFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQ 486
           D + SI +  F+EL A     TM   +++L+DA +  A I ++VLVGGSTR P V++ + 
Sbjct: 294 DIWCSIDKQTFQELIAPKVAETMNSCKQALQDAGLTIADIDEVVLVGGSTRTPYVKQAVT 353

Query: 487 DFF 495
           +FF
Sbjct: 354 EFF 356



 Score = 39.9 bits (89), Expect = 0.061
 Identities = 24/65 (36%), Positives = 30/65 (46%)
 Frame = +3

Query: 507 ANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNT 686
           A+  INPDE           IL G++S    D           GIET GG+M  +I RN 
Sbjct: 360 AHDQINPDEVVALGAAIQADILAGNRS----DILLLDVTPLSLGIETMGGLMDVIIPRNA 415

Query: 687 TIPTK 701
            +PTK
Sbjct: 416 KVPTK 420


>UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           Molecular chaperone DnaK - Syntrophomonas wolfei subsp.
           wolfei (strain Goettingen)
          Length = 498

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 31/80 (38%), Positives = 52/80 (65%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           + ++L+ D+GGGTFD++++  E G+  VK+T G + LGG DFD R+  H VQ F+   + 
Sbjct: 161 KEHILVLDIGGGTFDITLMEYEKGLCRVKATGGSSSLGGMDFDQRLAEHIVQSFQEANEI 220

Query: 188 DLATNKRALRRLRTACERAK 247
           DL  +  A++++    E+AK
Sbjct: 221 DLRNDMVAMQQIYINVEKAK 240



 Score = 39.9 bits (89), Expect = 0.061
 Identities = 24/90 (26%), Positives = 48/90 (53%), Gaps = 4/90 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEG----IDFYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K DLS+  + S+ I  +  G    +     + R +F  L  DL++   E + ++L  A
Sbjct: 238 KAKLDLSTVKECSVLIPYISMGMAGPLHINQLLQREQFNYLCRDLYQEIKELIGQTLERA 297

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFF 495
           ++D+  I  +V  GG++R+P  ++L+ + F
Sbjct: 298 EVDEKWIDVVVFAGGASRMPGFRELVAEIF 327


>UniRef50_Q9Y4L1 Cluster: Hypoxia up-regulated protein 1 precursor;
           n=39; Deuterostomia|Rep: Hypoxia up-regulated protein 1
           precursor - Homo sapiens (Human)
          Length = 999

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 42/112 (37%), Positives = 68/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query: 163 GVQEEIQKGPRYQ--QESS*AFAYCM*EG---KEDLSSSTQASIEIDSLFEGIDFYTSIT 327
           G+  E +KG R +  +E+  A A  + E    K  LS++     +I+ L + +DF   +T
Sbjct: 285 GLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVT 344

Query: 328 RARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           R  FEEL ADLF     PV+++L+ A+M   +I  ++LVGG+TR+P+VQ++L
Sbjct: 345 RVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVL 396


>UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG31366-PA - Tribolium castaneum
          Length = 614

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 34/78 (43%), Positives = 51/78 (65%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLAT 199
           L++DLGGGTFDV+IL       ++    GDTHLGG DFDN ++++      ++Y  +   
Sbjct: 196 LVYDLGGGTFDVAILKNCRQNIDIVGVDGDTHLGGHDFDNLIIDYVCDILLKEYDYNPKD 255

Query: 200 NKRALRRLRTACERAKRT 253
           ++R +RRLR+ CE AK+T
Sbjct: 256 DRRNMRRLRSICEEAKQT 273



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYT-SITRARFEELNADLFRSTMEPVEKSLRDAKMD 414
           E K+ LS   +  I + +  +  D    +ITR +FE +   LF+ T++ V+K L    + 
Sbjct: 269 EAKQTLSDLEETIIILPAFTKKHDIININITREQFESMAQMLFQRTIDIVDKCLTTCNIA 328

Query: 415 KAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           K +I +++L GGSTRIP++Q LL  +F GKE
Sbjct: 329 KTEIKEVILSGGSTRIPEIQNLLSSYFGGKE 359


>UniRef50_UPI0000E474BD Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 488

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 34/89 (38%), Positives = 58/89 (65%)
 Frame = +1

Query: 241 GKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKA 420
           GK  LS+   A+I +DSL+EG+DF++++TRA+FE +     +  ++ +  +L +  M  A
Sbjct: 265 GKHVLSTINSATISVDSLYEGMDFHSNVTRAKFESVINTPLQRCLQVIGTTLEENGMTAA 324

Query: 421 QIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
            I  ++++GGSTRIPK+Q +L+  F   E
Sbjct: 325 DIQKVIVIGGSTRIPKLQNVLKGRFPESE 353



 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 26/78 (33%), Positives = 44/78 (56%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NVL++ LGG +  VS++ + +G+  + ++       G+DF   + +    EFKR+ + D+
Sbjct: 189 NVLVYRLGGSSVSVSVINVTNGLQRIIASKTSRECAGDDFTKALADSCAIEFKRQSRMDI 248

Query: 194 ATNKRALRRLRTACERAK 247
             NKRA  +L  ACE  K
Sbjct: 249 TDNKRAKGKLYNACESGK 266


>UniRef50_A2VD43 Cluster: Heat shock protein 14; n=3;
           Clupeocephala|Rep: Heat shock protein 14 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 504

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 31/84 (36%), Positives = 56/84 (66%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+   A+  +DSL++G+DF  +++RARFE + + LF   ++P++  L    +  + 
Sbjct: 269 KHTLSTLGSANCFVDSLYDGMDFECNVSRARFELICSSLFNKCIQPIKSLLEQVNLSTSD 328

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           ++ +VL GGS RIPK+Q++++D F
Sbjct: 329 VNKVVLSGGSARIPKLQQMIRDLF 352



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           + +VL++ LGG +  V++L +  G++ V +T  D   GGE F   +  H   EFK+ +K+
Sbjct: 190 KSHVLVYKLGGTSLSVTVLEVNSGVYRVLATQTDHQTGGESFTQELAQHLAAEFKKTFKQ 249

Query: 188 DLATNKRALRRLRTACERAKRT 253
           D++ N RA+ +L  + + AK T
Sbjct: 250 DVSGNARAMMKLMNSADVAKHT 271


>UniRef50_A4J964 Cluster: Heat shock protein 70; n=2;
           Clostridiales|Rep: Heat shock protein 70 -
           Desulfotomaculum reducens MI-1
          Length = 619

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 33/79 (41%), Positives = 55/79 (69%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R++LI+DLGGGTFDVS++ +  G+ EVK+++G++HLGGEDFD ++V+   ++   ++  D
Sbjct: 176 RHILIYDLGGGTFDVSVVEMMSGVLEVKASSGNSHLGGEDFDWQIVDWLAEQMIAEHGVD 235

Query: 191 LATNKRALRRLRTACERAK 247
              + RA   L+   E+ K
Sbjct: 236 PRGDLRARALLKEEAEKIK 254



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 28/62 (45%), Positives = 39/62 (62%)
 Frame = +1

Query: 325 TRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           TR++F  L     + TM  V++ L DA +    I +I+LVGGSTRIP+V +L+  FF  K
Sbjct: 285 TRSQFISLIDSYLQETMACVQRVLTDADLGPQDIDEILLVGGSTRIPQVHQLIHQFFK-K 343

Query: 505 EP 510
           EP
Sbjct: 344 EP 345


>UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: HEAT SHOCK RELATED 70kDa
           PROTEIN - Encephalitozoon cuniculi
          Length = 683

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 40/87 (45%), Positives = 53/87 (60%), Gaps = 7/87 (8%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIE-----DGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFK 172
           + +VL+FDLGGGTFDVS+L  E       +  VK+  GDT LGG+DFDN ++N+ + EF 
Sbjct: 225 KEDVLVFDLGGGTFDVSLLDFEFNGAAGSLGIVKAIDGDTFLGGQDFDNLLINYCISEFL 284

Query: 173 RKYK--KDLATNKRALRRLRTACERAK 247
           +K    K     + AL RLR  C R K
Sbjct: 285 KKNSSIKQSDLKESALLRLRAECTRVK 311



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 38/109 (34%), Positives = 51/109 (46%), Gaps = 25/109 (22%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTME-------------PV 384
           K  LSS+T ++I +       D    ITRARFE L   LFR  ME              V
Sbjct: 311 KAVLSSATSSAIYVPCFHMTDDLNVQITRARFELLCDHLFRRCMERTKGCLLRSAGVPEV 370

Query: 385 EKSLRDAKM------------DKAQIHDIVLVGGSTRIPKVQKLLQDFF 495
           E S   +K+             K  I  ++LVGGS+RIPK++ LL ++F
Sbjct: 371 EYSADGSKLLLNPSLEKTLNEVKNNISKVLLVGGSSRIPKIKALLAEYF 419



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 24/74 (32%), Positives = 30/74 (40%), Gaps = 3/74 (4%)
 Frame = +3

Query: 504 GANKSINP---DEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLI 674
           GA+K I P   DE            ++ D  +                IETAGGV T LI
Sbjct: 420 GAHKVIEPVNADEAVAYGAAYQAASIYSDAVDAGSSLLLIDCVPLNLSIETAGGVATALI 479

Query: 675 KRNTTIPTKQTQTF 716
                IP K+T+TF
Sbjct: 480 HCGDNIPIKKTETF 493


>UniRef50_Q1E6G2 Cluster: Heat shock protein 70 homolog; n=17;
           Pezizomycotina|Rep: Heat shock protein 70 homolog -
           Coccidioides immitis
          Length = 577

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 32/85 (37%), Positives = 58/85 (68%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS  T A++ I+SL  GIDF +++ R RFE L+  +F S  + +E++++ A++D   
Sbjct: 284 KKALSLGTTAALSIESLASGIDFSSTVNRTRFELLSGKVFSSFTQLIEQAIKKAELDVLD 343

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFN 498
           I +++L GG++ IPK+ +L+Q  F+
Sbjct: 344 IDEVILCGGTSHIPKIARLVQSLFS 368



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 26/78 (33%), Positives = 46/78 (58%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           V++ D GG   D++I+    G++ V +T  D  LGG   D  +++HF +EF +K+K D  
Sbjct: 208 VVVADFGGTRSDIAIIASRGGMYTVLATVHDPELGGAQLDQILIDHFAKEFIKKHKTDPR 267

Query: 197 TNKRALRRLRTACERAKR 250
            N+R+L +++   E  K+
Sbjct: 268 ENERSLAKMKLEAEVTKK 285


>UniRef50_Q4RM18 Cluster: Chromosome 10 SCAF15019, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10
           SCAF15019, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 892

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 34/80 (42%), Positives = 50/80 (62%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G  +F VSI     G  +V + A D +LGG +FD  +V++F +EF+ KYK +
Sbjct: 244 RNVVFVDMGHSSFQVSITAFNKGKLKVLAAAFDPYLGGRNFDEVLVDYFCEEFRGKYKLN 303

Query: 191 LATNKRALRRLRTACERAKR 250
           +  N RAL RL   CE+ K+
Sbjct: 304 VRDNPRALLRLHQECEKLKK 323



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 18/56 (32%), Positives = 32/56 (57%)
 Frame = +1

Query: 328 RARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFF 495
           R  FEE++A        P+  +L  +K+    I+ + +VGG+TRIP +++ +  FF
Sbjct: 379 RGHFEEMSAQYLMRVEAPLRAALEQSKLSCDDIYAVEIVGGATRIPAIKERISRFF 434


>UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2;
           Pansporablastina|Rep: Mitochondrial-like Hsp70 -
           Trachipleistophora hominis
          Length = 543

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 33/79 (41%), Positives = 50/79 (63%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           ++ ++DLGGGTFD+SIL   D IFEVK+TAGD+ LGG+D DN + +  ++  K   +   
Sbjct: 182 HIAVYDLGGGTFDISILEKSDNIFEVKATAGDSFLGGDDIDNTLTDFLMERLKNGREMSD 241

Query: 194 ATNKRALRRLRTACERAKR 250
               +   R++ A E AK+
Sbjct: 242 IDLAKIRPRIKKAAESAKK 260



 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 34/87 (39%), Positives = 56/87 (64%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K++LS+    +I+I   ++   F   + RA FE++ A L + T++P  K+L+DA +D  Q
Sbjct: 259 KKELSTQETVTIDIPYAYKDTHFTYELKRAEFEDVVAPLIKRTVKPCLKALKDANID--Q 316

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           +  +VLVGG TR+P V+KL ++ FN K
Sbjct: 317 VDHLVLVGGMTRMPLVRKLSEEIFNRK 343



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 23/65 (35%), Positives = 35/65 (53%)
 Frame = +3

Query: 522 NPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIPTK 701
           +PDE           IL GD ++ + D           GIET GG+M+T++KRN+T+P K
Sbjct: 349 SPDESVAQGAAIQAAILSGDVNKLLLDVTSLSL-----GIETVGGLMSTIVKRNSTLPLK 403

Query: 702 QTQTF 716
           ++  F
Sbjct: 404 KSSVF 408


>UniRef50_P48723 Cluster: Stress 70 protein chaperone
           microsome-associated 60 kDa protein precursor; n=19;
           Tetrapoda|Rep: Stress 70 protein chaperone
           microsome-associated 60 kDa protein precursor - Homo
           sapiens (Human)
          Length = 471

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 30/67 (44%), Positives = 52/67 (77%)
 Frame = +1

Query: 310 FYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQD 489
           F T I+R  F+ LN DLF+  + P+++ L++  ++K +I ++VLVGGSTRIP++++++Q+
Sbjct: 361 FETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQE 420

Query: 490 FFNGKEP 510
           FF GK+P
Sbjct: 421 FF-GKDP 426



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           +VL+ DLGGGT DVS+L  + G+F  ++ +G+  LGG+DF+ R++ +  ++  + Y   +
Sbjct: 220 HVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTY-GFV 278

Query: 194 ATNKRALRRLRTACERAK 247
            + K  + RLR A E  K
Sbjct: 279 PSRKEEIHRLRQAVEMVK 296


>UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4;
           Planctomycetaceae|Rep: Chaperone protein HscC -
           Rhodopirellula baltica
          Length = 587

 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 37/93 (39%), Positives = 60/93 (64%), Gaps = 2/93 (2%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+ + DLGGGTFDV+++ + +G  E+++TAG++ LGGEDF +RMV+  +       + +
Sbjct: 177 KNLCVIDLGGGTFDVTVMEVFEGTLEIRATAGESMLGGEDFTDRMVSAVLS--GEDTQLE 234

Query: 191 LATNKRALR--RLRTACERAKRTCHRPHKRALR 283
           LA  ++ LR  RLR  CE+AKR   +     +R
Sbjct: 235 LAELQQPLRVSRLRGECEKAKRLLSKEESCKIR 267



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 26/63 (41%), Positives = 42/63 (66%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           +TRA F  +   L +    P+ ++LRDA++D  +I D++LVGGSTR+P ++  + D+F G
Sbjct: 284 LTRADFSRMCDPLMQRIAGPIARALRDAELDPKEIDDVILVGGSTRMPVLRDFVIDYF-G 342

Query: 502 KEP 510
           K P
Sbjct: 343 KPP 345


>UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 636

 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 35/86 (40%), Positives = 54/86 (62%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + KE LSS   A I I +L EG DF  ++TR +FEE+N DLF   +  +  +   ++   
Sbjct: 286 KAKETLSSQEIAHIRISNLIEGYDFQYNLTREKFEEVNQDLFDRVISTINSTFIVSETQI 345

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFF 495
             I +++LVGGS+RIPKVQ++++  F
Sbjct: 346 EDIDEVILVGGSSRIPKVQEIVEKRF 371



 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 26/82 (31%), Positives = 45/82 (54%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           + N+ +FD GGGT D++   +    FE    + + +LGGEDFD  +V + V +       
Sbjct: 209 KTNIFVFDFGGGTLDIAATIVTKQKFEEIDNSSEMNLGGEDFDFNVVKYLVDQIYNSTGM 268

Query: 188 DLATNKRALRRLRTACERAKRT 253
           +L  +K+A + L+   ++AK T
Sbjct: 269 NLTDHKKANQALKIEAQKAKET 290


>UniRef50_Q0RWC8 Cluster: Probable chaperone protein DnaK; n=1;
           Rhodococcus sp. RHA1|Rep: Probable chaperone protein
           DnaK - Rhodococcus sp. (strain RHA1)
          Length = 119

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 32/65 (49%), Positives = 47/65 (72%)
 Frame = +2

Query: 53  VSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRLRTA 232
           + +L + +G+ EV+STAGD+HLGG+DFD R+V++   EF+R    DL  + RAL+RL  A
Sbjct: 1   MGLLDVGEGVVEVRSTAGDSHLGGDDFDRRLVDYLADEFQRAENIDLRKDARALQRLFEA 60

Query: 233 CERAK 247
            E+AK
Sbjct: 61  AEKAK 65


>UniRef50_Q9SAB1 Cluster: F25C20.19 protein; n=3; core
           eudicotyledons|Rep: F25C20.19 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 763

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 33/78 (42%), Positives = 46/78 (58%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           ++  D+G     V + + E G   V+S A D +LGG DFD  + NHF  EFK KY  D+ 
Sbjct: 197 IVFIDIGHCDTQVCVASFESGSMRVRSHAFDRNLGGRDFDEVLFNHFALEFKEKYNIDVY 256

Query: 197 TNKRALRRLRTACERAKR 250
           TN +A  RLR +CE+ K+
Sbjct: 257 TNTKACVRLRASCEKVKK 274



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 31/84 (36%), Positives = 49/84 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++ +A + I+ L E  D  + I R  FE+L+A L    + P +K+L D+ +   Q
Sbjct: 273 KKVLSANAEAQLNIECLMEEKDVRSFIKREEFEQLSAGLLERLIVPCQKALADSGLSLDQ 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           IH + LVG  +RIP + K+L   F
Sbjct: 333 IHSVELVGSGSRIPAISKMLSSLF 356


>UniRef50_Q73CC4 Cluster: Dnak protein, truncation; n=1; Bacillus
           cereus ATCC 10987|Rep: Dnak protein, truncation -
           Bacillus cereus (strain ATCC 10987)
          Length = 505

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 32/81 (39%), Positives = 53/81 (65%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           ++NV+++DLGGGTFDV+++ +      VK+T GD +LGG DFDN++     Q+F+ ++  
Sbjct: 162 KQNVMVYDLGGGTFDVTLIQLNQDEVVVKATGGDRNLGGFDFDNKIFELVEQKFEEEHGL 221

Query: 188 DLATNKRALRRLRTACERAKR 250
           DL  +  A++ LR   E  K+
Sbjct: 222 DLYDDLNAVQDLREKAEACKK 242



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 29/81 (35%), Positives = 46/81 (56%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LSS  ++ I + S  +G      +T+ +F+EL + L   T   ++  L DA++    
Sbjct: 241 KKMLSSRKKSVITLSS--QGRTVKVEVTKEKFDELLSPLLSRTALIMKNVLMDAELSWGD 298

Query: 424 IHDIVLVGGSTRIPKVQKLLQ 486
           I  IVLVGGSTR+P V  L++
Sbjct: 299 IDKIVLVGGSTRVPAVSDLIE 319


>UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus
           weihenstephanensis KBAB4|Rep: Heat shock protein Hsp70 -
           Bacillus weihenstephanensis KBAB4
          Length = 578

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 35/86 (40%), Positives = 56/86 (65%), Gaps = 5/86 (5%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFK-----R 175
           +++L++DLGGGTFDVSI+ I +G+ EVK++AG+  LGG DFDN +V+  V E++      
Sbjct: 163 QHILVYDLGGGTFDVSIIEIFEGVVEVKASAGNNKLGGMDFDNAIVDWVVNEYEMIHGIH 222

Query: 176 KYKKDLATNKRALRRLRTACERAKRT 253
            Y+ +  T +     L+   ER K++
Sbjct: 223 LYRVEGKTEQEVRALLKEEAERVKKS 248



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 6/84 (7%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSIT------RARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           S STQ S+     F GI     IT      R +FE+L   L  ST+  V+ +L+++ +  
Sbjct: 248 SLSTQMSVRFMVPFVGIHNGAPITIDMEISRGQFEQLIQKLAVSTLHEVDTALKESNLSL 307

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQD 489
             I  I+LVGGSTRIP +QK++++
Sbjct: 308 TSIDHILLVGGSTRIPYIQKIVEE 331


>UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular
           organisms|Rep: Heat shock protein 70 - Rhodoferax
           ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118)
          Length = 633

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 33/77 (42%), Positives = 47/77 (61%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + + DLGGGT DV+I+    G+FEVK+T+GDT LGG D +  +  H  + F+     D+ 
Sbjct: 169 IAVIDLGGGTLDVTIMEFGKGVFEVKATSGDTQLGGTDMNQCIYAHLAERFQMATGVDVR 228

Query: 197 TNKRALRRLRTACERAK 247
           T+ +A  RL  A E AK
Sbjct: 229 TDPKAAARLMEAAEAAK 245



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           + R   E L   +      PVE++L DA +   Q+  +V VGG TR+P V+   ++ F  
Sbjct: 275 LNRTELERLVRPVIERCRAPVEQALHDAGVTPKQVDRVVFVGGPTRMPAVRAFFEEMFGH 334

Query: 502 K 504
           K
Sbjct: 335 K 335



 Score = 39.9 bits (89), Expect = 0.061
 Identities = 16/27 (59%), Positives = 21/27 (77%)
 Frame = +3

Query: 636 GIETAGGVMTTLIKRNTTIPTKQTQTF 716
           G+ET GG+ T+LI RNT IP K+T+ F
Sbjct: 375 GVETLGGIATSLIARNTPIPVKRTELF 401


>UniRef50_Q20752 Cluster: Putative uncharacterized protein stc-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein stc-1 - Caenorhabditis elegans
          Length = 450

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 30/78 (38%), Positives = 52/78 (66%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV++ DLGGGT DVS+L ++ G+F  ++ AG+  LGG+DF++R+  H + +   K+ K +
Sbjct: 228 NVVVVDLGGGTLDVSVLWLQGGVFVTQAMAGNNRLGGQDFNDRVQKHLISKIAEKFGKTI 287

Query: 194 ATNKRALRRLRTACERAK 247
             NK  ++++R   E+ K
Sbjct: 288 -DNKEDIQQIRMEVEKGK 304



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 33/86 (38%), Positives = 52/86 (60%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           +GK  L++    +I ++    G   Y  +TR  FE LN DL ++   P+  +L DA +D 
Sbjct: 302 KGKIRLTNVPSTTISLNLKTVGKWNY-ELTRDEFETLNGDLLKAIELPITAALADANLDT 360

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFF 495
           A + +IVLVGGST++P V+K++  FF
Sbjct: 361 ADVDEIVLVGGSTQVPAVRKIVGRFF 386


>UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 708

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/89 (38%), Positives = 56/89 (62%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K++L+   +A   I S +  ID Y S+ R  F  L +DLF+     V++SL  AK+    
Sbjct: 276 KKELNYIIKAEFTIKSFYNNIDLYCSMNRREFRTLCSDLFKRAENLVKQSLEKAKLRPEN 335

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I  ++++GGS++IP++Q++LQD F+ KEP
Sbjct: 336 ISQVIMIGGSSQIPEIQQILQDIFD-KEP 363



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 35/82 (42%), Positives = 49/82 (59%), Gaps = 4/82 (4%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRK--YKKD 190
           VLIFD GGGT D+SI+ I +   +V +T GD H GG+D D  +VN F  +F+ K   K D
Sbjct: 196 VLIFDFGGGTLDISIVEIFNNQCKVIATNGDPHFGGQDIDQLLVNRFRYDFETKNGIKID 255

Query: 191 LAT--NKRALRRLRTACERAKR 250
             T   ++A+  L+  CE  K+
Sbjct: 256 QTTKEGQKAILLLKLCCENLKK 277


>UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacifica
           SIR-1|Rep: Chaperone DnaK - Plesiocystis pacifica SIR-1
          Length = 539

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 33/79 (41%), Positives = 51/79 (64%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R + ++D GGGTFDV+IL I   +FEV ST+G+  LGG+D D  ++   V  ++ ++  +
Sbjct: 189 RRIAVYDFGGGTFDVTILQITRNVFEVLSTSGEMFLGGDDLDAEILERMVATYQVQHGFN 248

Query: 191 LATNKRALRRLRTACERAK 247
           L  + RAL +LR A E+ K
Sbjct: 249 LHGDARALEQLRIAAEQVK 267



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 31/93 (33%), Positives = 53/93 (56%), Gaps = 4/93 (4%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEG----IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKM 411
           K  LS    AS+ ++++ +G    +DF  S++      +   + R T    E ++R A +
Sbjct: 267 KIQLSEQPSASVRVENIPKGSGRHLDF--SLSERDLRTIVEPIVRRTTPVCEDAMRVAGV 324

Query: 412 DKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
              QI +IVLVGG+TR+P V+++++D F GK P
Sbjct: 325 SAEQIDEIVLVGGTTRVPLVREVVEDIF-GKAP 356


>UniRef50_A6C7U8 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Planctomyces maris DSM 8797|Rep: DnaK protein (Heat
           shock protein), C-terminal region has VWA type A domain
           - Planctomyces maris DSM 8797
          Length = 715

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/80 (43%), Positives = 52/80 (65%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NVL++DLGGGTFDV++L I +    V ++ GD  LGG+D+D+R+V+    EF+ +Y  + 
Sbjct: 167 NVLVYDLGGGTFDVTLLRITEDETRVLTSEGDAELGGKDWDSRIVDFLAAEFQNEYGSNP 226

Query: 194 ATNKRALRRLRTACERAKRT 253
             +  A+  L  A E AKRT
Sbjct: 227 LDDVVAIGDLWVAAEDAKRT 246



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 21/58 (36%), Positives = 35/58 (60%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFF 495
           + R +F +L  DL   T++ V   L   +M    I++++LVGGSTR+P +Q+ L  +F
Sbjct: 268 LRREQFSDLCQDLVERTLDTVRSVLESQQMQPTDINEVLLVGGSTRMPMIQEALTSYF 325


>UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 527

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 34/80 (42%), Positives = 48/80 (60%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R +L++DLGGGTFDV+I+      F V +T GD  LGG D+  R+V+H  ++F +K+  D
Sbjct: 179 RTILVYDLGGGTFDVTIVRYSPTQFRVLATDGDVMLGGLDWSQRIVDHVAEQFMKKFGSD 238

Query: 191 LATNKRALRRLRTACERAKR 250
              +   LR     CE AKR
Sbjct: 239 PRQDPVTLRTCVQECEDAKR 258



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 32/91 (35%), Positives = 52/91 (57%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K +LS   Q  + I    +G     ++TR  FE + ADL + T +  E  ++ A ++K
Sbjct: 255 DAKRELSHKAQTPVSI--YHKGNTLTVALTRGDFERMTADLLQRTRDTTELVMQQAGVEK 312

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            Q+ D+VLVGGST +P V+++L+    G EP
Sbjct: 313 GQLDDVVLVGGSTLMPVVEEMLKKVC-GSEP 342


>UniRef50_Q0WM51 Cluster: HSP like protein; n=11; Magnoliophyta|Rep:
           HSP like protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 701

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/88 (39%), Positives = 59/88 (67%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           KE LS++T A I ++SL +  DF ++ITR +FEEL  DL+  ++ P++  L+ + +    
Sbjct: 143 KEILSANTAAPISVESLHDDRDFRSTITREKFEELCKDLWERSLTPLKDVLKHSGLKIDD 202

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I  + L+GG+TR+PK+Q  +Q+F  GK+
Sbjct: 203 ISAVELIGGATRVPKLQSTIQEFI-GKQ 229



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +2

Query: 65  TIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNK--RALRRLRTACE 238
           T+    F+VK    D  LGG+  + R+V HF  EF ++    +   K  +A+ +L+   +
Sbjct: 81  TVSVNQFQVKDVRWDLGLGGQSMEMRLVEHFADEFNKQLGNGVDVRKFPKAMAKLKKQVK 140

Query: 239 RAK 247
           R K
Sbjct: 141 RTK 143


>UniRef50_O23508 Cluster: Growth regulator like protein; n=6;
           Magnoliophyta|Rep: Growth regulator like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 912

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/88 (39%), Positives = 59/88 (67%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           KE LS++T A I ++SL +  DF ++ITR +FEEL  DL+  ++ P++  L+ + +    
Sbjct: 737 KEILSANTAAPISVESLHDDRDFRSTITREKFEELCKDLWERSLTPLKDVLKHSGLKIDD 796

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I  + L+GG+TR+PK+Q  +Q+F  GK+
Sbjct: 797 ISAVELIGGATRVPKLQSTIQEFI-GKQ 823



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +2

Query: 65  TIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNK--RALRRLRTACE 238
           T+    F+VK    D  LGG+  + R+V HF  EF ++    +   K  +A+ +L+   +
Sbjct: 675 TVSVNQFQVKDVRWDLGLGGQSMEMRLVEHFADEFNKQLGNGVDVRKFPKAMAKLKKQVK 734

Query: 239 RAK 247
           R K
Sbjct: 735 RTK 737


>UniRef50_O59838 Cluster: Heat shock protein homolog pss1; n=21;
           Fungi|Rep: Heat shock protein homolog pss1 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 720

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 34/80 (42%), Positives = 47/80 (58%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V I D G   + VSI+    G F +KST  D +LG  + D  ++++F  EFK KYK D
Sbjct: 199 RRVAIVDFGHSNYSVSIVEFSRGQFHIKSTVCDRNLGSRNMDKALIDYFAAEFKEKYKID 258

Query: 191 LATNKRALRRLRTACERAKR 250
           + +N +A  RL TA ER K+
Sbjct: 259 VLSNPKATFRLATAVERLKK 278



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 28/84 (33%), Positives = 50/84 (59%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++  A + ++ +   ID  + I R+ FEEL   L      P+EK+L  A + K  
Sbjct: 277 KKVLSANANAPLNVEMIMNDIDASSFIKRSDFEELIKPLLERLTPPIEKALELAGIKKED 336

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           ++ I +VGG TR+P V++++ ++F
Sbjct: 337 LYSIEMVGGCTRVPIVKEVIANYF 360


>UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera
           aphidicola (Baizongia pistaciae)|Rep: Chaperone protein
           hscA - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 511

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 31/57 (54%), Positives = 43/57 (75%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           V I+DLGGGTFD+SIL +  GIFEV +T+G+T+LGG+DFD  +VN+  ++    Y K
Sbjct: 203 VAIYDLGGGTFDISILKLNQGIFEVLATSGNTNLGGDDFDQLLVNYIQKKTHFSYSK 259



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 24/59 (40%), Positives = 35/59 (59%)
 Frame = +1

Query: 319 SITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFF 495
           +ITR  FE++   L   T+   +  L D+  +   I +I+LVGGST IP VQ+ + DFF
Sbjct: 296 TITRFEFEKMIEPLILKTLNICQHVLHDSNTNLTHIEEIILVGGSTNIPIVQRKVSDFF 354


>UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum
           ferrooxidans|Rep: HscA chaperone - Leptospirillum
           ferrooxidans
          Length = 588

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 27/46 (58%), Positives = 40/46 (86%)
 Frame = +2

Query: 23  IFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFV 160
           ++DLGGGTFD S+L+I  G+FEVK+T+GDTHLGG+DFD  +++ ++
Sbjct: 171 VYDLGGGTFDFSLLSIRRGVFEVKATSGDTHLGGDDFDQAIIDQWL 216



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/86 (26%), Positives = 53/86 (61%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LS +T+ ++ + ++  G++  T+++R    +    L + T+ PV K+L DA +  
Sbjct: 240 KAKIALSQNTEVAVSVPAI--GLE--TTLSRETMNKWVEPLVQRTLIPVHKALSDAGVLP 295

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFF 495
            ++  ++LVGG+TR+ +V++ +++ F
Sbjct: 296 GEVDGVILVGGATRLLRVKEAVEELF 321



 Score = 41.1 bits (92), Expect = 0.027
 Identities = 18/27 (66%), Positives = 22/27 (81%)
 Frame = +3

Query: 636 GIETAGGVMTTLIKRNTTIPTKQTQTF 716
           GIET GGVM++LI RNTTIPT+  + F
Sbjct: 364 GIETMGGVMSSLIPRNTTIPTQAKELF 390


>UniRef50_Q92598 Cluster: Heat shock protein 105 kDa; n=92;
           Eumetazoa|Rep: Heat shock protein 105 kDa - Homo sapiens
           (Human)
          Length = 858

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 35/80 (43%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V+  D+G   F VS      G  +V  TA D  LGG++FD ++V HF  EFK KYK D
Sbjct: 196 RIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
             +  RAL RL   CE+ K+
Sbjct: 256 AKSKIRALLRLYQECEKLKK 275



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           S+ST   + I+      D    + R++FEEL A+L +    P+   L    +    +  +
Sbjct: 279 SNSTDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GK+
Sbjct: 339 EIVGGATRIPAVKERIAKFF-GKD 361


>UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26;
           Bacteria|Rep: Chaperone protein hscC - Bacillus
           anthracis
          Length = 566

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 36/78 (46%), Positives = 50/78 (64%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLAT 199
           L+FDLGGGTFDVSIL + +GI +VKS AGD +LGGEDF   ++  F++    +   D + 
Sbjct: 166 LVFDLGGGTFDVSILELFEGIMDVKSIAGDNYLGGEDFTRSLMTFFLE--SHQLDPD-SL 222

Query: 200 NKRALRRLRTACERAKRT 253
           + + L  + T  ER K T
Sbjct: 223 DSKTLSLIYTQAERCKLT 240



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 24/86 (27%), Positives = 50/86 (58%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           L+   +++  ++ + +   + TSI R  FE++   L      P+E++LRDA ++   +  
Sbjct: 239 LTLCNESAATMNVVIQNQTYETSINRGEFEKIVTPLLLRLRYPIERALRDASLNPNDLDA 298

Query: 433 IVLVGGSTRIPKVQKLLQDFFNGKEP 510
           ++L+GG+TR+P V+ ++   F G+ P
Sbjct: 299 VILIGGATRMPLVKSVISKMF-GRMP 323


>UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2;
           Actinomycetales|Rep: Heat shock protein HSP70 -
           Saccharopolyspora erythraea (strain NRRL 23338)
          Length = 555

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 38/107 (35%), Positives = 56/107 (52%), Gaps = 2/107 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R +L++DLGGGTFD + + +     EV  T GD HLGG D+D R+ ++ +Q F      D
Sbjct: 169 RTILVYDLGGGTFDTTAIRVSSDEIEVLCTDGDDHLGGADWDARLRDYLLQRFTESTGTD 228

Query: 191 LATNKRALRRLRTACERAKRTCHRPHKR--ALR*ILSLRVLTSTRQL 325
              ++  ++ L T  E  K+   R   R  ALR   S   +  TR+L
Sbjct: 229 AEDDEEFMQSLATTAEETKKQLSRAESRPVALRGAGSSARVEVTREL 275



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 30/93 (32%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDA--KM 411
           E K+ LS +    + +     G      +TR  FE    DL   T++ V ++L     K 
Sbjct: 245 ETKKQLSRAESRPVALRGA--GSSARVEVTRELFEHETRDLLDKTIDIVRRTLETLRDKR 302

Query: 412 DKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
               I D++LVGGST++P V + L+  F G EP
Sbjct: 303 PGTTIDDVLLVGGSTKMPAVAERLRAEF-GWEP 334


>UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena CCY
           9414|Rep: DnaK protein - Nodularia spumigena CCY 9414
          Length = 578

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 31/83 (37%), Positives = 53/83 (63%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           +   +++FD GGGT D+S+L + +G+ +VKS+ GD  LGG+DFD  M++  +Q+F  +Y 
Sbjct: 164 SEEQLVVFDFGGGTLDISVLEMFEGVLDVKSSFGDPQLGGKDFDAVMISLLLQKFAAQYP 223

Query: 185 KDLATNKRALRRLRTACERAKRT 253
           +    N+     L+   E+AK+T
Sbjct: 224 EVAVENRET--ELKGQAEQAKKT 244



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/71 (33%), Positives = 39/71 (54%)
 Frame = +1

Query: 298 EGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQK 477
           +GID    ITR  FE+    L       + ++L   K+  + I  ++LVGG+T IP V+ 
Sbjct: 264 KGIDLDIEITRTEFEQAIEPLLERARICIREALNAKKIRPSAIDRVLLVGGTTYIPAVRN 323

Query: 478 LLQDFFNGKEP 510
           ++ + F GK+P
Sbjct: 324 MVAEMF-GKQP 333


>UniRef50_Q54GD7 Cluster: Heat shock protein Hsp70 family protein;
           n=2; Dictyostelium discoideum|Rep: Heat shock protein
           Hsp70 family protein - Dictyostelium discoideum AX4
          Length = 772

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 33/79 (41%), Positives = 48/79 (60%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NVL  D+G     VS +  + G  +V  TA + ++G   FD  +V HF +EF+ KYK ++
Sbjct: 195 NVLFVDVGDSATSVSAVQYKKGQLKVLGTASNPNIGSRVFDETLVKHFAKEFQTKYKINV 254

Query: 194 ATNKRALRRLRTACERAKR 250
             NK+AL RLR ACE+ K+
Sbjct: 255 FENKKALIRLRQACEKVKK 273



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/82 (37%), Positives = 46/82 (56%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LSS+ +A + IDSL +  D    I RA FEEL  D   + +EP+++ L + +M   Q
Sbjct: 272 KKILSSNNEAPVSIDSLMDDKDVKGMIDRATFEELANDDMNTIVEPLQRLLSELQMTPDQ 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQD 489
              I + GG TR   +QK L +
Sbjct: 332 FQSIEITGGGTRSTSLQKKLSE 353


>UniRef50_UPI0000F1F58C Cluster: PREDICTED: similar to Heat shock
           protein 4, partial; n=1; Danio rerio|Rep: PREDICTED:
           similar to Heat shock protein 4, partial - Danio rerio
          Length = 298

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 33/80 (41%), Positives = 47/80 (58%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  ++ +TA D  +GG+ FD R+V +F +EF  KYK D
Sbjct: 53  RNVVFVDIGHSGYQVSVCAFNKGKLKILATAFDPEMGGKYFDERLVKYFCEEFVVKYKLD 112

Query: 191 LATNKRALRRLRTACERAKR 250
             T  RAL RL   CE+ K+
Sbjct: 113 AKTKPRALVRLFQECEKLKK 132


>UniRef50_Q7ZUM5 Cluster: Heat shock protein 4; n=20;
           Euteleostomi|Rep: Heat shock protein 4 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 840

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 33/80 (41%), Positives = 47/80 (58%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  ++ +TA D  +GG+ FD R+V +F +EF  KYK D
Sbjct: 196 RNVVFVDIGHSGYQVSVCAFNKGKLKILATAFDPEMGGKYFDERLVKYFCEEFVVKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
             T  RAL RL   CE+ K+
Sbjct: 256 AKTKPRALIRLFQECEKLKK 275



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 27/85 (31%), Positives = 49/85 (57%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++S+   + I+     +D  + + RA+FEE+ AD+      P+   L  A + K  IH +
Sbjct: 279 ANSSDLPLNIECFMNDVDVSSRLNRAQFEEMCADILARVEPPLRSLLEQAHLKKDDIHAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKEP 510
            +VGG++R+P +++ +  FF GKEP
Sbjct: 339 EIVGGASRMPAIKERISKFF-GKEP 362


>UniRef50_A2FKE2 Cluster: DnaK protein; n=3; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 573

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 37/83 (44%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVK--STAGDTHLGGEDFDNRMVNHFVQEFKRK 178
           T + +LIFD GGGT DVS++ I     EVK  +TAGD+HLGG + DN++  +   +    
Sbjct: 175 TEQKLLIFDFGGGTLDVSVIEINKN-NEVKELATAGDSHLGGRNIDNKLAEYIFGKLAES 233

Query: 179 YKKDLATNKRALRRLRTACERAK 247
             KD   NK+ L  ++ ACERAK
Sbjct: 234 -GKDYRNNKKVLSIVQDACERAK 255



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 36/86 (41%), Positives = 53/86 (61%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS+      +I   F    +  +ITR  FE++N D+F   + PVE++LR A + K QI D
Sbjct: 258 LSNKGTIRADISFNFNQESYSYTITRKNFEKINDDIFDKILPPVEEALRKANLTKDQITD 317

Query: 433 IVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I+ VGGS+ IP V++ L DFF+ K+P
Sbjct: 318 ILAVGGSSHIPIVRETLSDFFD-KDP 342


>UniRef50_A3LND0 Cluster: Lumen HSP Seventy; n=2;
           Saccharomycetales|Rep: Lumen HSP Seventy - Pichia
           stipitis (Yeast)
          Length = 929

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 32/77 (41%), Positives = 51/77 (66%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS++++    ++S+++  DF TSITR  FEE+N+DL     EP+  SL+D+ +    +  
Sbjct: 317 LSANSEYHASLESIYDDRDFKTSITRGEFEEINSDLMGRITEPILSSLKDSGVTLDNVKS 376

Query: 433 IVLVGGSTRIPKVQKLL 483
           I+L GGSTR+P +QK L
Sbjct: 377 IILNGGSTRVPFIQKHL 393


>UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 605

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 33/77 (42%), Positives = 50/77 (64%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLAT 199
           ++ D GGGTFDVSI+T+ D  F V +T GDTHLGG+D D  M+N+ + E   + +K +  
Sbjct: 200 IVIDFGGGTFDVSIVTVSDKEFTVNATDGDTHLGGKDIDIEMMNYLL-ENNEQLEKYVTF 258

Query: 200 NKRALRRLRTACERAKR 250
             +++R    AC R+K+
Sbjct: 259 QDKSIRS-EVACTRSKK 274



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/63 (34%), Positives = 39/63 (61%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           I    F EL   LF+   + +E++L    + K +I D++LVGG T++   +K++++FF G
Sbjct: 319 IDSTTFIELCDPLFKRIQQTIERALNKKGILKEEIKDVILVGGPTKLCCFKKMIKEFF-G 377

Query: 502 KEP 510
           K+P
Sbjct: 378 KQP 380


>UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera
           aphidicola str. Cc (Cinara cedri)|Rep: Molecular
           chaperone - Buchnera aphidicola subsp. Cinara cedri
          Length = 499

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 37/77 (48%), Positives = 49/77 (63%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFDVSIL I  GIFEV ST G+  LGG+DFD ++V   + + K   KK L 
Sbjct: 187 ICVYDLGGGTFDVSILKISKGIFEVLSTNGNCKLGGDDFDKKLVYLLISKIK---KKPL- 242

Query: 197 TNKRALRRLRTACERAK 247
            NK   ++L    E+ K
Sbjct: 243 LNKILFKKLLIIAEKIK 259



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/60 (33%), Positives = 35/60 (58%)
 Frame = +1

Query: 325 TRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           ++  F +L     + T++ ++ +L DA + K +I DI+LVGG T IP + + +  FF  K
Sbjct: 280 SKKEFNQLIYPFIKKTLKILKIALNDANISKKKIKDIILVGGFTYIPLIHECIYSFFKIK 339



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +3

Query: 636 GIETAGGVMTTLIKRNTTIPTKQTQTF 716
           GIE  GG+M  +IK+NT IPT+  + F
Sbjct: 384 GIELVGGLMEKMIKKNTKIPTEVIKYF 410


>UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: 70 kD heat
           shock protein - Saccharopolyspora erythraea (strain NRRL
           23338)
          Length = 538

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK- 187
           R++L++DLGGGTFD + + +E     V  T GD  LGG D+D R+V H ++ F+ ++ + 
Sbjct: 170 RHLLVYDLGGGTFDTTAIRVERDDIRVVCTDGDQALGGADWDRRIVEHLLEVFRARHPRL 229

Query: 188 DLATNKRALRRLRTACERAKRTCHRPHKR 274
           D A ++ A++   +  E  K+   R   R
Sbjct: 230 DPAADEEAMQEFHSTAEELKKALSRTESR 258



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 1/68 (1%)
 Frame = +1

Query: 295 FEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ-IHDIVLVGGSTRIPKV 471
           F G      +TRA    L  DL   TME   ++L  A+    +   D++L GG TR+P V
Sbjct: 264 FAGAAAGVELTRADLRRLTGDLLDRTMEITRRTLEVARRKGIERFDDVLLAGGMTRMPAV 323

Query: 472 QKLLQDFF 495
            + L+  F
Sbjct: 324 AENLRTRF 331


>UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 707

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 4/82 (4%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           +L++D GGGTFDVS++ I    FEV    GD+HLGG+D DN +V +F   F  K + D+ 
Sbjct: 195 ILVYDFGGGTFDVSLVGINGKNFEVIGYDGDSHLGGQDIDNALVQYFAPNFLMKTRIDIF 254

Query: 197 T----NKRALRRLRTACERAKR 250
                +KR   +++  CE  K+
Sbjct: 255 ADDNQSKRYKGQMKQQCEHLKK 276


>UniRef50_Q2H062 Cluster: Putative uncharacterized protein; n=2;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Chaetomium globosum (Soil fungus)
          Length = 763

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 33/80 (41%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V   D+G   +  SI+  + G   VK  A D HLGG DFD  +V H  +EF  KYK D
Sbjct: 195 RRVAFVDVGYSDYSCSIVEFKKGELAVKGNAYDRHLGGRDFDRALVEHLQKEFLGKYKID 254

Query: 191 LATNKRALRRLRTACERAKR 250
           + +N +AL R+  A E+ K+
Sbjct: 255 IFSNPKALTRVYAAAEKLKK 274



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 32/85 (37%), Positives = 51/85 (60%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++ QA + I+SL   ID    ITR  FE +   L       +E++L +AK++K  
Sbjct: 273 KKVLSANQQAPLNIESLMNDIDVRAMITRQEFEAMTEPLISRIDVILEQALTEAKLNKED 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFN 498
           I  I +VGG +R+P +++ +Q FFN
Sbjct: 333 IDIIEVVGGGSRVPAIKERIQGFFN 357


>UniRef50_Q06068 Cluster: 97 kDa heat shock protein; n=3;
           Strongylocentrotus|Rep: 97 kDa heat shock protein -
           Strongylocentrotus purpuratus (Purple sea urchin)
          Length = 889

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 30/80 (37%), Positives = 46/80 (57%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D G  +  VS+     G  +V + A D +LGG DFD  +  HF  +F+ +YK D
Sbjct: 196 RNVVFVDCGHSSLQVSVCAFNKGKLKVLANASDKNLGGRDFDWLLAEHFAVDFQTRYKMD 255

Query: 191 LATNKRALRRLRTACERAKR 250
           + +N+RA  RL   C++ K+
Sbjct: 256 VKSNQRAWLRLMAECDKTKK 275



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 26/80 (32%), Positives = 45/80 (56%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           +++T  S+ I+ +    D    I+RA FE L A+L +    P++  L   K+    IH I
Sbjct: 279 ANATLISMNIECIMNDRDVSGKISRADFEALAAELLKRVEVPLKSVLEQTKLKPEDIHSI 338

Query: 436 VLVGGSTRIPKVQKLLQDFF 495
            +VGGS+RIP +++ ++  F
Sbjct: 339 EIVGGSSRIPSIKETIKKVF 358


>UniRef50_Q0VDF9 Cluster: Heat shock 70 kDa protein 14; n=25;
           Euteleostomi|Rep: Heat shock 70 kDa protein 14 - Homo
           sapiens (Human)
          Length = 509

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 36/88 (40%), Positives = 53/88 (60%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+   A+  +DSL+EG DF  +++RARFE L + LF   +E +   L         
Sbjct: 269 KHSLSTLGSANCFLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADD 328

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I+ +VL GGS+RIPK+Q+L++D F   E
Sbjct: 329 INKVVLCGGSSRIPKLQQLIKDLFPAVE 356



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 28/82 (34%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           + N+L+F LGG +  +S++ +  GI+ V ST  D ++GG  F   +  +   EF+R +K 
Sbjct: 190 KSNILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQRSFKH 249

Query: 188 DLATNKRALRRLRTACERAKRT 253
           D+  N RA+ +L  + E AK +
Sbjct: 250 DVRGNARAMMKLTNSAEVAKHS 271


>UniRef50_P32590 Cluster: Heat shock protein homolog SSE2; n=20;
           Saccharomycetales|Rep: Heat shock protein homolog SSE2 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 693

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 31/80 (38%), Positives = 44/80 (55%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R + + D+G  T+  SI+    G  +V  TA D H GG DFD  +  HF  +FK KYK D
Sbjct: 197 RIIGLVDIGHSTYTCSIMAFRKGEMKVLGTAYDKHFGGRDFDRAITEHFADQFKDKYKID 256

Query: 191 LATNKRALRRLRTACERAKR 250
           +  N +A  R+  A E+ K+
Sbjct: 257 IRKNPKAYNRILIAAEKLKK 276



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 27/84 (32%), Positives = 48/84 (57%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++T A   ++S+ + ID  + ++R   EEL   L +    P+  +L  AK+    
Sbjct: 275 KKVLSANTTAPFSVESVMDDIDVSSQLSREELEELVEPLLKRVTYPITNALAQAKLTVND 334

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           I  + ++GG+TRIP ++K + D F
Sbjct: 335 IDFVEIIGGTTRIPVLKKSISDVF 358


>UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera
           aphidicola|Rep: Chaperone protein hscA - Buchnera
           aphidicola subsp. Acyrthosiphon pisum (Acyrthosiphon
           pisumsymbiotic bacterium)
          Length = 611

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 28/50 (56%), Positives = 41/50 (82%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQE 166
           VL++DLGGGTFDVSIL +  GIFEV +T+GD++LGG+DFD+ +  +  ++
Sbjct: 195 VLVYDLGGGTFDVSILNLNKGIFEVLATSGDSNLGGDDFDDALAKNIYKK 244



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = +1

Query: 307 DFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQ 486
           D+   ITR  F  +  D  + T+      L +  +   QI ++++VGGSTRIP V   + 
Sbjct: 282 DWKGYITREEFNLIIIDFIKKTLFICSDLLEEINLSVEQIKEVIMVGGSTRIPLVHTEVS 341

Query: 487 DFF 495
            FF
Sbjct: 342 KFF 344



 Score = 37.1 bits (82), Expect = 0.43
 Identities = 20/68 (29%), Positives = 29/68 (42%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPD+           +L   K+                GIE  GG +  +I RNT++
Sbjct: 350 KSINPDQVVAIGAAMHVDMLFSSKNNTKNKVILLDVMPLSLGIEVMGGFVEKIIFRNTSL 409

Query: 693 PTKQTQTF 716
           P  +T+ F
Sbjct: 410 PISKTKEF 417


>UniRef50_Q96269 Cluster: Heat-shock protein; n=14;
           Magnoliophyta|Rep: Heat-shock protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 831

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 32/79 (40%), Positives = 45/79 (56%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV   D+G  +  V I   + G  ++ S A D  LGG DFD  + NHF  +FK +YK D+
Sbjct: 195 NVAFIDIGHASMQVCIAGFKKGQLKILSHAFDRSLGGRDFDEVLFNHFAAKFKDEYKIDV 254

Query: 194 ATNKRALRRLRTACERAKR 250
           + N +A  RLR  CE+ K+
Sbjct: 255 SQNAKASLRLRATCEKLKK 273



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 30/89 (33%), Positives = 51/89 (57%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++  A + I+ L +  D    I R  FEE++  +      P+EK+L DA +    
Sbjct: 272 KKVLSANPLAPLNIECLMDEKDVRGVIKREEFEEISIPILERVKRPLEKALSDAGLTVED 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +H + ++G  +R+P + K+L +FF GKEP
Sbjct: 332 VHMVEVIGSGSRVPAMIKILTEFF-GKEP 359


>UniRef50_A2DWC1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 649

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 2/82 (2%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           R ++LI+D GGGTFD+S+ TI++   EVKST GD+ LGG+D D  +VN+     ++    
Sbjct: 195 RHHILIYDFGGGTFDISLATIDNKTVEVKSTGGDSRLGGQDIDAALVNYLAPLIQKNCGI 254

Query: 188 DLAT--NKRALRRLRTACERAK 247
           D+    N++    ++   E+AK
Sbjct: 255 DIKKKGNEKMFNIVKRESEQAK 276


>UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1;
           Methanospirillum hungatei JF-1|Rep: Heat shock protein
           70 - Methanospirillum hungatei (strain JF-1 / DSM 864)
          Length = 571

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/79 (37%), Positives = 48/79 (60%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R VL++D GGGTFDVSIL++  G F+V ++ G+  LGG+D D R++ +  +  +++  K 
Sbjct: 164 RKVLVYDFGGGTFDVSILSVSSGFFDVDASTGEHRLGGDDLDTRIIAYVTKALQKELGKS 223

Query: 191 LATNKRALRRLRTACERAK 247
              +      L+ A E AK
Sbjct: 224 DKIDLALQATLKEAAEEAK 242



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 37/92 (40%), Positives = 54/92 (58%), Gaps = 1/92 (1%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYT-SITRARFEELNADLFRSTMEPVEKSLRDAKMD 414
           E K  LS+     I I  + E    +T  +TR   E L  DL   T  P+E++L DA ++
Sbjct: 240 EAKIALSTEESTQITIPFVAENRPPFTMELTRQTLESLIQDLIERTRAPMERALHDASLE 299

Query: 415 KAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           K +I DI+LVGG+T IP V++ + ++F GKEP
Sbjct: 300 KDEIDDILLVGGTTLIPAVRRFVTEYF-GKEP 330


>UniRef50_Q10061 Cluster: Heat shock protein 70 homolog precursor;
           n=1; Schizosaccharomyces pombe|Rep: Heat shock protein
           70 homolog precursor - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 848

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 32/83 (38%), Positives = 54/83 (65%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS++++A   I+ L +GIDF   ITR+  E L  D+  + +EP+ K+L+ A +  ++
Sbjct: 305 KHILSANSEAIASIEELADGIDFRLKITRSVLESLCKDMEDAAVEPINKALKKANLTFSE 364

Query: 424 IHDIVLVGGSTRIPKVQKLLQDF 492
           I+ I+L GG++RIP +Q  L D+
Sbjct: 365 INSIILFGGASRIPFIQSTLADY 387


>UniRef50_UPI00005A5FFD Cluster: PREDICTED: similar to heat shock
           protein 2; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to heat shock protein 2 - Canis familiaris
          Length = 158

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 30/49 (61%), Positives = 38/49 (77%)
 Frame = +2

Query: 44  TFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           TFD+ IL I+D IFEVKSTA ++HL GE FD+ MV H ++EFK K+K D
Sbjct: 17  TFDIFILNIQDDIFEVKSTADNSHLDGEQFDSCMVGHLIEEFKCKHKVD 65



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 30/68 (44%), Positives = 48/68 (70%)
 Frame = +1

Query: 304 IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           +D+        FE+LNA LF S ++ VE+S +DA++DK+ I++IV++ G +  P+ QKLL
Sbjct: 64  VDYSLQQAGTHFEQLNAYLFHSALKLVEESQKDARLDKSHINEIVIMCGPSCTPQFQKLL 123

Query: 484 QDFFNGKE 507
           ++F NGKE
Sbjct: 124 KNFLNGKE 131


>UniRef50_A7SM46 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 938

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 32/80 (40%), Positives = 47/80 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++ +   +I+ +F+G DF   +TR   EE+  DLF     PV ++L+ A M    
Sbjct: 313 KQVLSANNEIFAQIEGVFDGKDFRVKVTREELEEMCQDLFDRVAGPVNRALKSASMTMND 372

Query: 424 IHDIVLVGGSTRIPKVQKLL 483
           I  +VLVGG  R+PKVQ  L
Sbjct: 373 IDSVVLVGGGIRVPKVQDAL 392



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = +2

Query: 89  VKSTAGDTHLGGEDFDNRMVNHFVQEFKR--KYKKDLATNKRALRRLRTACERAKR 250
           +K    D  LGG   D R+ +H VQ FK+  K+K ++  + RA+ +      R K+
Sbjct: 259 IKGIGFDRTLGGHAIDMRLRDHLVQLFKKNYKFKGEVTQSSRAMAKFYKEALRVKQ 314


>UniRef50_Q6CII0 Cluster: Similar to sp|P36016 Saccharomyces
           cerevisiae YKL073w LHS1 chaperone of the ER lumen; n=1;
           Kluyveromyces lactis|Rep: Similar to sp|P36016
           Saccharomyces cerevisiae YKL073w LHS1 chaperone of the
           ER lumen - Kluyveromyces lactis (Yeast) (Candida
           sphaerica)
          Length = 863

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 34/83 (40%), Positives = 54/83 (65%), Gaps = 4/83 (4%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPV----EKSLRDAKMDKA 420
           LS+++ ASI I+SL+  +DF T+ITRA+FEE  A+L    +EP+    E  L    ++  
Sbjct: 314 LSANSDASISIESLYHDLDFKTTITRAKFEEFVAELQSVVIEPILSTLESPLNGKALNVK 373

Query: 421 QIHDIVLVGGSTRIPKVQKLLQD 489
            +  ++L GGSTR+P V+K L++
Sbjct: 374 DLDSVILTGGSTRVPFVKKQLEN 396


>UniRef50_A6R6X7 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 504

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 29/84 (34%), Positives = 53/84 (63%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS  T A++ I+SL  G+DF +++ R R+E L+  +F +    +E+S++ A +D   
Sbjct: 200 KKSLSLGTNATLSIESLASGVDFSSTVNRTRYELLSGKVFANFTRLIEESVKKADLDILD 259

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           I + +L GG++  PK+ +L+Q  F
Sbjct: 260 IDEAILCGGTSHTPKIARLVQSLF 283



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/79 (34%), Positives = 47/79 (59%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           V++ D GG   DV+++    G++ + +TA D  LGG   D  +++HF +EF +K+K D  
Sbjct: 124 VVVADFGGTRSDVAVIATRGGMYTILATAHDYELGGAQLDQVLIDHFSKEFIKKHKVDPR 183

Query: 197 TNKRALRRLRTACERAKRT 253
            N R+L +L+   E  K++
Sbjct: 184 ENARSLAKLKLEAELTKKS 202


>UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative gdh;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           putative gdh - Nasonia vitripennis
          Length = 486

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 29/61 (47%), Positives = 44/61 (72%)
 Frame = -2

Query: 510 WLLSIKEILQELLHLGDTSGATHQYNIVDLSLIHLGITERLLHWLHGRPEQIGVQLLEAS 331
           WLL+ +E+L ELL+ G+TSG + ++++VD+ L H+ + + LLH LHG  E+I VQL E  
Sbjct: 217 WLLATEELLNELLNFGNTSGTSDEHDLVDVLLAHVSVFKDLLHGLHGASEEIHVQLFELG 276

Query: 330 T 328
           T
Sbjct: 277 T 277



 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 23/50 (46%), Positives = 36/50 (72%)
 Frame = -1

Query: 163 LDKVVDHAIVKVLTSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYI 14
           LD+V+   +VKVLTSQV V  GG  LED+++DG+   ++GT  +V+D+ +
Sbjct: 284 LDEVIHDTLVKVLTSQVSVTVGGNDLEDSVVDGQKTDIKGTTTQVEDENV 333



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 26/66 (39%), Positives = 39/66 (59%)
 Frame = -3

Query: 716 ECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCYIKQQQILHLLRLVTVQDSSLDSCTISY 537
           E L L  GD  V+ DE GHD+++  NT G+   +K+   + +  L T +DS L+  T+S 
Sbjct: 150 EDLRLLGGDDGVSGDELGHDSTNGFNTHGERVDVKKNDGISV--LFTREDSGLNGGTVSD 207

Query: 536 GLVRVN 519
            LVRV+
Sbjct: 208 SLVRVD 213


>UniRef50_Q2QXK2 Cluster: DnaK protein, expressed; n=2; Oryza
           sativa|Rep: DnaK protein, expressed - Oryza sativa
           subsp. japonica (Rice)
          Length = 461

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 38/94 (40%), Positives = 60/94 (63%), Gaps = 6/94 (6%)
 Frame = +1

Query: 244 KEDLSSS--TQASIEIDSLFEG-IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMD 414
           K  LSS    Q ++   +L  G   F  S+TRA+FEELN DLF   +  V+ ++ +A+  
Sbjct: 308 KRTLSSHDVAQVNLHATNLANGAFSFSGSLTRAQFEELNHDLFEKVISLVDAAMAEARRA 367

Query: 415 KAQ---IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
            A    I ++VLVGGST+IP++++L++++F GKE
Sbjct: 368 VAGFDVIDEVVLVGGSTKIPRIRELIKNYFAGKE 401



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 32/80 (40%), Positives = 48/80 (60%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NVL+  +GGGT   ++LT ++ +FE  ++  D HLGG+DFD R+   F Q  KR +    
Sbjct: 233 NVLVLHVGGGTSAATVLTYDNAVFEAVASRHDAHLGGDDFDARIAGRFSQLIKRDHGG-- 290

Query: 194 ATNKRALRRLRTACERAKRT 253
             +  A  +L++ CE AKRT
Sbjct: 291 GVDDIAPAKLKSQCELAKRT 310


>UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 876

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 29/57 (50%), Positives = 40/57 (70%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           LI+D GGGTFD+S++ I+    EVK   GD HLGG D DN++V+  VQ+ K++Y  D
Sbjct: 199 LIYDFGGGTFDLSLVEIKGTTIEVKDNHGDPHLGGRDIDNKIVDLVVQKIKQQYSID 255



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 23/63 (36%), Positives = 38/63 (60%), Gaps = 1/63 (1%)
 Frame = +1

Query: 319 SITRARFEELNADLFRSTMEPVEKSL-RDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFF 495
           ++T   FE++   L   T+  VE+ L R+  +DK  + +I+LVGGS+ I  V+  L++ F
Sbjct: 299 TMTCREFEQILDPLVDKTIALVEEILKRNGGIDK--LDNIILVGGSSLIYYVRDKLEEKF 356

Query: 496 NGK 504
            GK
Sbjct: 357 EGK 359


>UniRef50_P38788 Cluster: Ribosome-associated complex subunit SSZ1;
           n=12; Saccharomycetales|Rep: Ribosome-associated complex
           subunit SSZ1 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 538

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 28/80 (35%), Positives = 49/80 (61%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV++ D GG   D +++ + +GIF + +TA D  LGG++ D  +V +F  EF++KY+ + 
Sbjct: 193 NVVVADFGGIRSDAAVIAVRNGIFTILATAHDLSLGGDNLDTELVEYFASEFQKKYQANP 252

Query: 194 ATNKRALRRLRTACERAKRT 253
             N R+L +L+      K+T
Sbjct: 253 RKNARSLAKLKANSSITKKT 272



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/81 (34%), Positives = 47/81 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++T A+I IDSL +G D++ SI R R+E +   +F      V+  +  A++D   
Sbjct: 270 KKTLSNATSATISIDSLADGFDYHASINRMRYELVANKVFAQFSSFVDSVIAKAELDPLD 329

Query: 424 IHDIVLVGGSTRIPKVQKLLQ 486
           I  ++L GG +  PK+   L+
Sbjct: 330 IDAVLLTGGVSFTPKLTTNLE 350


>UniRef50_A7PR73 Cluster: Chromosome chr14 scaffold_26, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr14 scaffold_26, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 166

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 27/40 (67%), Positives = 35/40 (87%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLG 121
           G  +N+L+FDLGGG FDVS+LTI++G+FEV +T GDTHLG
Sbjct: 105 GGEKNILVFDLGGGIFDVSVLTIDNGVFEVLATNGDTHLG 144


>UniRef50_A2E407 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 693

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 34/86 (39%), Positives = 51/86 (59%), Gaps = 4/86 (4%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRK-- 178
           T+  VLIFD GGGT D+SI+ I      V  T G+ H GG+D D  +V +F  +F+++  
Sbjct: 194 TQEKVLIFDFGGGTLDISIVDINQTECRVVKTKGNPHFGGQDIDKILVGYFKDDFEKQNN 253

Query: 179 YKKDLAT--NKRALRRLRTACERAKR 250
            K D++T   + A+  L+  CE+ KR
Sbjct: 254 VKIDMSTKEGQMAMMLLKIECEKLKR 279



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 26/87 (29%), Positives = 52/87 (59%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K +LS+   A+  ++  ++G D    +T+  FE+  +       + +E++L +AK+    
Sbjct: 278 KRNLSNLRTANFTLNKFYQGFDLNAKLTKRNFEKRISGFLEKAKDLIEETLNEAKLQPDD 337

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           I  I+LVGGS++IP V +L++++F+ K
Sbjct: 338 ISQIILVGGSSQIPAVGELIENYFDKK 364


>UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Clostridium acetobutylicum|Rep: DnaK protein (Heat shock
           protein), C-terminal region has VWA type A domain -
           Clostridium acetobutylicum
          Length = 698

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 29/83 (34%), Positives = 51/83 (61%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +N+L++DLGGGTFDV+++ I + + +V ST GD  LGG+D+D+R+  +  ++F  K+
Sbjct: 162 GENKNILVYDLGGGTFDVTLVHIGEELIKVLSTDGDHELGGKDWDDRIAMYIGEKFFEKF 221

Query: 182 KKDLATNKRALRRLRTACERAKR 250
             +   +      +   CE  K+
Sbjct: 222 GVNPMDDIEYYNDILVKCENVKK 244



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 23/83 (27%), Positives = 41/83 (49%)
 Frame = +1

Query: 262 STQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVL 441
           S + S +I   +  +    +IT+  F  L  DL + T    +  ++ A +    I  ++ 
Sbjct: 247 SKRESTDISIYYCDLSEKFTITKEIFLGLTGDLLQRTKSLSDDVIKSAGLTWEDIDGVLP 306

Query: 442 VGGSTRIPKVQKLLQDFFNGKEP 510
           VGGSTR+P V   +++  + KEP
Sbjct: 307 VGGSTRMPMVLDFIKE-VSKKEP 328


>UniRef50_A0C553 Cluster: Chromosome undetermined scaffold_15, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_15,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 898

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 30/88 (34%), Positives = 51/88 (57%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           KE LS++ +  + ++ L +G D+ TSI R+ FE L  D  +   EP+   L  +   K  
Sbjct: 304 KEILSANKETQVYLEGLIDGEDYTTSIQRSTFESLFEDRLQQLTEPINYVLEKSNKTKED 363

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I+ + L+GG  R+PK+Q++L ++F   E
Sbjct: 364 INIVELIGGGIRVPKIQQVLANYFGSVE 391



 Score = 36.3 bits (80), Expect = 0.76
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
 Frame = +2

Query: 110 THLGGEDFDNRMVNHFVQEF----KRKYKKDLATNKRALRRLRTACERAK 247
           ++ GG+  D  + NHF +EF     RK KK + TN +A+ +L  A  + K
Sbjct: 255 SNAGGQSLDLLLANHFAREFDNQPSRKGKKSIFTNSKAMNKLLKASNKYK 304


>UniRef50_A2YAM2 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 516

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 36/113 (31%), Positives = 67/113 (59%), Gaps = 1/113 (0%)
 Frame = +1

Query: 166 VQEEIQKGPRYQQESS*AFAYCM*EGKEDLSSSTQASIEIDSLFE-GIDFYTSITRARFE 342
           ++E+  +  R ++++           K+ LS   +  +++DSL + G  F  ++TRA+FE
Sbjct: 343 IKEQHGRDVRQEEKAMVRLRVACEHAKKALSEQQETLVQMDSLLDDGAVFSATLTRAKFE 402

Query: 343 ELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           ELN DL    M  V++ +      +  + ++++VGGS RIPKV++L++D+FNG
Sbjct: 403 ELNHDLLDRAMALVKEVVVTTGGVEV-VDEVLVVGGSARIPKVRQLVKDYFNG 454



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 13/96 (13%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGG-------------EDFDNR 142
           G R+ +L+F LGG T   +I    DG   + +T     LGG             +DF  R
Sbjct: 275 GDRKAILVFHLGGRTSHATIFKFVDGTARLIATRAHHFLGGKIDQCPASFLNTSDDFTAR 334

Query: 143 MVNHFVQEFKRKYKKDLATNKRALRRLRTACERAKR 250
           +V+H V+  K ++ +D+   ++A+ RLR ACE AK+
Sbjct: 335 IVDHMVEHIKEQHGRDVRQEEKAMVRLRVACEHAKK 370


>UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13;
           Rickettsiales|Rep: Heat shock protein Hsp70 - Ehrlichia
           canis (strain Jake)
          Length = 618

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 30/77 (38%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK-KDLA 196
           +++DLGGGTFDVSIL +  G+F+V +T GDT+LGG+D D  +      +++++    ++ 
Sbjct: 198 MVYDLGGGTFDVSILKLHQGVFQVLATGGDTNLGGDDIDYLLAKFIYNKYQKEENINNIE 257

Query: 197 TNKRALRRLRTACERAK 247
            NK  L  L    + AK
Sbjct: 258 FNKELLSYLIPDVKHAK 274



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/66 (25%), Positives = 39/66 (59%)
 Frame = +1

Query: 307 DFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQ 486
           +F   I+R   +++ +DL   T+  +  ++   ++D   I  ++LVGG+T++P ++ +L 
Sbjct: 293 NFSCKISRDELQDIISDLLNKTLSIITSTINSIELDFNSIAKVILVGGATKMPIIKNMLN 352

Query: 487 DFFNGK 504
           + F+ K
Sbjct: 353 NIFHNK 358



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +3

Query: 636 GIETAGGVMTTLIKRNTTIPTKQTQTF 716
           GIET GG++  +I RNT IP   TQ F
Sbjct: 400 GIETMGGIVEKIIPRNTPIPASATQEF 426


>UniRef50_A2G573 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 621

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 32/87 (36%), Positives = 53/87 (60%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K +LS+   + I I + ++  D    I R +FE L  D  ++ +E ++K+L+ AK+ K Q
Sbjct: 272 KINLSTMKSSEIIIPNFYKNGDLQKMIRRIKFESLIEDKIQACIESLDKALQKAKLSKDQ 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           I  ++ +GGS  IP VQ  L+D+F+GK
Sbjct: 332 ITAVIPIGGSCNIPAVQTALEDYFDGK 358



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           ++ VLIFD G GT DVSI+  E+    + +  G+ +LGG+D D  + +  V++ ++ +  
Sbjct: 192 KQTVLIFDFGAGTLDVSIVAFENDDCNIIAVEGNVNLGGKDLDKALYDFVVRDEQKTHPN 251

Query: 188 -DLATNKRALRRLRTACERAK 247
                  +    L  ACE+ K
Sbjct: 252 FRFDPKSKECANLLEACEKCK 272


>UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n=2;
           Eukaryota|Rep: NAD-specific glutamate dehydrogenase -
           Achlya klebsiana
          Length = 1063

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/75 (37%), Positives = 46/75 (61%)
 Frame = -1

Query: 235 TCSTQTPKSSLVGSEVLFVFPLELLDKVVDHAIVKVLTSQVGVAGGGFHLEDTILDGKDG 56
           T  T+T K +LV   +L V  LE   KVVD A++++ T+QVG+       EDT  +G+  
Sbjct: 775 TSGTKTAKGTLVLGHILAVLALEFSGKVVDEAVIEIFTTQVGITSSSLDFEDTFFNGQKR 834

Query: 55  HVEGTAAEVKDKYIS 11
           H+EGT  +++++ I+
Sbjct: 835 HIEGTTTKIENENIA 849



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 29/83 (34%), Positives = 49/83 (59%)
 Frame = -2

Query: 516 ICWLLSIKEILQELLHLGDTSGATHQYNIVDLSLIHLGITERLLHWLHGRPEQIGVQLLE 337
           + W L+++E+ ++LL L DT G T + + +DL+L  L +TE L +  H   E +   + E
Sbjct: 681 LAWFLAVEEVRKQLLDLWDTGGTTDKDDFMDLALGELRVTEDLFNRFHSLAEVVTAHVFE 740

Query: 336 ASTSN*RVEVNTLKERIYLNARL 268
             T +  VE+NT++ER+  N  L
Sbjct: 741 TGTGDGGVEINTIEERVDFNVSL 763



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
 Frame = -3

Query: 716 ECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCYIKQQQILHLL-RLVTVQDSSLDSCTIS 540
           E L L     SVTLDE  HDT+SS  T+ +   IK+QQ+L L  R+VT Q+ SLD  T S
Sbjct: 613 ESLRLLGWHSSVTLDEGSHDTTSSFQTKRERSDIKKQQVLELFRRVVTAQNGSLDCGTES 672

Query: 539 YGLVRVNR 516
              +RV+R
Sbjct: 673 NSFIRVDR 680


>UniRef50_UPI0000661593 Cluster: Homolog of Homo sapiens "Heat shock
           70kDa protein 8; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Heat shock 70kDa protein 8 - Takifugu
           rubripes
          Length = 200

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = -3

Query: 716 ECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCYIKQQQILHLLRLVTVQDSSLDSCTISY 537
           E L  FSGDG V L++  HD+S  L+T+ +  +I+Q+QIL+++R V+ Q+  LD  T+S+
Sbjct: 74  EDLCFFSGDGGVALNQGSHDSSCCLDTQRQRGHIQQKQILNIIRHVSCQNGGLDGSTVSH 133

Query: 536 GLVRVNRFVGSFPLKKSCRSFCTLG 462
            LV V+  V    L++  + F   G
Sbjct: 134 RLVWVDALVQFLALEEILQEFLNFG 158



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 24/56 (42%), Positives = 39/56 (69%)
 Frame = -2

Query: 504 LSIKEILQELLHLGDTSGATHQYNIVDLSLIHLGITERLLHWLHGRPEQIGVQLLE 337
           L+++EILQE L+ GD+ G T+Q +I+D +L+H GI +  LH +    E++  QLL+
Sbjct: 145 LALEEILQEFLNFGDSCGTTNQNDIMDFTLVHFGIFQGFLHGIQSSSEKVTTQLLK 200


>UniRef50_Q5BSZ7 Cluster: SJCHGC03031 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC03031 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 82

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/33 (90%), Positives = 31/33 (93%)
 Frame = +1

Query: 409 MDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           MDKA I+DIVLVGGSTRIPKVQKLL DFFNGKE
Sbjct: 1   MDKAHINDIVLVGGSTRIPKVQKLLMDFFNGKE 33


>UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=2; Bacteria|Rep: DnaK protein (Heat
           shock protein), HSP70/DnaK family - Clostridium
           acetobutylicum
          Length = 551

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 29/87 (33%), Positives = 53/87 (60%), Gaps = 2/87 (2%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKR--KYKKD 190
           VL++DLGGGTFDV+++ ++    +V  T GD +LGG+D+D+ ++ +  +++K      KD
Sbjct: 166 VLVYDLGGGTFDVTMIDVKKDSIKVICTGGDHNLGGKDWDDALIAYMAEQYKEITGNDKD 225

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           +  +    + L+   ER K+T  +  K
Sbjct: 226 ILEDPETCQELQLLAERVKKTLSQREK 252



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 30/86 (34%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDA-KMDKA 420
           K+ LS   +A I I+  +EG      ITR +F EL  DL + T+  ++  L++A K +  
Sbjct: 244 KKTLSQREKAPISIN--YEGERAKIEITRQKFNELTYDLLQRTVNLMDDMLKEAAKKNYT 301

Query: 421 QIHDIVLVGGSTRIPKVQKLLQDFFN 498
              +I+LVGGS+R+P+V++++++ +N
Sbjct: 302 SFDEILLVGGSSRMPQVEEIIKNKYN 327


>UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1;
           Neorickettsia sennetsu str. Miyayama|Rep: Putative
           chaperone protein HscA - Neorickettsia sennetsu (strain
           Miyayama)
          Length = 593

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 25/50 (50%), Positives = 38/50 (76%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEF 169
           +++DLGGGTFDVSIL    GIF+V  T GD +LGG++FD  ++ H ++++
Sbjct: 181 IVYDLGGGTFDVSILEFHKGIFKVSCTDGDDYLGGDNFDQALLEHLLKKY 230



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 26/88 (29%), Positives = 47/88 (53%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           KE+LS   + +  +D  + G +    IT   FE++       T+  V+++LR + +    
Sbjct: 250 KEELSHQNRVTNYLD--YRGQNLCFEITLDEFEKIIEKDVEKTINIVKRALRKSSLSVGD 307

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I  ++LVGGST +P ++  +  FF G+E
Sbjct: 308 IDGLLLVGGSTMVPMIRSRVSTFF-GEE 334


>UniRef50_Q4P3F6 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 573

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 32/88 (36%), Positives = 49/88 (55%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+S  A+  ++SL EG+DF  S+ R RF+ L    F   +  VEK+L +A ++  Q
Sbjct: 296 KRALSASNSATCSVESLAEGVDFTGSVNRMRFDMLAGAAFGKVVSGVEKALAEAGLEACQ 355

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           + ++VL GGS R+  +   L   F   E
Sbjct: 356 VDEVVLAGGSARLSGLADRLAGLFGDAE 383



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV++ D+GG + D+++ +   G++   +   D  +GG   D+ +V  F +EF +K K  
Sbjct: 217 RNVVVVDMGGSSTDITVFSARSGLYTNLAYLHDATVGGTTLDSALVAFFAKEFTKKTKIT 276

Query: 191 LA-TNKRALRRLRTACERAKR 250
           +A T+KRA  +LR   E  KR
Sbjct: 277 IAETDKRAWAKLRNEAEFTKR 297


>UniRef50_O15797 Cluster: CG4; n=10; Plasmodium|Rep: CG4 -
           Plasmodium falciparum
          Length = 855

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 32/85 (37%), Positives = 56/85 (65%), Gaps = 1/85 (1%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEP-VEKSLRDAKMDKA 420
           K+ LS++ +ASI ++ L+E +D   SI R  FEEL ++ F + ++  ++ +L  +K++  
Sbjct: 304 KKVLSANNEASIHVECLYEDLDCQGSINRETFEELCSNFFLTKLKHLLDTALCISKVNIQ 363

Query: 421 QIHDIVLVGGSTRIPKVQKLLQDFF 495
            IH I ++GGSTR+P +Q  LQ +F
Sbjct: 364 DIHSIEVLGGSTRVPFIQNFLQQYF 388


>UniRef50_A2F432 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 629

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK-- 184
           + +++FD G GT DVS++   +  F VK   G++ LGG+DFDN +  +  ++FK++YK  
Sbjct: 206 QTIIVFDFGAGTLDVSVVVFNNNDFVVKYIEGNSDLGGQDFDNILYEYIKEQFKKQYKDV 265

Query: 185 KDLATNKRALRRLRTACERAK 247
            D   N RA   L    E+ K
Sbjct: 266 TDADINYRAANLLMLNVEKCK 286



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 24/85 (28%), Positives = 48/85 (56%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS++ +  I +    +GID    I +++++ L  D      + + K+++ AK+D   I  
Sbjct: 289 LSATKRYDIVVQPFAKGIDLNMKIIQSKYQSLIEDKVYQAQDVLAKAIKGAKIDPNSITA 348

Query: 433 IVLVGGSTRIPKVQKLLQDFFNGKE 507
           ++ +GG+ R P V ++L  FFNG++
Sbjct: 349 VIPIGGTCRTPLVAEMLNSFFNGED 373


>UniRef50_A2EPF1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 657

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 24/50 (48%), Positives = 36/50 (72%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF 157
           ++NV+I+D GGGTFD S+ TIE    ++++T GD HLGG + D  ++ HF
Sbjct: 193 KQNVIIYDFGGGTFDASLATIEGSEIKIRNTEGDPHLGGRNIDQALIEHF 242


>UniRef50_Q06YR5 Cluster: Possibile polyglycylated protein 1; n=2;
           Tetrahymena thermophila|Rep: Possibile polyglycylated
           protein 1 - Tetrahymena thermophila
          Length = 879

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 32/90 (35%), Positives = 48/90 (53%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + KE LS++ + +   + L +G DF   I R  FEE    L     +P+E  L  A    
Sbjct: 315 KAKEILSANKEMTFFSEGLLDGNDFRAQINRTVFEEKAESLLSQVTKPIEAILAKANKTI 374

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           A I  I L+GG  R+PK+Q++L ++  GKE
Sbjct: 375 ADIDVIELIGGGIRVPKIQQILSEYLQGKE 404


>UniRef50_UPI0000D55C7E Cluster: PREDICTED: similar to CG2918-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG2918-PA - Tribolium castaneum
          Length = 872

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 33/81 (40%), Positives = 47/81 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS++ +   +I+ L +  DF   +TR   E+L  DLF     PVE +L+ A + K  
Sbjct: 306 KNILSANAEHYAQIEGLLDEEDFKVLVTRDELEQLAGDLFERVGRPVELALQSAHLTKDI 365

Query: 424 IHDIVLVGGSTRIPKVQKLLQ 486
           I  +VLVG  TR+PKVQ+ LQ
Sbjct: 366 IGQVVLVGAGTRVPKVQEKLQ 386


>UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3;
           Psychrobacter|Rep: 2-alkenal reductase - Psychrobacter
           sp. PRwf-1
          Length = 650

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 29/66 (43%), Positives = 45/66 (68%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R  LI+DLGGGTFDVS+L + +G+FEV +T G++ LGG+D D +++   +++      KD
Sbjct: 217 RLFLIYDLGGGTFDVSLLKMNEGVFEVLATGGNSALGGDDMDRQIMGWLLKQANLN-PKD 275

Query: 191 LATNKR 208
           L   +R
Sbjct: 276 LTAQQR 281



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 28/85 (32%), Positives = 50/85 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ L+   +  + ID     I++  ++T A   ++   + R T+   E+ +RDA +   Q
Sbjct: 292 KQALTHRDRVDVSID--IADIEWSGTLTAADLIQIVEPITRRTLATCEQVMRDAGVSIEQ 349

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFN 498
           + +I+LVGGSTR+P VQ+ ++ FFN
Sbjct: 350 LDEIILVGGSTRMPVVQQAVEQFFN 374



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +3

Query: 636 GIETAGGVMTTLIKRNTTIPTKQTQTF 716
           G+ET GG++  +I RNT IP  + QTF
Sbjct: 418 GLETMGGLVEVVIPRNTPIPVAKKQTF 444


>UniRef50_Q655N4 Cluster: Putative heat-shock protein; n=2; Oryza
           sativa|Rep: Putative heat-shock protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 753

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 31/78 (39%), Positives = 44/78 (56%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           V   D+G     V+++  +    +V S   D  LGG DFD  +  HF +EF+ KYK D+ 
Sbjct: 201 VAFVDVGHCDTQVAVVAFDVSGMKVLSHRFDADLGGRDFDEVLFEHFAEEFRDKYKIDVT 260

Query: 197 TNKRALRRLRTACERAKR 250
            N +A  RLR ACE+AK+
Sbjct: 261 GNVKASMRLRAACEKAKK 278



 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 29/91 (31%), Positives = 53/91 (58%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K+ LS++ +A + I+ L E  D    I R  FE+L A L    +EP +K++  +++  
Sbjct: 275 KAKKVLSANAEAVVNIECLMEEKDVRGMIRREEFEKLCAGLLERVVEPCKKAMEGSRIGF 334

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            ++H + LVG  +R+P + ++L  FF  +EP
Sbjct: 335 DRLHSVELVGSGSRVPAIARILAGFFR-REP 364


>UniRef50_A2ECF5 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 730

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 32/86 (37%), Positives = 49/86 (56%), Gaps = 4/86 (4%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           +   VLIFD GGGT D+SI+ I     +V  T G+ H GG+D D  +V+ F  +F++K +
Sbjct: 192 SEEKVLIFDFGGGTLDISIVEISRNKCKVLKTKGNPHFGGQDIDKILVDKFKADFEKKNR 251

Query: 185 KDL----ATNKRALRRLRTACERAKR 250
             +       +RAL  L+  CE+ K+
Sbjct: 252 VTIDPYTLQGQRALLSLKMECEQLKK 277



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/84 (28%), Positives = 49/84 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K++LS   +  I+   LF G D   +++R +FE    ++   ++  V +++++  + +  
Sbjct: 276 KKNLSQKLRCEIKHPKLFNGYDLEGTLSRKQFEICIGNILTESLNMVIETIKEVNLTRDN 335

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           I  I+LVGGS++IP V   L+++F
Sbjct: 336 ISQIILVGGSSQIPAVADNLKNYF 359


>UniRef50_Q8SWH2 Cluster: Similarity to HSP70-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: Similarity to
           HSP70-RELATED PROTEIN - Encephalitozoon cuniculi
          Length = 687

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 31/79 (39%), Positives = 42/79 (53%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           N+ +FDLGGGTFDVSI+    G   V S  G+  LGGE+ ++ +  +F    K     D+
Sbjct: 249 NICVFDLGGGTFDVSIVESSGGFMMVPSYGGNNFLGGENVNDNLTKYFADYIKSSTGFDV 308

Query: 194 ATNKRALRRLRTACERAKR 250
             N+    RLR   E  KR
Sbjct: 309 MENQNVKLRLRNVVEDMKR 327



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 5/67 (7%)
 Frame = +1

Query: 322 ITRARFEELNADLF---RSTMEPV-EKSLRDAK-MDKAQIHDIVLVGGSTRIPKVQKLLQ 486
           +T  +F ELNAD +   R TM+ +     +D K  DK+ I+ ++LVGGSTRIPKV  +++
Sbjct: 361 LTNEKFNELNADFYSRIRKTMDSLLSGDGKDNKGYDKSLINRVLLVGGSTRIPKVIDIVE 420

Query: 487 DFFNGKE 507
           + F   +
Sbjct: 421 EIFGANK 427


>UniRef50_A5DUP7 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 907

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 28/81 (34%), Positives = 48/81 (59%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS++ + S  ++S++   DF   ITR  FEELN+DL +   +PV  +L++  +    +  
Sbjct: 250 LSANNEFSTVVESIYGDEDFKVYITREEFEELNSDLMQQVTQPVLDALKEGGLKVEDVKS 309

Query: 433 IVLVGGSTRIPKVQKLLQDFF 495
           ++  GGSTR+P +QK +   F
Sbjct: 310 VIFNGGSTRVPFIQKQITSLF 330


>UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29;
           Proteobacteria|Rep: Chaperone protein hscA - Salmonella
           typhimurium
          Length = 616

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 24/50 (48%), Positives = 39/50 (78%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQE 166
           + ++DLGGGTFD+SIL +  G+FEV +T GD+ LGG+DFD+ + ++  ++
Sbjct: 203 IAVYDLGGGTFDISILRLSRGVFEVLATGGDSALGGDDFDHLLADYIREQ 252



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 23/63 (36%), Positives = 43/63 (68%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           ITR +F +L + L + T+    ++L+DA ++   + ++V+VGGSTR+P V++ + +FF G
Sbjct: 295 ITREQFNDLISALVKRTLLACRRALKDAGVEPQDVLEVVMVGGSTRVPLVRERVGEFF-G 353

Query: 502 KEP 510
           + P
Sbjct: 354 RTP 356



 Score = 36.3 bits (80), Expect = 0.76
 Identities = 21/67 (31%), Positives = 32/67 (47%)
 Frame = +3

Query: 516 SINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIP 695
           +I+PD+           IL G+K +   +           G+ET GG++  +I RNTTIP
Sbjct: 359 AIDPDKVVAIGAAIQADILVGNKPDS--EMLLLDVIPLSLGLETMGGLVEKVIPRNTTIP 416

Query: 696 TKQTQTF 716
             + Q F
Sbjct: 417 VARAQDF 423


>UniRef50_Q6F9S6 Cluster: Chaperone protein; n=2; Acinetobacter|Rep:
           Chaperone protein - Acinetobacter sp. (strain ADP1)
          Length = 566

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 26/38 (68%), Positives = 34/38 (89%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDF 133
           LIFDLGGGTFDVSI+ + DG+ EV+++AGD +LGG+DF
Sbjct: 168 LIFDLGGGTFDVSIVELFDGVIEVRASAGDNYLGGDDF 205



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/44 (47%), Positives = 33/44 (75%)
 Frame = +1

Query: 379 PVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           P+E++LRDA++   Q+  I++VGG+TRIP V+KL+   F G+ P
Sbjct: 287 PLERALRDARILPKQVDQIIMVGGATRIPAVRKLVTKLF-GRFP 329


>UniRef50_A6EQS3 Cluster: Heat shock protein Hsp70; n=1;
           unidentified eubacterium SCB49|Rep: Heat shock protein
           Hsp70 - unidentified eubacterium SCB49
          Length = 730

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 28/61 (45%), Positives = 36/61 (59%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  + VLI+D GGGTFD+SIL I DG +    T GD  LGG+D D  +  H ++     Y
Sbjct: 190 GDAKTVLIYDFGGGTFDLSILNIVDGQYMEAGTGGDRWLGGDDLDKALQAHILKRISNDY 249

Query: 182 K 184
           K
Sbjct: 250 K 250



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 30/92 (32%), Positives = 50/92 (54%), Gaps = 4/92 (4%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLF----EGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKM 411
           K  LSSS  A + +D       E ID   S TR  FE+L       ++E +E  L++   
Sbjct: 281 KMQLSSSKTAQLIMDGFEDENGEWIDLDLSFTREEFEKLAKPFIDKSIELIESLLKEVGY 340

Query: 412 DKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           D + I +I+LVGG++ IP V+++L + +  ++
Sbjct: 341 DISMIDNILLVGGTSCIPLVKQMLSEKYGNEK 372


>UniRef50_O46067 Cluster: CG2918-PA; n=3; Diptera|Rep: CG2918-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 923

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 28/81 (34%), Positives = 52/81 (64%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS++T+   +I++L E IDF   +TR + E+L  DL+    +P+E++L  + +    
Sbjct: 303 KNVLSANTEFFAQIENLIEDIDFKLPVTREKLEQLCEDLWPRATKPLEEALASSHLSLDV 362

Query: 424 IHDIVLVGGSTRIPKVQKLLQ 486
           I+ ++L GG TR+P+VQ+ ++
Sbjct: 363 INQVILFGGGTRVPRVQETIK 383


>UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14;
           Rickettsia|Rep: Chaperone protein hscA homolog -
           Rickettsia felis (Rickettsia azadi)
          Length = 637

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 27/50 (54%), Positives = 37/50 (74%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEF 169
           L++DLGGGTFDVSIL I++GIF+V +T GD  LGG+D D  +  +   +F
Sbjct: 196 LVYDLGGGTFDVSILNIQEGIFQVIATNGDNMLGGDDIDVVITQYLCNKF 245


>UniRef50_Q7M080 Cluster: DnaK-type molecular chaperone; n=1;
           Cricetulus griseus|Rep: DnaK-type molecular chaperone -
           Cricetulus griseus (Chinese hamster)
          Length = 137

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/39 (71%), Positives = 34/39 (87%)
 Frame = +1

Query: 277 IEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKS 393
           IEI+S FEG DF  ++TRA+FEELN DLFRSTM+PV+KS
Sbjct: 83  IEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKS 121


>UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma
           marginale str. St. Maries|Rep: Heat shock protein -
           Anaplasma marginale (strain St. Maries)
          Length = 602

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/76 (35%), Positives = 47/76 (61%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLAT 199
           +++D GGGTFDVS+L + +G+F+V +T GDT+LGG+D D  +    V +++ +  + +  
Sbjct: 196 VVYDFGGGTFDVSVLRLHNGVFQVLATGGDTNLGGDDIDQLLAELVVAKYESRKCERVCG 255

Query: 200 NKRALRRLRTACERAK 247
           +  A   +  AC   K
Sbjct: 256 DPYADGLVLDACNAKK 271



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 22/65 (33%), Positives = 39/65 (60%)
 Frame = +1

Query: 310 FYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQD 489
           F   IT A F E+   +   T++ +E+++ DA ++   +  ++LVGGS++IP+V+  L  
Sbjct: 290 FRCHITDAEFTEVVDKVVSKTVKILEQTISDAGIEPCDVSRVILVGGSSKIPRVKAALDS 349

Query: 490 FFNGK 504
            F GK
Sbjct: 350 IFCGK 354


>UniRef50_A5N5I5 Cluster: DnaK1; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK1 - Clostridium kluyveri DSM 555
          Length = 521

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 5/82 (6%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           ++++DLGGGTFDVSI+ I    FE  +  GD  LGG+DFD ++ +   +  K   K D+ 
Sbjct: 163 IMVYDLGGGTFDVSIMKIRGNKFEAIAIDGDFRLGGDDFDEKICSVLYKRIKEDTKIDIE 222

Query: 197 TNKR-----ALRRLRTACERAK 247
             K      A ++++ A E AK
Sbjct: 223 VGKEREHMAARQKIKEAAENAK 244



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/81 (30%), Positives = 43/81 (53%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K +LSS    S+ I ++         +TR  +  L   L   T+E V+  L+DA M    
Sbjct: 244 KIELSSKENTSVIIPNILRDYHLDFELTRDEYYNLIKPLIDKTIEKVKSVLKDANMTPED 303

Query: 424 IHDIVLVGGSTRIPKVQKLLQ 486
           I  ++LVGG+T+ P ++++L+
Sbjct: 304 IDRLILVGGATKTPIIKEILK 324


>UniRef50_A5MZQ7 Cluster: DnaK9; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK9 - Clostridium kluyveri DSM 555
          Length = 540

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/82 (34%), Positives = 50/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           ++++DLGGGTFD+SI+ ++   FEV +  G++ LGG+DFD  + +    +   +  +D+ 
Sbjct: 163 IMVYDLGGGTFDISIMKVDKNEFEVLAVDGNSRLGGDDFDELICSRIYDKINDELGEDIT 222

Query: 197 TNK-----RALRRLRTACERAK 247
           + K      AL ++R   E+AK
Sbjct: 223 SKKDKKYISALMKIRENAEKAK 244



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 26/84 (30%), Positives = 47/84 (55%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K DLS   +  I I +L +   F  ++TR  F +L   L   T++ +   L+ A + +
Sbjct: 242 KAKMDLSDLEEVEIIIPNLIDDYSFEMTLTRDEFNQLVEPLMEETIDKIYNVLKLANLTR 301

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQD 489
             I  ++LVGGST++P V++ ++D
Sbjct: 302 DDIDRVLLVGGSTKMPIVKEKVRD 325


>UniRef50_A2DR00 Cluster: DnaK protein; n=7; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 615

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/79 (39%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK--- 184
           ++L+FD G GT DVSI+ I+  +F VK+ AG+++LGG D D  + ++ +++FK+K     
Sbjct: 198 HLLVFDFGAGTLDVSIVYIDGQVFNVKAVAGNSNLGGADIDKIIADYCIEQFKKKQSDFN 257

Query: 185 -KDLATNKRALRRLRTACE 238
            KD    K     L+TA E
Sbjct: 258 PKDPNNKKNMALLLKTAEE 276


>UniRef50_A2DQ03 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 372

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/101 (28%), Positives = 54/101 (53%)
 Frame = +1

Query: 202 QESS*AFAYCM*EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEP 381
           QE+      C+ E K  L  S    + +  +  GID+  S+ R +F+ +  D   + ME 
Sbjct: 250 QEAMDKLFKCIDEAKIKLLDSETVEMSVPQILPGIDYKDSMDREKFDYMIEDTLGTVMEI 309

Query: 382 VEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           V+K+L DAK+ K  + D+++ GG+ R+P++  +++     K
Sbjct: 310 VDKALEDAKIAKKDVTDVIVCGGTARLPRIADVVEQHIGVK 350



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 21/79 (26%), Positives = 39/79 (49%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RN+++FD+      VS+         ++S +GD  +GG+ F         +EF+  YK+ 
Sbjct: 187 RNIVVFDISQTNTVVSVCKGRKNSPRLQSWSGDD-VGGDSFTGDATQFISREFRVTYKQP 245

Query: 191 LATNKRALRRLRTACERAK 247
           +  N+ A+ +L    + AK
Sbjct: 246 IKNNQEAMDKLFKCIDEAK 264


>UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188;
           Bacteria|Rep: Chaperone protein hscA - Yersinia pestis
          Length = 650

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 24/45 (53%), Positives = 36/45 (80%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVN 151
           + ++DLGGGTFD+SIL +  G+FEV +T GD+ LGG+DFD+ + +
Sbjct: 237 IAVYDLGGGTFDISILRLSRGVFEVLATGGDSALGGDDFDHLLAD 281



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/63 (36%), Positives = 40/63 (63%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           +TR + E L A   + T+    ++L+DA +   +I ++V+VGGSTR+P V++ +  FF G
Sbjct: 329 VTREQLESLIAPQVKRTLMACRRALKDAGVTADEILEVVMVGGSTRVPLVREQVGQFF-G 387

Query: 502 KEP 510
           + P
Sbjct: 388 RTP 390



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 23/67 (34%), Positives = 32/67 (47%)
 Frame = +3

Query: 516 SINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIP 695
           SI+PD+           IL G+K +   D           G+ET GG++  +I RNTTIP
Sbjct: 393 SIDPDKVVAIGAAIQADILVGNKPDS--DMLLLDVIPLSLGLETMGGLVEKVIPRNTTIP 450

Query: 696 TKQTQTF 716
             + Q F
Sbjct: 451 AARAQEF 457


>UniRef50_UPI0000DB7485 Cluster: PREDICTED: similar to CG2918-PA;
           n=2; Apocrita|Rep: PREDICTED: similar to CG2918-PA -
           Apis mellifera
          Length = 932

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 28/83 (33%), Positives = 49/83 (59%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS++T    +I+ L + +DF   +TR + E+L  DLF     P++ +L+ + +    
Sbjct: 306 KNVLSANTDHFAQIEGLIDEVDFRLQVTREKLEQLCTDLFERVTNPIKIALKTSGLTMDA 365

Query: 424 IHDIVLVGGSTRIPKVQKLLQDF 492
           I  +VLVG +TR+PK+Q+ L  +
Sbjct: 366 ISQVVLVGAATRMPKIQEHLSQY 388


>UniRef50_Q22E65 Cluster: DnaK protein; n=1; Tetrahymena thermophila
           SB210|Rep: DnaK protein - Tetrahymena thermophila SB210
          Length = 969

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 4/94 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEID----SLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LS +  A+I ++    +  E   F  SITR +FEE+  +   +T+   EK L+D+
Sbjct: 712 KAKCELSQNDIANINLEYFLPNSIERRCFSCSITRLQFEEICQEFLENTIRLCEKCLKDS 771

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
              K  I  ++L GGSTRIP VQKL+ ++F GK+
Sbjct: 772 GFSKDNIDKVILTGGSTRIPLVQKLVSEYF-GKQ 804



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 26/79 (32%), Positives = 46/79 (58%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R + I+ LGG TF++SI+  EDG +++K T  D   GGE+ +N +  +  ++   +   D
Sbjct: 636 RLIAIYHLGGYTFNISIIHFEDGFYDIKETQSDIFSGGEEINNLLSEYIAKQILSQTGID 695

Query: 191 LATNKRALRRLRTACERAK 247
           +   + A++ LR   E+AK
Sbjct: 696 ITRCESAIQNLRDVTEKAK 714


>UniRef50_Q55Y28 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 896

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/88 (34%), Positives = 54/88 (61%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++ +A++ I+SLF+ +DF ++I+RA  E++   + +    PV  +L  A +    
Sbjct: 321 KQILSANQEANVAIESLFDDVDFRSTISRADLEKIVGAVDQLYGSPVISALEAAGLQLGD 380

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I+ ++L GG+TR+P VQ  L+    G E
Sbjct: 381 INSVILFGGNTRVPLVQASLKSVLGGAE 408


>UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep:
           Heat shock protein 70 - Frankia sp. (strain CcI3)
          Length = 556

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 24/51 (47%), Positives = 36/51 (70%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEF 169
           VL++DLGGGTFD +++ + +G   V +T GD  LGG D+DN +V +  Q+F
Sbjct: 175 VLVYDLGGGTFDTTVIRLSEGAITVVATDGDHELGGADWDNELVRYLAQKF 225



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           L+ S + S+++  +  G      +TR  FEE+   L R T++     L  A+    +  D
Sbjct: 254 LALSGRDSVDVLVVHNGRRTSVPVTRTVFEEITGPLLRRTIDLTGSVLARAREKGVEKID 313

Query: 433 I-VLVGGSTRIPKVQKLLQDFF 495
           + +LVGG ++ P V + LQ+ F
Sbjct: 314 LCLLVGGMSKTPAVARRLQESF 335


>UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2;
           Gammaproteobacteria|Rep: Molecular chaperone HscA -
           Vesicomyosocius okutanii subsp. Calyptogena okutanii
           (strain HA)
          Length = 614

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 24/48 (50%), Positives = 35/48 (72%)
 Frame = +2

Query: 23  IFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQE 166
           I+DLGGGTFD+SIL    G+F+V +  GD  LGG+DFD  ++N  +++
Sbjct: 204 IYDLGGGTFDISILNFSKGVFKVLAIGGDATLGGDDFDELIINDCIEQ 251



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/82 (36%), Positives = 50/82 (60%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           ++  T ++ E  S F+ I     IT+ +FE L   L + T+   ++++RDA++D   I +
Sbjct: 271 IAKETLSNYEF-SEFDCIKRPYCITKKKFETLAKVLIKRTLLLTKQAIRDAQVDVKNIKN 329

Query: 433 IVLVGGSTRIPKVQKLLQDFFN 498
           I++VGGSTRIP V  ++ D FN
Sbjct: 330 IIMVGGSTRIPLVCSMVSDLFN 351



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 26/67 (38%), Positives = 32/67 (47%)
 Frame = +3

Query: 516 SINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIP 695
           SINPDE           IL G KS+   D           G+ET GG++  +I RNTTIP
Sbjct: 357 SINPDEVVAKGAAIQANILAGIKSQN--DILLLDVLPLSLGLETMGGLVEKIIHRNTTIP 414

Query: 696 TKQTQTF 716
             + Q F
Sbjct: 415 IIRAQEF 421


>UniRef50_Q010Y3 Cluster: DNAK_GLOVI Chaperone protein dnaK; n=1;
           Ostreococcus tauri|Rep: DNAK_GLOVI Chaperone protein
           dnaK - Ostreococcus tauri
          Length = 412

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/54 (50%), Positives = 36/54 (66%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRK 178
           V +FDLGGGTFDVS+L +  G  EV +T GD  LGG+DFD  +     +E K++
Sbjct: 234 VFVFDLGGGTFDVSVLEVGGGTVEVLATGGDPQLGGDDFDRVIAMWLSEEAKKR 287


>UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27;
           Proteobacteria|Rep: Chaperone protein hscA homolog -
           Burkholderia mallei (Pseudomonas mallei)
          Length = 622

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 24/48 (50%), Positives = 36/48 (75%)
 Frame = +2

Query: 23  IFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQE 166
           ++DLGGGTFD+SIL +  G+FEV +  GD+ LGG+DFD+ +  H + +
Sbjct: 204 VYDLGGGTFDLSILKLTKGVFEVLAAGGDSALGGDDFDHLLFEHVLAQ 251



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 34/89 (38%), Positives = 53/89 (59%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           KE LS++ QA +++  L  G     +ITR  F  L   L + T+ P  K+LRDA++  A 
Sbjct: 275 KEALSAAPQARVDV-KLSTGEKLAQTITRDTFAALVEPLVQRTLGPTRKALRDAQVSAAD 333

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I  +VLVGG+TR+P ++  +  +F G+ P
Sbjct: 334 IKGVVLVGGATRMPVIRDAVAKYF-GQPP 361



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 19/67 (28%), Positives = 32/67 (47%)
 Frame = +3

Query: 516 SINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIP 695
           +++PD+           +L G++S    D           G+ET GG++  +I RN+TIP
Sbjct: 364 NLDPDQVVALGAAIQADLLAGNRSGG-DDWLLLDVIPLSLGVETMGGLVEKIIPRNSTIP 422

Query: 696 TKQTQTF 716
             + Q F
Sbjct: 423 VARAQEF 429


>UniRef50_Q64YI6 Cluster: Chaperone protein DnaK; n=2; Bacteroides
           fragilis|Rep: Chaperone protein DnaK - Bacteroides
           fragilis
          Length = 529

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 23/57 (40%), Positives = 38/57 (66%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRK 178
           ++ VL++DLGGGTFDV+++ +  G  +V +T GD HLGG D+D  +  + +  F  +
Sbjct: 172 KKTVLVYDLGGGTFDVTLINVNGGAIKVIATGGDHHLGGVDWDTALAEYMLAAFNEQ 228



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 2/70 (2%)
 Frame = +1

Query: 295 FEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKA--QIHDIVLVGGSTRIPK 468
           +EG      I+R  F  L       T++  +K +  AK +K    I +I+LVGGS+R+P+
Sbjct: 268 YEGNSARIEISRELFNSLTERKLDETIDATKKVIAIAK-EKGYNNIDEILLVGGSSRMPQ 326

Query: 469 VQKLLQDFFN 498
           +++ +   FN
Sbjct: 327 IKERVDKEFN 336


>UniRef50_A2EMY0 Cluster: DnaK protein; n=4; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 626

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK- 187
           R VL++D GGGTFD+S++ I     EV    GD HLGG D DN +    ++  K++Y K 
Sbjct: 193 RTVLVYDFGGGTFDLSLVKISPDQIEVIDQDGDAHLGGRDIDNGIFQKAIEYIKKQYPKI 252

Query: 188 DLATNKRAL 214
           D+ + K  L
Sbjct: 253 DIESIKGGL 261


>UniRef50_Q22758 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 925

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 32/88 (36%), Positives = 51/88 (57%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++ +   +I+S  E ID    +TR  F  L +D+     EP+E++LR A++    
Sbjct: 306 KQVLSANAEHFAQIESAHEDIDAKLKVTREDFNHLISDMESRFGEPIEQALRMAQIPIDD 365

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I   VL+G  TR+PKVQ+++Q     KE
Sbjct: 366 IDQFVLMGAGTRVPKVQEIVQKTIGTKE 393



 Score = 36.7 bits (81), Expect = 0.57
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +2

Query: 107 DTHLGGEDFDNRMVNHFVQEFKRKY--KKDLATNKRALRRLRTACERAKR 250
           D  LGG +  NR+ +H ++ F++ Y  K  + TN+RA+ +     ER K+
Sbjct: 258 DRTLGGIEMTNRLRDHLIEMFEKNYKPKTKVNTNRRAMTKFSKEAERLKQ 307


>UniRef50_P87142 Cluster: Heat shock protein 70 homolog C57A7.12;
           n=1; Schizosaccharomyces pombe|Rep: Heat shock protein
           70 homolog C57A7.12 - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 566

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 28/84 (33%), Positives = 49/84 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+ T AS  +DSL +GIDF++SI R R++   +       + V +++  A M+   
Sbjct: 295 KRVLSNGTTASAAVDSLADGIDFHSSINRLRYDLAASATLNRMADLVTEAVEKANMEPFD 354

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           I +++L GG++  PK+  L++  F
Sbjct: 355 ISEVILAGGASNTPKLTSLMESIF 378



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 26/80 (32%), Positives = 48/80 (60%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + V++ + G    +VS+++++ G+  + ++  D +LGGE   + +VN F +EF++K   D
Sbjct: 217 KTVVVANFGATRSEVSVVSVKGGLMTILASVHDENLGGEQLTDVLVNFFAKEFEKKNGID 276

Query: 191 LATNKRALRRLRTACERAKR 250
              N R+L +LR  CE  KR
Sbjct: 277 PRKNARSLAKLRAQCEITKR 296


>UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas sp.
           MWYL1|Rep: 2-alkenal reductase - Marinomonas sp. MWYL1
          Length = 552

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 29/82 (35%), Positives = 48/82 (58%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           + +  L+ DLGGGTFDVS++ + + IFE+ +++GD +LGG DF N +     Q  K   +
Sbjct: 160 SEQTYLVLDLGGGTFDVSVIEVFNEIFEIHASSGDNYLGGNDFTNIIQKDVYQ--KHNVQ 217

Query: 185 KDLATNKRALRRLRTACERAKR 250
           +   T     R + + C++ KR
Sbjct: 218 RGFLTGSEE-RNIWSLCDQLKR 238



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 26/85 (30%), Positives = 45/85 (52%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K DL+   +AS E     E I  YT +T   F  ++++L      P+ +++ DA +   +
Sbjct: 237 KRDLTEQPEASFEFQYKDE-IYRYT-LTNEDFRIISSELIERIKFPINRAMSDADLKVDE 294

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFN 498
           I  ++ VGG+TR+P  QK +   F+
Sbjct: 295 IDGLIFVGGATRMPIFQKQISHAFS 319


>UniRef50_Q9VUC1 Cluster: CG6603-PA, isoform A; n=7;
           Endopterygota|Rep: CG6603-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 804

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 27/85 (31%), Positives = 53/85 (62%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+  ++ST+  + I+   + ID  +S+ R++ EEL A + +   +  ++ L ++K+    
Sbjct: 272 KQMSANSTKLPLNIECFLDDIDVSSSMQRSQMEELCAPVLQRVEQTFKRLLAESKLQLDD 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFN 498
           IH + +VGGS+RIP V++L++  FN
Sbjct: 332 IHSVEIVGGSSRIPSVKQLIEQVFN 356



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 26/80 (32%), Positives = 42/80 (52%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D G  +   S      G  ++ ++  D  +GG D D  + ++F +EF+ +YK +
Sbjct: 194 RNVIFVDFGHSSLQASACAFTKGKLKMLASTWD-QIGGRDIDLALGDYFAKEFQERYKIN 252

Query: 191 LATNKRALRRLRTACERAKR 250
             TN RA  RL T  E+ K+
Sbjct: 253 AKTNARANLRLLTEIEKLKK 272


>UniRef50_Q6BJA2 Cluster: Debaryomyces hansenii chromosome G of
           strain CBS767 of Debaryomyces hansenii; n=2;
           Saccharomycetaceae|Rep: Debaryomyces hansenii chromosome
           G of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 922

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 29/79 (36%), Positives = 51/79 (64%), Gaps = 2/79 (2%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKA--QI 426
           LS ++   + +++L+E  DF T++T+  FEE+N+DL     +P++ +L+ +  +K+   I
Sbjct: 315 LSINSDYHVSLENLYEDKDFKTTVTKDEFEEINSDLMDHITKPIKDALKSSAPEKSIEDI 374

Query: 427 HDIVLVGGSTRIPKVQKLL 483
             ++L GGS RIP VQK L
Sbjct: 375 KSVILNGGSMRIPFVQKHL 393


>UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=1;
           Yersinia mollaretii ATCC 43969|Rep: COG0443: Molecular
           chaperone - Yersinia mollaretii ATCC 43969
          Length = 571

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 24/53 (45%), Positives = 38/53 (71%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQ 163
           T++  L FDLGGGTFDVS++ + +G+ EV+++ GD  LGG+DF  ++    +Q
Sbjct: 169 TQQKYLTFDLGGGTFDVSVIDMFEGVIEVRASCGDIFLGGDDFTRQIYQWMLQ 221



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/84 (27%), Positives = 46/84 (54%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K DL+ S  A  ++  +++G  +   +      E+  +L     +PV ++LRDA+    +
Sbjct: 245 KCDLTFSAHARAQL--VWQGQTYEWQLNETLLAEICEELLNRLKKPVLQALRDARFSSDE 302

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           +  ++LVGG+TR+P V++ +   F
Sbjct: 303 LDHVLLVGGATRMPLVRQAVTRMF 326


>UniRef50_UPI0000510557 Cluster: COG0443: Molecular chaperone; n=1;
           Brevibacterium linens BL2|Rep: COG0443: Molecular
           chaperone - Brevibacterium linens BL2
          Length = 340

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 32/85 (37%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = +2

Query: 2   GTR-RNVLIFDLGGGTFDVSILTIE-DGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKR 175
           G+R  NVL+FDLGGGTFDV+I+ +E DG   V +T G+  LGG DFD+ ++    +  + 
Sbjct: 166 GSRSENVLVFDLGGGTFDVTIMRVESDGEMTVLATGGNHKLGGTDFDSAIIGIMAERAQT 225

Query: 176 KYKKDLATNKRALRRLRTACERAKR 250
           +   D+          R   E  K+
Sbjct: 226 ELGVDILAEDWMFSDARDKAEEIKK 250



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 29/91 (31%), Positives = 51/91 (56%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           E K++LS++   S  + +      F  ++TRA FE   AD      + +E +L D+ +  
Sbjct: 247 EIKKELSTTDSVSRPLQTGQRPYMF--TMTRAEFENAVADTVEDVSDTIETTLDDSGLSA 304

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + +  +++VGGS+RIP    +L++ F GKEP
Sbjct: 305 SDLGTVLMVGGSSRIPVFASMLKELF-GKEP 334


>UniRef50_UPI0000499681 Cluster: heat shock protein 70; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 527

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 29/86 (33%), Positives = 52/86 (60%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K +LSS++   I++  L +  +F  SI R+ FEE N   F   ME +++ ++   +  
Sbjct: 287 KAKIELSSNSYCEIDLSELVDEDEFIISIDRSEFEECNKKEFDRCMECIDEIMQKKGIKT 346

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFF 495
            QI +++LVGG ++IPK+++LL   F
Sbjct: 347 TQIDEVMLVGGCSQIPKIKELLNKKF 372



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFK 172
           L+FDLGGGT DV+IL  +   F+ ++  GD HLGG DFD  ++   + + K
Sbjct: 200 LVFDLGGGTLDVTILEKKGEEFKFRAIGGDVHLGGLDFDMNLMEFVISKMK 250


>UniRef50_Q6L4S6 Cluster: Putative uncharacterized protein
           P0663C08.2; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0663C08.2 - Oryza sativa subsp. japonica (Rice)
          Length = 437

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 32/84 (38%), Positives = 46/84 (54%), Gaps = 1/84 (1%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  + +L+F LGG T   +   I DG   + +   D  LGG+DF  R+V+H     K K+
Sbjct: 230 GDGKVILVFHLGGRTAHATKFVIRDGTPSLIALRHDPFLGGDDFTARVVDHMADLIKDKH 289

Query: 182 -KKDLATNKRALRRLRTACERAKR 250
             +D+  +  ALRRL   CERAK+
Sbjct: 290 GGRDVRADAAALRRLTAECERAKK 313



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 29/66 (43%), Positives = 43/66 (65%)
 Frame = +1

Query: 310 FYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQD 489
           F   +TR++ EEL  DL    ++ VE S   +  D   + +I+LVGGSTRIP V+ L++D
Sbjct: 334 FSEPLTRSKLEELIGDLVGRAVDLVE-SCDASGGDVVGVDEILLVGGSTRIPMVRDLVKD 392

Query: 490 FFNGKE 507
           +F+GKE
Sbjct: 393 YFHGKE 398


>UniRef50_A7PZE7 Cluster: Chromosome chr15 scaffold_40, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr15 scaffold_40, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 92

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 25/40 (62%), Positives = 33/40 (82%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLG 121
           G  +N+L+F LGGG  DVS+LTI++G+FEV +T GDTHLG
Sbjct: 15  GGEKNILVFYLGGGICDVSVLTIDNGVFEVLATNGDTHLG 54


>UniRef50_A2F7Z8 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 707

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 25/78 (32%), Positives = 45/78 (57%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           +   D+G  + +V+I  +++    + S A D H GG +F  +++N+ ++E K+KYK D  
Sbjct: 198 IAFIDIGDSSMNVAIAYLKEDNVRISSFAYDEHFGGSNFTEKLLNYLIEETKKKYKIDPR 257

Query: 197 TNKRALRRLRTACERAKR 250
            NKR L R   + E+ K+
Sbjct: 258 ENKRMLHRFTESVEKLKK 275



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 26/89 (29%), Positives = 43/89 (48%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K++LS +T    E+  +    D    + R  FE    DL      P++K+L  + + K  
Sbjct: 274 KKNLSVNTSIQFEVIGIKGDTDVRFIVKREEFEAQIQDLLPRLENPIQKALESSNLKKED 333

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +    L+GG +R+P V+  +Q   N KEP
Sbjct: 334 LKGCELLGGCSRVPIVKAEIQKILN-KEP 361


>UniRef50_P36016 Cluster: Heat shock protein 70 homolog LHS1
           precursor; n=2; Saccharomyces cerevisiae|Rep: Heat shock
           protein 70 homolog LHS1 precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 881

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 4/81 (4%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEP----VEKSLRDAKMDKA 420
           LS++++ASI I+SL   IDF TSITR  FEE  AD     ++P    V K       +  
Sbjct: 323 LSANSEASINIESLINDIDFRTSITRQEFEEFIADSLLDIVKPINDAVTKQFGGYGTNLP 382

Query: 421 QIHDIVLVGGSTRIPKVQKLL 483
           +I+ ++L GGS+RIP VQ  L
Sbjct: 383 EINGVILAGGSSRIPIVQDQL 403



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 11/93 (11%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTI---EDG----IFEVKSTAGDTHLGGE----DFDNRMV 148
           G +++ +++D+G G+   S+ +I   ED       E +    + HLGG     D  + + 
Sbjct: 228 GEQQHYIVYDMGSGSIKASMFSILQPEDTTQPVTIEFEGYGYNPHLGGAKFTMDIGSLIE 287

Query: 149 NHFVQEFKRKYKKDLATNKRALRRLRTACERAK 247
           N F++        +L  N +AL ++  A E+AK
Sbjct: 288 NKFLETHPAIRTDELHANPKALAKINQAAEKAK 320


>UniRef50_P37092 Cluster: Heat shock protein 70 homolog; n=5;
           Closterovirus|Rep: Heat shock protein 70 homolog - Beet
           yellows virus (BYV) (Sugar beet yellows virus)
          Length = 598

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 2/75 (2%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQ--EFKR 175
           G    VL++D GGGTFDVS+++  +  F V+++ GD +LGG D D   V H     +   
Sbjct: 195 GATSPVLVYDFGGGTFDVSVISALNNTFVVRASGGDMNLGGRDIDKAFVEHLYNKAQLPV 254

Query: 176 KYKKDLATNKRALRR 220
            YK D++  K +L +
Sbjct: 255 NYKIDISFLKESLSK 269


>UniRef50_Q9VSI1 Cluster: CG7182-PA; n=2; Sophophora|Rep: CG7182-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 513

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 27/80 (33%), Positives = 46/80 (57%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           RR+VL    GG   D++  ++++G+F   +T G   +GG  F   +V    +EF+RKYK 
Sbjct: 206 RRHVLTIKCGGLYSDIAFYSVQNGLFVQLATFGPFPIGGRQFTEALVQFICEEFRRKYKL 265

Query: 188 DLATNKRALRRLRTACERAK 247
           D   ++R++ ++RTA    K
Sbjct: 266 DPHESRRSVAKIRTAAANCK 285



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 3/80 (3%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK-- 417
           K  L++     + IDSL +G+D+   ++RARFE L   +  + ++ + + +  A+ +   
Sbjct: 285 KHILTTMPSTQLYIDSLMDGVDYNAQMSRARFESLIQPVINNLIQQLGECVEQAQKEHPG 344

Query: 418 -AQIHDIVLVGGSTRIPKVQ 474
            ++I DIVL+G + +IPK+Q
Sbjct: 345 LSKIDDIVLLGATMQIPKLQ 364


>UniRef50_A2ECV1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 650

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 24/57 (42%), Positives = 39/57 (68%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRK 178
           R ++LI+D GGGTFD+S  TI +   ++ ST GD+ LGG+D D  +V++   E +++
Sbjct: 192 RHHILIYDFGGGTFDISRATINNRKIKINSTGGDSKLGGQDIDAAIVDYLAPEIEKQ 248


>UniRef50_A2E4A6 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 844

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 30/78 (38%), Positives = 41/78 (52%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           V   D G  + +VSI  +  G  ++KS A D H GG  F   +    +    +KYK D  
Sbjct: 199 VAFIDFGDSSLNVSIAQLHQGAVDIKSFACDEHFGGAHFTEALQELLLDMTMKKYKIDPR 258

Query: 197 TNKRALRRLRTACERAKR 250
           TN+RA+ R  TA ERAK+
Sbjct: 259 TNQRAMIRFNTAVERAKK 276



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 30/107 (28%), Positives = 51/107 (47%)
 Frame = +1

Query: 190 PRYQQESS*AFAYCM*EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRS 369
           PR  Q +   F   +   K+ LS +     E+  L   +D      R  FE   ADL + 
Sbjct: 257 PRTNQRAMIRFNTAVERAKKVLSVNPVVRFEVQCLMNDMDVRFDFKREDFEAKIADLVKR 316

Query: 370 TMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
             EP+ K+L  A + K  +  I + GG++R+  V+  +++ F G++P
Sbjct: 317 LDEPINKALELAGVKKEDLFAIEVHGGASRVAAVKAHIKEIF-GRDP 362


>UniRef50_Q4PG59 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 919

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 34/84 (40%), Positives = 50/84 (59%), Gaps = 2/84 (2%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEEL--NADLFRSTMEPVEKSLRDAKMDK 417
           K  LS++  AS  ++SL + IDF T I R  FE+    A L      P+ ++L +A +  
Sbjct: 355 KHILSANDAASSSVESLVDEIDFRTMIQRQDFEDAVTAAGLVPKFTSPISQALANAGLKL 414

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQD 489
           + I+ IVLVGGSTR+P VQ  L++
Sbjct: 415 SDINSIVLVGGSTRVPLVQNALRE 438


>UniRef50_P77319 Cluster: Chaperone protein hscC; n=19;
           Gammaproteobacteria|Rep: Chaperone protein hscC -
           Escherichia coli (strain K12)
          Length = 556

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 33/82 (40%), Positives = 45/82 (54%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLAT 199
           L+FDLGGGTFDV++L     + EV ++AGD  LGGEDF + +V+   +  KR        
Sbjct: 169 LVFDLGGGTFDVTVLEYATPVIEVHASAGDNFLGGEDFTHMLVD---EVLKRADVARTTL 225

Query: 200 NKRALRRLRTACERAKRTCHRP 265
           N+  L  L    E AK +   P
Sbjct: 226 NESELAALYACVEAAKCSNQSP 247



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/57 (40%), Positives = 37/57 (64%)
 Frame = +1

Query: 340 EELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           E+L   L      P+E++LRDA++  +QI  +VLVGG++++P VQ++    F GK P
Sbjct: 269 EDLWLPLLNRLRVPIEQALRDARLKPSQIDSLVLVGGASQMPLVQRIAVRLF-GKLP 324


>UniRef50_A2EVQ1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 1135

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 36/92 (39%), Positives = 53/92 (57%), Gaps = 10/92 (10%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTI---EDGIFEVKSTA--GDTHLGGEDFDNRMVNHFVQ- 163
           G  + ++IFD GGGT DV+I+ +    +G+F+ K+ A  GD  LGGE  D  +++HF Q 
Sbjct: 192 GKNQKLMIFDFGGGTLDVTIMEMSKDSEGVFKFKTIAITGDPDLGGEVIDEMLMDHFSQI 251

Query: 164 ----EFKRKYKKDLATNKRALRRLRTACERAK 247
               ++K K   D  T+ R LR LR  C + K
Sbjct: 252 LEKYDYKVKTGDDEMTS-RNLRTLRDTCHKMK 282


>UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 545

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 32/87 (36%), Positives = 47/87 (54%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NV +FDLGGGTFDV IL I+ G        GD  LGG+D+D+ ++ +  + FK KY   
Sbjct: 197 QNVFVFDLGGGTFDVVILEIKGGKIREVVVNGDHLLGGKDWDDEIIRYASKIFKEKYGTY 256

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
              +  A + L+    +AK    +  K
Sbjct: 257 PLDDLSAYQDLQLRAIKAKEELTKREK 283



 Score = 40.3 bits (90), Expect = 0.046
 Identities = 26/91 (28%), Positives = 44/91 (48%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + KE+L+   +  I    +  G      +TR  FEE+   L          +L DA M  
Sbjct: 273 KAKEELTKREKTKIMC--VHAGNTLLVELTRDTFEEITKYLIDRCKVLCGIALSDANMTW 330

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
             +  ++LVGGSTR+P ++ ++ +  +GK P
Sbjct: 331 QDVGAVLLVGGSTRMPMIRNMIAE-ISGKTP 360


>UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_226_13599_12049 - Giardia lamblia
           ATCC 50803
          Length = 516

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 29/83 (34%), Positives = 49/83 (59%)
 Frame = -2

Query: 507 LLSIKEILQELLHLGDTSGATHQYNIVDLSLIHLGITERLLHWLHGRPEQIGVQLLEAST 328
           L +++E+ + LL L DT G T + N+VD+ L  LGI E  ++ +    E++  ++LE   
Sbjct: 148 LAAVEEVPEHLLDLRDTRGPTDKNNVVDVVLSELGIAENAINGVQALTEEVNAKILELRP 207

Query: 327 SN*RVEVNTLKERIYLNARLCGR 259
            +   EV  L++R+YL+ RL  R
Sbjct: 208 CDVSEEVYALEKRLYLDRRLLAR 230


>UniRef50_A0DJC4 Cluster: Chromosome undetermined scaffold_53, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_53,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 817

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 28/86 (32%), Positives = 50/86 (58%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + ++ LS++++A I ++ L E  DF T I R  FE++   +     + +E      +  K
Sbjct: 276 KARKVLSANSEAPINVEYLVEDEDFNTLIKREDFEQMIQPVLNQIQQQLEFLFSQVQNLK 335

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFF 495
            Q+H + +VGG+TRIP VQ+L++  F
Sbjct: 336 LQLHSVEIVGGATRIPAVQRLIEKIF 361


>UniRef50_Q5KHV7 Cluster: Heat shock protein HSP60, putative; n=2;
           Filobasidiella neoformans|Rep: Heat shock protein HSP60,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 601

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 31/90 (34%), Positives = 51/90 (56%), Gaps = 1/90 (1%)
 Frame = +1

Query: 244 KEDLSSST-QASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKA 420
           K  LS+S+  A+  ++SL EG+D  ++I R RF+ L A ++R     +  +++ A +D  
Sbjct: 327 KRSLSASSGAATCAVESLKEGMDLSSAINRLRFDGLAAPVYRQVGSVLSNTVKSAGLDLC 386

Query: 421 QIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           QI +++L G ST  P +Q  L   F G  P
Sbjct: 387 QIDEVLLAGASTLFPGLQSSLSYLFPGTTP 416



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 29/90 (32%), Positives = 50/90 (55%), Gaps = 9/90 (10%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + V++ D+G  +  VS++ + +G + V + A +  LGG +FDN ++ HF +EF +K K  
Sbjct: 240 KRVVVLDMGETSLAVSVIQVAEGEYTVLAKAREDKLGGREFDNLLLKHFAKEFTKKTKVA 299

Query: 191 L---------ATNKRALRRLRTACERAKRT 253
           L           +KRA  +LR A +  KR+
Sbjct: 300 LDLPCGESASDADKRAEAKLRLAVDHTKRS 329


>UniRef50_A6UND5 Cluster: 2-alkenal reductase; n=1; Methanococcus
           vannielii SB|Rep: 2-alkenal reductase - Methanococcus
           vannielii SB
          Length = 573

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 26/83 (31%), Positives = 47/83 (56%), Gaps = 1/83 (1%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEF-KRKY 181
           +  N+ +FD GGGT D+S+L +  G  +VK ++G+  LGG+D D  +V +  ++F     
Sbjct: 158 SNENIAVFDFGGGTLDISVLEMMGGFLDVKISSGNPKLGGKDIDELIVEYLKKKFLSGNP 217

Query: 182 KKDLATNKRALRRLRTACERAKR 250
             ++  N++ L  L+   E  K+
Sbjct: 218 NSNILNNQQNLLNLKLKAEELKK 240



 Score = 35.9 bits (79), Expect = 1.00
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 5/90 (5%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLF-EGIDFYTSITRARFEELNA---DLFRSTMEPVEKSLRDA 405
           E K+ LS  T + + I +    G D   +ITR  F        D  R  +    K   D 
Sbjct: 237 ELKKKLSMVTSSDVYIPNFGGAGKDLELTITRNEFNNAIKPVLDEIRVCIRDALKKANDK 296

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQK-LLQDF 492
            + +  I  ++LVGGS+RIP +Q+ ++Q+F
Sbjct: 297 GVTQKDISRVLLVGGSSRIPVIQEVVMQEF 326


>UniRef50_UPI00006CA81B Cluster: dnaK protein; n=1; Tetrahymena
           thermophila SB210|Rep: dnaK protein - Tetrahymena
           thermophila SB210
          Length = 811

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 25/82 (30%), Positives = 45/82 (54%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS++++A    + L E  D   ++TR  FE +   +     E +   + D K  K ++H 
Sbjct: 283 LSANSEADCNCEYLVEDCDLNENLTRTEFESVIQPVLARIKESINTIIEDLKSKKIELHS 342

Query: 433 IVLVGGSTRIPKVQKLLQDFFN 498
           + ++GG+ RIP VQ ++Q+ FN
Sbjct: 343 VEIIGGAVRIPAVQAIIQEAFN 364



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 19/82 (23%), Positives = 39/82 (47%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           T R+V   DLG   F   +         + S   + +LG  D D  +   + ++F++++ 
Sbjct: 200 TPRHVAFVDLGHSKFSAFVGAFTKEKLSIVSQVHERNLGARDMDWLVFQKYCKKFEQQHG 259

Query: 185 KDLATNKRALRRLRTACERAKR 250
             ++ +K+A  RL  A E+ ++
Sbjct: 260 LSVSESKKAQLRLLDAIEKQRK 281


>UniRef50_UPI0000498B17 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 543

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 20/52 (38%), Positives = 35/52 (67%)
 Frame = +2

Query: 23  IFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRK 178
           +FD GGGT D+S++   +G+ ++K+T GD  LGG D D  +  + ++E K++
Sbjct: 199 VFDFGGGTLDISVIKFVEGVMQIKTTIGDPFLGGNDIDFNIQKYLIEEIKKR 250



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/80 (32%), Positives = 49/80 (61%)
 Frame = +1

Query: 268 QASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVG 447
           QA   I+   E ++    +T ++F ELN D+F    + + K+L+ ++ +K+ I  +++VG
Sbjct: 295 QAECIIEIGIEALEEPFELTYSKFLELNQDIFNRCKDLMIKALQKSRYNKSAIDHVLMVG 354

Query: 448 GSTRIPKVQKLLQDFFNGKE 507
           GS + P ++ +L DFF GK+
Sbjct: 355 GSCKCPAIKAMLVDFF-GKD 373


>UniRef50_A7DID8 Cluster: Glutamate dehydrogenase; n=14;
           Alphaproteobacteria|Rep: Glutamate dehydrogenase -
           Methylobacterium extorquens PA1
          Length = 728

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/65 (47%), Positives = 42/65 (64%)
 Frame = -1

Query: 214 KSSLVGSEVLFVFPLELLDKVVDHAIVKVLTSQVGVAGGGFHLEDTILDGKDGHVEGTAA 35
           +  LV  +V  +  LEL  +V+DHA+V+VL ++ GVA    HLE  + D KD HVEG AA
Sbjct: 422 EGELVLGQVDALLLLELGGQVLDHAVVEVLATEEGVAVRRLHLEHAVADLKDRHVEGAAA 481

Query: 34  EVKDK 20
           EV D+
Sbjct: 482 EVVDR 486



 Score = 32.7 bits (71), Expect = 9.3
 Identities = 22/66 (33%), Positives = 32/66 (48%)
 Frame = -2

Query: 504 LSIKEILQELLHLGDTSGATHQYNIVDLSLIHLGITERLLHWLHGRPEQIGVQLLEASTS 325
           L  +E   +LLHLG    A  ++++VDL     GI ERL   L    +++  Q LE   +
Sbjct: 321 LLAEERFHDLLHLGHAGLAADEHDLVDLGSRDAGILERLAARLDRALDEVINQRLELRAA 380

Query: 324 N*RVEV 307
               EV
Sbjct: 381 ELEREV 386


>UniRef50_A7BR82 Cluster: Heat shock protein Hsp70; n=1; Beggiatoa
           sp. PS|Rep: Heat shock protein Hsp70 - Beggiatoa sp. PS
          Length = 516

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 3/81 (3%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIED-GIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           VLI+DLGGGTFDVSI+ I+      V ++ GD  LGG +FD  +  H  + F+++    L
Sbjct: 166 VLIYDLGGGTFDVSIVDIQSPQEITVIASEGDHDLGGVNFDEALAEHLNKLFQKEKGIYL 225

Query: 194 ATNKRA--LRRLRTACERAKR 250
            T + A   RR +   ERAKR
Sbjct: 226 KTEEDATSFRRAQAEAERAKR 246



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 29/64 (45%), Positives = 41/64 (64%)
 Frame = +1

Query: 319 SITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFN 498
           SI RA FEEL +D    T   +E +L +A + +  I  ++LVGGSTRIP ++++L   F 
Sbjct: 269 SIKRADFEELISDYITKTEMLIEDALFEANLTENDIEFVLLVGGSTRIPAIKRMLHKKF- 327

Query: 499 GKEP 510
           GKEP
Sbjct: 328 GKEP 331


>UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshimeri
           serovar 6b str. SLCC5334|Rep: Complete genome - Listeria
           welshimeri serovar 6b (strain ATCC 35897 / DSM 20650
           /SLCC5334)
          Length = 561

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/58 (44%), Positives = 39/58 (67%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +++ D+GGGTFDVSIL + DG+ +V +  G+ +LGGEDF   ++  F+   K   KKD
Sbjct: 164 LMVIDIGGGTFDVSILEMFDGVMQVIAIGGNNYLGGEDFTTVIIEDFLS--KSNLKKD 219



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 22/64 (34%), Positives = 37/64 (57%)
 Frame = +1

Query: 319 SITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFN 498
           S+T   FE++   L      P+ +SL+DA++    I  IVL+GG+T++P ++  +  F  
Sbjct: 256 SLTEKEFEKICQSLILKLRNPIIQSLKDAQLKPVDIEQIVLIGGATKMPIIKSFVSKFL- 314

Query: 499 GKEP 510
           GK P
Sbjct: 315 GKIP 318


>UniRef50_Q86JV8 Cluster: Similar to heat shock protein; n=2;
           Dictyostelium discoideum|Rep: Similar to heat shock
           protein - Dictyostelium discoideum (Slime mold)
          Length = 926

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 29/83 (34%), Positives = 49/83 (59%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           KE+LS + QA I I SL +  DF  +I++ +FEEL+  L   ++ P++K +    +    
Sbjct: 309 KENLSVNQQAQIFIGSLVDDHDFQATISKQQFEELSQSLIERSLLPLKKLILSTGIKLKD 368

Query: 424 IHDIVLVGGSTRIPKVQKLLQDF 492
           I    ++GG  RIP +Q+ L+D+
Sbjct: 369 IEYFEVIGGGVRIPFIQQALKDY 391


>UniRef50_Q5DEW6 Cluster: SJCHGC09345 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC09345 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 455

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 28/77 (36%), Positives = 46/77 (59%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS++T+   ++++LF G D    ITR   E   +DLF    +P+   + D  ++  Q  +
Sbjct: 312 LSANTEIFAQVENLFNGEDLKVKITRTEMEAFCSDLFDRVKQPLLDIMIDVPLESLQ--E 369

Query: 433 IVLVGGSTRIPKVQKLL 483
           +VL+GG TRIPK+Q +L
Sbjct: 370 VVLMGGGTRIPKIQSVL 386


>UniRef50_UPI00015B551B Cluster: PREDICTED: similar to
           ENSANGP00000015293; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000015293 - Nasonia
           vitripennis
          Length = 822

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 27/80 (33%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D G  +  VSI     G  ++ ++A D+ +GG + D  + ++F ++F+ +YK D
Sbjct: 199 RNVVFVDCGYASLQVSICAFHKGKLKMLASAADSQVGGREIDAILADYFCKDFQARYKID 258

Query: 191 LATNKRALRRLRTACERAKR 250
              N RA  RL T  E+ K+
Sbjct: 259 ARNNPRAYVRLLTEVEKLKK 278



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/84 (27%), Positives = 48/84 (57%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+  ++ST+  I I+   +  D +  + RA  E + A LF+     + + L  +K+   +
Sbjct: 278 KQMSANSTKLPINIECFIDEKDVHGDLQRADMEAMCAHLFKRVEATLRQCLAQSKLKLDE 337

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           IH + L GGS+R+P +++L+++ +
Sbjct: 338 IHSVELAGGSSRVPAIKRLIEEVY 361


>UniRef50_A7R204 Cluster: Chromosome undetermined scaffold_388,
           whole genome shotgun sequence; n=2; core
           eudicotyledons|Rep: Chromosome undetermined
           scaffold_388, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 372

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 31/95 (32%), Positives = 54/95 (56%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS++Q  I +  +            ++TR++FE L   L   T  P +  L+DA
Sbjct: 30  KAKIELSSTSQTDINLPFITADASGAKHLNITLTRSKFEALVDKLIERTRNPCKSCLKDA 89

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            +   ++ +++LVGG TR+PKVQ+++ + F GK P
Sbjct: 90  GISVKEVDEVLLVGGMTRVPKVQEVVAEIF-GKSP 123



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  +K +NPDE           IL GD    V++           GIET GG+ T LI R
Sbjct: 121 KSPSKGVNPDEAVAMGAAIQGGILRGD----VKELLLLDVTPLSLGIETLGGIFTRLINR 176

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 177 NTTIPTKKSQVF 188


>UniRef50_A2G8T1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 591

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 28/87 (32%), Positives = 50/87 (57%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LS+ ++A+I I+    G D   +I R  +EEL +D    + + +  ++R +K++ 
Sbjct: 277 QAKIKLSAESKATITIEDFASGYDLKVNIFRNHYEELISDEIEKSRKVLFNAIRGSKVEA 336

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFN 498
             I  +  +GG+ R P VQK+L +FFN
Sbjct: 337 ETISAVFPIGGTCRTPLVQKMLNEFFN 363



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 32/79 (40%), Positives = 42/79 (53%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + +LIFD G GT DVSI+ I+   FEV  T G++ LGG D D  +    +  FK K K  
Sbjct: 201 QKILIFDYGAGTLDVSIVEIKGKEFEVLYTEGNSDLGGHDLDLILYEDVLNTFKSKNKDI 260

Query: 191 LATNKRALRRLRTACERAK 247
                R+ R L    E+AK
Sbjct: 261 TTIPDRSARILMLEVEQAK 279


>UniRef50_Q05036 Cluster: Uncharacterized protein C30C11.4; n=2;
           Caenorhabditis|Rep: Uncharacterized protein C30C11.4 -
           Caenorhabditis elegans
          Length = 776

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 30/80 (37%), Positives = 43/80 (53%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G  +   S++    G  ++ +T+ D   GG  FD  +  HF +EFK KY  D
Sbjct: 198 RNVVFLDIGHSSTQASLVAFNRGKLQMVNTSYDLESGGIWFDALIREHFRKEFKTKYGID 257

Query: 191 LATNKRALRRLRTACERAKR 250
            AT+ R   RL   CER K+
Sbjct: 258 AATSPRPWLRLLDECERVKK 277



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+  ++ T   + I+   E  D    + R  FE+L A +F    + +     D    K +
Sbjct: 277 KQMSANQTPIPLNIECFMEDKDVTGKMQRQEFEDLAAPIFNRIKQVLINLFADGVSIKPE 336

Query: 424 -IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            I +I +VGGS+RIP ++++++D F GKEP
Sbjct: 337 EIDEIEIVGGSSRIPMIREIVKDLF-GKEP 365


>UniRef50_Q5CTE6 Cluster: APG-1 like HSP70 domain containing
           protein, signal peptide plus likely ER retention motif;
           n=2; Cryptosporidium|Rep: APG-1 like HSP70 domain
           containing protein, signal peptide plus likely ER
           retention motif - Cryptosporidium parvum Iowa II
          Length = 927

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 27/82 (32%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEE-LNADLFRSTMEPVEKSLRDAKMDKAQIH 429
           LS+  QA   ++SL++ +D   SI+R  F+  +   +    +EP+ +SLR A     +I 
Sbjct: 354 LSTLKQADFFVESLYKDVDISQSISREEFDRSIQEKILSKALEPINESLRVANKTMKEIT 413

Query: 430 DIVLVGGSTRIPKVQKLLQDFF 495
           D+ ++GG  R+P V+ LL  +F
Sbjct: 414 DVEILGGGIRVPGVRALLDQYF 435


>UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia
           burgdorferi group|Rep: Heat shock protein 70 - Borrelia
           burgdorferi (Lyme disease spirochete)
          Length = 491

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 28/77 (36%), Positives = 42/77 (54%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLAT 199
           LI+DLGGGTFDV+++  +   + V S  G + LGG DF+  +  + +  FK KY      
Sbjct: 166 LIYDLGGGTFDVTLMEKQGDTYTVLSVKGQSRLGGNDFNKIIEKYVLDSFKNKYPDFNLE 225

Query: 200 NKRALRRLRTACERAKR 250
           +   L +LR   E  K+
Sbjct: 226 DIFLLEQLRERIEEGKK 242



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 26/87 (29%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLF-EGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMD 414
           EGK++LS      ++I  LF +G     ++ R  F  + ++    T++   + + D+ +D
Sbjct: 239 EGKKNLS--VMEEVDITLLFLDGKHLNYNLKRDEFNSMISEYIDKTIQLSMECIADSGVD 296

Query: 415 KAQIHDIVLVGGSTRIPKVQKLLQDFF 495
            + +  I+L GGSTRIP ++K+L++ F
Sbjct: 297 ISSVSKIILSGGSTRIPLIEKVLKESF 323


>UniRef50_Q1VU26 Cluster: Heat shock protein Hsp70; n=2;
           Bacteroidetes|Rep: Heat shock protein Hsp70 -
           Psychroflexus torquis ATCC 700755
          Length = 838

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 22/47 (46%), Positives = 34/47 (72%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFV 160
           L+FD GGGTFD +++ +E+GI +V  T GD HLGG++ D  +V+  +
Sbjct: 177 LVFDFGGGTFDSALIKVEEGIMKVADTEGDNHLGGKNLDFAIVDKVI 223


>UniRef50_Q00YD5 Cluster: Heat shock protein 91-Arabidopsis
           thaliana; n=1; Ostreococcus tauri|Rep: Heat shock
           protein 91-Arabidopsis thaliana - Ostreococcus tauri
          Length = 779

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 29/79 (36%), Positives = 41/79 (51%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV   D+G     V I        ++ ST  D +LGG + D  + +HF  EFK   K D+
Sbjct: 223 NVAFVDVGHSAMQVCIAQFTKSGLKILSTGFDRNLGGRNVDEVLFDHFCDEFKETKKIDI 282

Query: 194 ATNKRALRRLRTACERAKR 250
            +N RA  RL+TA E+ K+
Sbjct: 283 RSNPRACLRLKTALEKMKQ 301



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 27/89 (30%), Positives = 54/89 (60%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ L+++ +A + I+ L + +D ++ ++R + EEL AD     + PVE ++++A +    
Sbjct: 300 KQILTANPEAPLNIECLMDDVDVHSMMSREKMEELAADTISRLVTPVETAVKEAGLTVGD 359

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I  + LVG ++R+P +   +Q+ F GK P
Sbjct: 360 IAAVELVGNASRMPCILGRMQELF-GKMP 387


>UniRef50_Q3W504 Cluster: Heat shock protein Hsp70; n=3;
           Actinomycetales|Rep: Heat shock protein Hsp70 - Frankia
           sp. EAN1pec
          Length = 586

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 2/78 (2%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK--DL 193
           L++DLGGGTFDV+I+ + D    V +T GD  LGG D+D ++V      F   + +  D 
Sbjct: 152 LVYDLGGGTFDVTIVELADRRVSVVATDGDHQLGGADWDEKIVLFLSDRFLEAHPEADDP 211

Query: 194 ATNKRALRRLRTACERAK 247
             +  A + L+ A ERA+
Sbjct: 212 LDDGEAAQELQLAAERAR 229


>UniRef50_A6EMR6 Cluster: Heat shock protein Hsp70; n=1;
           unidentified eubacterium SCB49|Rep: Heat shock protein
           Hsp70 - unidentified eubacterium SCB49
          Length = 847

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 23/53 (43%), Positives = 36/53 (67%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRK 178
           L+FD GGGTFD ++L I DGI +V  T GD +LGG++ D  +V+  +  + ++
Sbjct: 180 LVFDFGGGTFDAALLKITDGIRQVIDTEGDNYLGGKNLDEAIVDQIILPYLKE 232


>UniRef50_Q7SBZ8 Cluster: Putative uncharacterized protein
           NCU09485.1; n=2; Sordariomycetes|Rep: Putative
           uncharacterized protein NCU09485.1 - Neurospora crassa
          Length = 1005

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 31/84 (36%), Positives = 47/84 (55%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           + +TQAS E   L++ +DF   ITRA FEE+ A   +     V+ +L  A +    +  +
Sbjct: 346 NQNTQASFE--GLYDDVDFKYKITRAEFEEMAATHAQRVSAAVKNALSMAGLQIKDLDSV 403

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
           +L GG+TR P VQK L+ F  G +
Sbjct: 404 ILHGGATRTPFVQKELESFLGGAD 427


>UniRef50_UPI0000499E28 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 480

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 25/56 (44%), Positives = 35/56 (62%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           L FDLGGGT DV+IL  +   F+ ++T GD HLGG DFD   +   + + K K ++
Sbjct: 195 LAFDLGGGTLDVTILEKKGEEFKFRATGGDVHLGGLDFDMNFMELVISKMKEKQRR 250


>UniRef50_A6CBP2 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 671

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 25/81 (30%), Positives = 50/81 (61%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           + +L++DLGGGTFD+S++  +     V ++ GD  LGG D+++++     ++F  ++  +
Sbjct: 173 QRILVYDLGGGTFDLSLVKYQKDEVNVLASGGDLKLGGIDWNSKLQATIAEQFFGEFGVN 232

Query: 191 LATNKRALRRLRTACERAKRT 253
            A +  +L+ L    E+AKR+
Sbjct: 233 PANDPESLQYLANEVEQAKRS 253



 Score = 35.9 bits (79), Expect = 1.00
 Identities = 17/55 (30%), Positives = 30/55 (54%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQ 486
           IT+++FE+L   L   T       L+D  M  A +  ++  GGS+R+P ++  L+
Sbjct: 275 ITQSQFEQLTKGLVEQTTSITRALLKDNGMGWAHVDVVLTTGGSSRMPMIRDALK 329


>UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;
           Orientia tsutsugamushi Boryong|Rep: Heat shock chaperone
           protein hscA - Orientia tsutsugamushi (strain Boryong)
           (Rickettsia tsutsugamushi)
          Length = 616

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 24/45 (53%), Positives = 32/45 (71%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFD 136
           G+    L++D GGGTFDVS+L I++ IF+V +T GD  LGG D D
Sbjct: 195 GSNGVYLVYDFGGGTFDVSLLKIKNKIFQVIATGGDNQLGGNDID 239



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/67 (31%), Positives = 41/67 (61%)
 Frame = +1

Query: 295 FEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQ 474
           + G +    ITR  FE++ + +   T+    + ++++K+ + Q+  I+LVGGS+ IP ++
Sbjct: 288 YNGQNLKLYITRTEFEQVISHIISKTIHITNQVIQESKISE-QLKGIILVGGSSNIPLIK 346

Query: 475 KLLQDFF 495
           KLL+  F
Sbjct: 347 KLLKQTF 353


>UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK6 - Clostridium kluyveri DSM 555
          Length = 490

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 31/84 (36%), Positives = 45/84 (53%), Gaps = 6/84 (7%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDG----IFEVKSTAGDTHLGGEDFDNRMVNHFV--QEFKR 175
           N+L+FDLGGGTFD+++  + +      F V +T+GD  LGG DFD  + N+ V  +  + 
Sbjct: 176 NILVFDLGGGTFDLTLFNLNNSSNRISFNVLATSGDDRLGGMDFDEELYNYIVDREGIRL 235

Query: 176 KYKKDLATNKRALRRLRTACERAK 247
              KD      A  +L     RAK
Sbjct: 236 SACKDKRQQNIAKNKLMEQIIRAK 259


>UniRef50_A0MBW7 Cluster: HSP 70h; n=6; Closterovirus|Rep: HSP 70h -
           Raspberry mottle virus
          Length = 599

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 22/46 (47%), Positives = 31/46 (67%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH 154
           +L++D GGGTFDVS +T+    F VK + GD +LGG D D  + +H
Sbjct: 198 LLVYDFGGGTFDVSAVTVNGTTFVVKGSGGDMNLGGRDIDRALSDH 243


>UniRef50_A4RY30 Cluster: Heat Shock Protein 70, ER lumen; n=2;
           Ostreococcus|Rep: Heat Shock Protein 70, ER lumen -
           Ostreococcus lucimarinus CCE9901
          Length = 884

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 31/91 (34%), Positives = 50/91 (54%), Gaps = 3/91 (3%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEP---VEKSLRDAKMD 414
           KE LS++ +A   ++SL + ID  + ITR  F  L  D+F     P   +  SL D  + 
Sbjct: 278 KEILSANKEAPFSVESLHDEIDLRSKITRDEFTTLAGDIFERMTGPLRAIVASLGDFNIT 337

Query: 415 KAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
             +I  I ++GGSTR+P V++ +    NG++
Sbjct: 338 LDEIEAIEVIGGSTRVPGVKEEIGKAINGRK 368



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 22/59 (37%), Positives = 35/59 (59%)
 Frame = +2

Query: 71  EDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRLRTACERAK 247
           + G FE+ S   D  +GG+  D  +V HF +EFK+K+  DL+T  RA+ ++R    + K
Sbjct: 220 QHGQFEMVSVKWDETVGGDALDMLLVEHFQEEFKQKHGTDLSTIPRAVGKMRKQVRKTK 278


>UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia
           intestinalis|Rep: GLP_54_20127_18205 - Giardia lamblia
           ATCC 50803
          Length = 640

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/63 (36%), Positives = 38/63 (60%), Gaps = 1/63 (1%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIE-DGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           ++ D GGGT+D+SI+    DG++ V +TAGD  LGG+D+DN  V + + +    + +   
Sbjct: 207 VVIDAGGGTYDISIMECSGDGVYSVIATAGDGFLGGDDWDNGFVEYLIGDIAETFARGAP 266

Query: 197 TNK 205
             K
Sbjct: 267 DTK 269



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 27/87 (31%), Positives = 44/87 (50%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+  S      I +   ++G  +   ITR +FE L A L    + P +++L DA +    
Sbjct: 297 KKQFSEKVSTEIILPGFYDGKSYKKVITRDQFELLTAPLVARLIPPCKQALTDADLTPRD 356

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           I  I+ VGG+TR   +Q+ + +FF  K
Sbjct: 357 ISKILYVGGTTRSLALQRKVSEFFKQK 383



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/67 (37%), Positives = 34/67 (50%)
 Frame = +3

Query: 516 SINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIP 695
           ++NPDE           IL+     EV             G+ET GG+ + +IKRN TIP
Sbjct: 387 TMNPDESVSLGAAVQGAILN----HEVNSILLLDVAPLSLGLETLGGIFSPIIKRNATIP 442

Query: 696 TKQTQTF 716
           T++TQTF
Sbjct: 443 TRKTQTF 449


>UniRef50_A2R006 Cluster: Contig An12c0210, complete genome; n=1;
           Aspergillus niger|Rep: Contig An12c0210, complete genome
           - Aspergillus niger
          Length = 513

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/58 (41%), Positives = 41/58 (70%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFF 495
           ITR  +E++  D F  T+  V++++ +A+++K+ I ++VLVGGS   P +QK+L DFF
Sbjct: 231 ITRKEYEDVCKDNFAGTVALVKRTIHNAEIEKSAIREVVLVGGSASTPILQKVLADFF 288



 Score = 39.5 bits (88), Expect = 0.081
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 4/83 (4%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFK-RKYKKDL 193
           +L+ D+G    + ++L   +G+FEVKS+ GD  LGG  +D ++  +     + R   +DL
Sbjct: 144 MLVLDIGARRAEATVLDAWNGLFEVKSSHGDCRLGGWAYDIKLRRYLEYHMRDRIPDRDL 203

Query: 194 AT---NKRALRRLRTACERAKRT 253
            +       ++R  + CE    T
Sbjct: 204 QSLLGRSEDIKRSLSVCESVSDT 226


>UniRef50_A4FEW4 Cluster: Putative surface layer protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: Putative
           surface layer protein - Saccharopolyspora erythraea
           (strain NRRL 23338)
          Length = 793

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 4/81 (4%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILT-IEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           V ++DLGGGTFD ++L  + DGI  + S  G   LGG DFD  ++NH  +E      +  
Sbjct: 167 VAVYDLGGGTFDATVLRKLPDGIAILGSPEGIERLGGVDFDEAVLNHVDRELNGAIGELP 226

Query: 194 ATNKR---ALRRLRTACERAK 247
             + +   ALRRLR  C  AK
Sbjct: 227 PQDPQAATALRRLRQDCIEAK 247



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 28/84 (33%), Positives = 50/84 (59%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           E KE LS  T+ +I +            +TRA FE++      ST+E + ++LR A+++ 
Sbjct: 245 EAKEALSIDTETTIPV--FLPNRHCEVRLTRAEFEDMIRVPIESTIEALRRALRSARVEP 302

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQD 489
           A++  ++LVGGS+RIP V +++ +
Sbjct: 303 AELAAVLLVGGSSRIPLVARMVSE 326


>UniRef50_A4HIH9 Cluster: Heat shock 70-related protein 1,
           mitochondrial, putative; n=2; Leishmania
           braziliensis|Rep: Heat shock 70-related protein 1,
           mitochondrial, putative - Leishmania braziliensis
          Length = 356

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 25/63 (39%), Positives = 44/63 (69%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           I+R++FE +   L   ++ P ++ ++DA ++  +I+D+VLVGG TR+PKV + ++ FF  
Sbjct: 24  ISRSKFEGITTRLIERSIAPCKQCIKDAGVELKEINDVVLVGGMTRMPKVVEEVKRFFQ- 82

Query: 502 KEP 510
           KEP
Sbjct: 83  KEP 85


>UniRef50_P34935 Cluster: 78 kDa glucose-regulated protein; n=13;
           Eukaryota|Rep: 78 kDa glucose-regulated protein - Sus
           scrofa (Pig)
          Length = 262

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 31/85 (36%), Positives = 41/85 (48%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           +L GD  ++  D           GI
Sbjct: 13  PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD--QDTGDLVLLDVCPLTLGI 70

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI RNT +PTK++Q F
Sbjct: 71  ETVGGVMTKLIPRNTVVPTKKSQIF 95



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 21/27 (77%), Positives = 27/27 (100%)
 Frame = +1

Query: 430 DIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +IVLVGGSTRIPK+Q+L+++FFNGKEP
Sbjct: 2   EIVLVGGSTRIPKIQQLVKEFFNGKEP 28


>UniRef50_Q52V38 Cluster: Heat shock protein 70-like; n=4; Mint
           virus 1|Rep: Heat shock protein 70-like - Mint virus 1
          Length = 604

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 21/48 (43%), Positives = 34/48 (70%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV 148
           + R V+++D GGGTFDVS +++ +  F VK++ GD +LGG D D  ++
Sbjct: 197 SERFVMVYDFGGGTFDVSAVSVRNSTFVVKASGGDMNLGGRDVDRALL 244


>UniRef50_Q3WFH0 Cluster: Heat shock protein Hsp70; n=1; Frankia sp.
           EAN1pec|Rep: Heat shock protein Hsp70 - Frankia sp.
           EAN1pec
          Length = 832

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 6/82 (7%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQ-EFKRKYK---- 184
           L+FDLGGGTFD S++ I DG F++ +  GD  LGG+  D  +V   +     R+Y     
Sbjct: 173 LVFDLGGGTFDASVVHIRDGEFDIVNHRGDNFLGGKLIDWAIVEELLMPALLRQYSLPGF 232

Query: 185 -KDLATNKRALRRLRTACERAK 247
            +   T  +A+ +L+ A E AK
Sbjct: 233 GRGEPTWAQAIAKLKAAAENAK 254


>UniRef50_A6C7U7 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=1; Planctomyces maris DSM 8797|Rep:
           DnaK protein (Heat shock protein), HSP70/DnaK family -
           Planctomyces maris DSM 8797
          Length = 557

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 3/82 (3%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK--- 187
           VL++DLGGGTFD++++ ++ G   V ST GD  LGG ++D  +     Q+   +  +   
Sbjct: 169 VLVYDLGGGTFDITLVDVKKGALTVLSTDGDAELGGFNWDTELAQFLAQKVAEETGESVD 228

Query: 188 DLATNKRALRRLRTACERAKRT 253
           D+  +      L    E AKRT
Sbjct: 229 DILGDGEFYADLLLMAEEAKRT 250



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 2/90 (2%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           E K  LS+   A   +  L+ G    T +TR  F +L   L   T+E  +     A+ + 
Sbjct: 246 EAKRTLSTRETAKQVL--LYGGERIKTEVTRDEFNDLTRHLLDRTIEITKTVFERAESNT 303

Query: 418 AQI--HDIVLVGGSTRIPKVQKLLQDFFNG 501
           +      I+LVGGST +P+V++ ++  F G
Sbjct: 304 SLPVPKRILLVGGSTYMPQVKQRIEQEFPG 333


>UniRef50_A7PZ39 Cluster: Chromosome chr4 scaffold_39, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr4 scaffold_39, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 704

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 25/70 (35%), Positives = 48/70 (68%)
 Frame = +1

Query: 298 EGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQK 477
           E ++F ++IT  +FEEL  DL+  ++  V++ L+++ +   +I+ + L+GG+TR+PK+Q 
Sbjct: 87  EILNFRSAITCEKFEELCEDLWERSLILVKEVLKNSGLKVDEIYAVELIGGATRVPKLQA 146

Query: 478 LLQDFFNGKE 507
            LQ+F   K+
Sbjct: 147 KLQEFLGRKD 156



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 2/63 (3%)
 Frame = +2

Query: 65  TIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNK--RALRRLRTACE 238
           T+    F+VK  + D  LGG++ + R+V +F  EF ++    +   K  +A+ +L+   +
Sbjct: 24  TVTVNQFQVKDVSWDPELGGQNMEMRLVEYFADEFNQQVGNGVDVRKFPKAMAKLKKQVK 83

Query: 239 RAK 247
           R K
Sbjct: 84  RTK 86


>UniRef50_A1XM67 Cluster: Heat shock protein Hsp70-6; n=1;
           Blastocladiella emersonii|Rep: Heat shock protein
           Hsp70-6 - Blastocladiella emersonii (Aquatic fungus)
          Length = 605

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 27/81 (33%), Positives = 45/81 (55%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS +T A+  ++S +EGID+ +S+ R RFE L A   R     +   L    +D  ++  
Sbjct: 345 LSQATIANCHVESFYEGIDYVSSVNRTRFETLAAKWKRQLDAGITDFLEAQNVDADEVDH 404

Query: 433 IVLVGGSTRIPKVQKLLQDFF 495
           ++LVGG    P VQ++ ++ F
Sbjct: 405 VLLVGGVAFTPFVQRMFENKF 425



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDT-HLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           ++ D+G  +  +S++    G+  +   A  T  +GG   D  +  HF  +FK++ + D  
Sbjct: 268 VVADVGASSTTISLMNQFAGL--ITPIAHTTLPIGGVTLDQALAGHFAADFKKRTQHDTT 325

Query: 197 TNKRALRRLRTACERAKR 250
           TN++A  +L  ACE A++
Sbjct: 326 TNRKATEKLLVACEIARK 343


>UniRef50_Q9XZM1 Cluster: Heat shock protein HSP70-2; n=3; Entamoeba
           histolytica|Rep: Heat shock protein HSP70-2 - Entamoeba
           histolytica
          Length = 244

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 26/80 (32%), Positives = 47/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK-K 187
           + +L+FD+GGGTFD++++ +     +V +T G+ HLGG+D D ++    ++++K   K K
Sbjct: 28  KTILVFDIGGGTFDITLIRMNKRNQQVIATEGERHLGGKDIDRKVEEILMKKWKEIDKEK 87

Query: 188 DLATNKRALRRLRTACERAK 247
              + KR   R+    E  K
Sbjct: 88  AEESYKRKKYRIEKISEEIK 107



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/89 (22%), Positives = 51/89 (57%), Gaps = 7/89 (7%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGID--FYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKA-- 420
           LS++ + + ++   +E  +      I+R   EE + ++F   ++ +E+   D  M K   
Sbjct: 110 LSTNQRCTFDLSEFYEEEEEIINIEISRQEVEEASKEIFEKCIKCIERMFEDKTMQKKGI 169

Query: 421 ---QIHDIVLVGGSTRIPKVQKLLQDFFN 498
               + +++LVGG+++IPK+++++ ++F+
Sbjct: 170 RKESVEEVILVGGTSKIPKIREMVSEYFD 198


>UniRef50_Q57VU9 Cluster: Heat shock 70 kDa protein, putative; n=4;
           Trypanosoma|Rep: Heat shock 70 kDa protein, putative -
           Trypanosoma brucei
          Length = 870

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 4/68 (5%)
 Frame = +2

Query: 2   GTRRNV--LIFDLGGGTFDVSILTIED--GIFEVKSTAGDTHLGGEDFDNRMVNHFVQEF 169
           G++R V  L+FDLGGGT D +++  +   G F + +T GD  LGG D+D  +  HF  +F
Sbjct: 264 GSKRIVRSLVFDLGGGTLDCAVMENDRRRGTFTLVATHGDPLLGGNDWDAVLSQHFSDQF 323

Query: 170 KRKYKKDL 193
           +RK++  L
Sbjct: 324 ERKWRVPL 331


>UniRef50_Q22515 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 921

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++     +++SLFE  +F   +TR   E++  DL      P+  ++  A++    
Sbjct: 309 KQVLSANKDTYAQVESLFEEQNFRAKVTREELEKMIEDLEPRIAAPILDAIGMAQISTND 368

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I  +VL+G  TR+PKV+++L+     KE
Sbjct: 369 IDLVVLMGAGTRVPKVKEILKTILKDKE 396



 Score = 37.1 bits (82), Expect = 0.43
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +2

Query: 107 DTHLGGEDFDNRMVNHFVQEFKRKYK--KDLATNKRALRRLRTACERAKR 250
           D  LGG +  NR+ +H  + F+   K  KD++TN RA+ +L    ER K+
Sbjct: 261 DKTLGGLEITNRLRDHLEKVFRDTVKTSKDISTNARAIGKLHKEAERVKQ 310


>UniRef50_Q1NQZ1 Cluster: Glutamate dehydrogenase precursor; n=1;
           delta proteobacterium MLMS-1|Rep: Glutamate
           dehydrogenase precursor - delta proteobacterium MLMS-1
          Length = 656

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 24/61 (39%), Positives = 41/61 (67%)
 Frame = -1

Query: 202 VGSEVLFVFPLELLDKVVDHAIVKVLTSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKD 23
           V +++  +  LEL+ + VD   +KV  +Q GVA GG + +D + D +DG++EG+A +VKD
Sbjct: 396 VATQINPLLALELVGQPVDDPHIKVFATQEGVAVGGLYFKDPVADLQDGNIEGSATKVKD 455

Query: 22  K 20
           +
Sbjct: 456 R 456



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 29/70 (41%), Positives = 39/70 (55%)
 Frame = -3

Query: 716 ECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCYIKQQQILHLLRLVTVQDSSLDSCTISY 537
           E L+L SGDG V LD+ GH  +  L+ +GK   IKQQ +L     + +Q  +LD     +
Sbjct: 225 ENLTLLSGDGGVLLDQLGHHPTQGLDPQGKRGDIKQQHVLD----IALQHPALDGSAKGH 280

Query: 536 GLVRVNRFVG 507
            LV VN  VG
Sbjct: 281 HLVGVNPPVG 290


>UniRef50_A5MZQ6 Cluster: DnaK8; n=2; Clostridium kluyveri DSM
           555|Rep: DnaK8 - Clostridium kluyveri DSM 555
          Length = 530

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 30/88 (34%), Positives = 54/88 (61%), Gaps = 9/88 (10%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSIL---TIEDG--IFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKR 175
           +N+L++DLGGGTFDV IL   T E+G   +E+ +  G   LGG+DFD +++    ++F+ 
Sbjct: 174 QNILVYDLGGGTFDVCILKAETQEEGNANYEILAKEGINKLGGDDFDRKLMELINEKFQD 233

Query: 176 KYKKDLATNKR----ALRRLRTACERAK 247
           +   DL   ++    + ++L+ A ++ K
Sbjct: 234 ECGMDLLDTQKDQGVSRKKLKEAMQKLK 261



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 23/71 (32%), Positives = 40/71 (56%)
 Frame = +1

Query: 298 EGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQK 477
           E ++    I R  F +   +L   T + V+K+L +A +    I  I+LVGGST +P +++
Sbjct: 291 EWLNVDVEIEREEFNDRIENLIYKTEDTVKKALENAGLTIDDIDKIILVGGSTLVPIIKE 350

Query: 478 LLQDFFNGKEP 510
            +++ F G EP
Sbjct: 351 KIKEMF-GVEP 360


>UniRef50_A2EAK8 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 615

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           +++ V++FD G GT DVSI+  +   F V  T G++ LGG D D+ +    + +FK +  
Sbjct: 209 SKKTVIVFDFGAGTLDVSIVEFDGNSFNVIHTEGNSQLGGIDIDHAIYEFVLNKFKDENN 268

Query: 185 KDLATNKRALRRLRTACERAK 247
                N + L  L    E+ K
Sbjct: 269 GYDKANPKMLATLMIEAEKCK 289



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 25/85 (29%), Positives = 45/85 (52%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSS  A I I   + GID   ++ R +FE L  D+     E +  +++ +K++   
Sbjct: 289 KIKLSSSPSAEIFIPGFWNGIDLNVTLRRRQFETLIDDIIEKAKEVLNTAIKASKVNVKN 348

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFN 498
           I  ++ +GG+ +IP    +L + F+
Sbjct: 349 ITSVIPIGGTCKIPAAIDILNEIFD 373


>UniRef50_A7U5U4 Cluster: Hsp70; n=4; Pezizomycotina|Rep: Hsp70 -
           Magnaporthe oryzae
          Length = 999

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 26/85 (30%), Positives = 45/85 (52%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           LS+++      + L+E +DF   I R  FE++  D        V+ +L  A +D A +  
Sbjct: 335 LSANSNTGASFEGLYEDVDFKYKIERVDFEKMAEDQVGRVSVAVKTALETAGIDIADLDS 394

Query: 433 IVLVGGSTRIPKVQKLLQDFFNGKE 507
           ++L GG+TR P VQ+ L+  F  ++
Sbjct: 395 VILAGGATRTPFVQQELEKLFGAEK 419


>UniRef50_A4ZIR9 Cluster: Heat shock protein 70; n=12;
           Closterovirus|Rep: Heat shock protein 70 - Grapevine
           leafroll-associated virus 2
          Length = 599

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 20/47 (42%), Positives = 32/47 (68%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH 154
           ++ ++D GGGTFDVSI++  +  F V+++ GD +LGG D D   + H
Sbjct: 199 SLAVYDFGGGTFDVSIISYRNNTFVVRASGGDLNLGGRDVDRAFLEH 245


>UniRef50_A6GJQ9 Cluster: Heat shock protein Hsp70; n=1;
           Plesiocystis pacifica SIR-1|Rep: Heat shock protein
           Hsp70 - Plesiocystis pacifica SIR-1
          Length = 826

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 38/122 (31%), Positives = 55/122 (45%), Gaps = 5/122 (4%)
 Frame = +2

Query: 20  LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRK----YKK 187
           L++DLGGGTFD S+L   DG   V    GD  LGG DFD  +V+  +     +      +
Sbjct: 171 LVYDLGGGTFDASLLETADGFLRVVGHDGDNFLGGRDFDWAIVDWAIARIAEQDGVTISR 230

Query: 188 DLATNKRALRRLRTACERAKRTCHRPHKRALR*ILSLRVLTSTRQL-LVLASRS*TPICS 364
               +  A++ L+ A E  K    R     L     L V  S+  + L +   +   +CS
Sbjct: 231 GDPAHAEAVKTLKQAAEEVKIELSRSTDAVLVPAAPLEVGGSSLDVELEIDRPTLETLCS 290

Query: 365 GL 370
           GL
Sbjct: 291 GL 292


>UniRef50_UPI0000499AA8 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 757

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/81 (30%), Positives = 44/81 (54%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           S S +A + +D+L+E  D++   TR +F+EL   L    +E +++++  A M   QIH I
Sbjct: 279 SGSPKAILNLDTLYEERDYHMEFTREKFDELTCHLNNEIIELIKRTITKAGMTIEQIHSI 338

Query: 436 VLVGGSTRIPKVQKLLQDFFN 498
            + G  TR+  +Q  +    N
Sbjct: 339 EITGSGTRLNTLQDAIVKTLN 359



 Score = 32.7 bits (71), Expect = 9.3
 Identities = 18/78 (23%), Positives = 38/78 (48%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V+I D+G      S++++     +V +   +  LGG ++D  +      + ++K+K D
Sbjct: 195 RPVVILDVGHCNTTCSVISLLKSKMKVLAVEYNWKLGGRNYDEALGQFVRADIQQKWKID 254

Query: 191 LATNKRALRRLRTACERA 244
              N R   R+ +  E++
Sbjct: 255 PMNNLRMWNRILSGIEKS 272


>UniRef50_Q66239 Cluster: 65-kDa protein; n=19; Citrus tristeza
           virus|Rep: 65-kDa protein - Citrus tristeza virus
          Length = 594

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 24/66 (36%), Positives = 44/66 (66%), Gaps = 2/66 (3%)
 Frame = +2

Query: 23  IFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQ--EFKRKYKKDLA 196
           ++D GGGTFDVSI+++    F V+S++GD +LGG D D ++ +   +  +F  + + +++
Sbjct: 201 VYDFGGGTFDVSIVSVRLPTFAVRSSSGDMNLGGRDIDKKLSDKIYEMADFVPQKELNVS 260

Query: 197 TNKRAL 214
           + K AL
Sbjct: 261 SLKEAL 266


>UniRef50_A4EA23 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 516

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/68 (42%), Positives = 45/68 (66%)
 Frame = -1

Query: 223 QTPKSSLVGSEVLFVFPLELLDKVVDHAIVKVLTSQVGVAGGGFHLEDTILDGKDGHVEG 44
           QT +   V ++V  V  LEL+   VD A++ V+ +QV +A GG +L+  + + +DG VEG
Sbjct: 261 QTLQGHGVLTQVDTVLLLELIGHPVDDALIPVVAAQVVIARGGQNLKHAVGEVEDGDVEG 320

Query: 43  TAAEVKDK 20
           TAA+VKD+
Sbjct: 321 TAAQVKDQ 328


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 747,411,630
Number of Sequences: 1657284
Number of extensions: 15794452
Number of successful extensions: 54963
Number of sequences better than 10.0: 408
Number of HSP's better than 10.0 without gapping: 51526
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54832
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57851245060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -