SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20035
         (493 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P46776 Cluster: 60S ribosomal protein L27a; n=204; Euka...   102   4e-21
UniRef50_Q9LR33 Cluster: 60S ribosomal protein L27a-2; n=56; Euk...   100   2e-20
UniRef50_Q00V89 Cluster: 60s ribosomal protein L15/L27; n=2; Ost...    92   5e-18
UniRef50_A1BQ56 Cluster: Ribosomal protein L27a; n=4; Bilateria|...    92   7e-18
UniRef50_Q00454 Cluster: 60S ribosomal protein L27a; n=3; Eukary...    91   2e-17
UniRef50_Q9AW02 Cluster: 60S ribosomal protein L27A; n=3; Eukary...    69   4e-11
UniRef50_O62581 Cluster: 60S ribosomal protein L27a; n=1; Enceph...    53   4e-06
UniRef50_Q4P992 Cluster: Putative uncharacterized protein; n=1; ...    52   5e-06
UniRef50_Q3LW97 Cluster: Ribosomal protein L27a; n=1; Bigelowiel...    51   2e-05
UniRef50_A7QSF4 Cluster: Chromosome chr12 scaffold_159, whole ge...    50   3e-05
UniRef50_Q9LPV3 Cluster: Putative 60S ribosomal protein L27a-1; ...    39   0.053
UniRef50_UPI0000DA3FAD Cluster: PREDICTED: similar to 60S riboso...    39   0.070
UniRef50_P53143 Cluster: Putative uncharacterized protein YGL102...    35   1.1  
UniRef50_A4ANL3 Cluster: Putative lipoprotein; n=1; Flavobacteri...    34   2.0  
UniRef50_Q9ZQM0 Cluster: Putative non-LTR retroelement reverse t...    33   3.5  
UniRef50_A7RPS0 Cluster: Predicted protein; n=1; Nematostella ve...    32   8.0  

>UniRef50_P46776 Cluster: 60S ribosomal protein L27a; n=204;
           Eukaryota|Rep: 60S ribosomal protein L27a - Homo sapiens
           (Human)
          Length = 148

 Score =  102 bits (245), Expect = 4e-21
 Identities = 43/78 (55%), Positives = 54/78 (69%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M +  +KTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GM++
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKH 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           +H ++N++FCP +NLDKL
Sbjct: 61  YHLKRNQSFCPTVNLDKL 78



 Score = 58.8 bits (136), Expect = 6e-08
 Identities = 33/88 (37%), Positives = 42/88 (47%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           + L + Q F  +  L   WTLVSEQTR+  A    G  P+I++V++           PKQ
Sbjct: 61  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQ 120

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV               VGGACVL A
Sbjct: 121 PVIVKAKFFSRRAEEKIKSVGGACVLVA 148


>UniRef50_Q9LR33 Cluster: 60S ribosomal protein L27a-2; n=56;
           Eukaryota|Rep: 60S ribosomal protein L27a-2 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 146

 Score =  100 bits (239), Expect = 2e-20
 Identities = 46/78 (58%), Positives = 51/78 (65%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           MAT+ KK RK RGHVS                 NAGG HHHRI  DKYHPGYFGK+GMR 
Sbjct: 1   MATALKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           FH  +NK FCP++NLDKL
Sbjct: 61  FHKLRNKFFCPIVNLDKL 78


>UniRef50_Q00V89 Cluster: 60s ribosomal protein L15/L27; n=2;
           Ostreococcus|Rep: 60s ribosomal protein L15/L27 -
           Ostreococcus tauri
          Length = 198

 Score = 92.3 bits (219), Expect = 5e-18
 Identities = 41/76 (53%), Positives = 47/76 (61%)
 Frame = +1

Query: 28  TSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRNFH 207
           T   K RK RGHVS                  AGG+HHHRI MDKYHPGYFGK+GMR+FH
Sbjct: 54  TQLHKNRKKRGHVSAGHGRIGKHRKHPAGRGMAGGQHHHRIMMDKYHPGYFGKVGMRHFH 113

Query: 208 FRKNKNFCPVLNLDKL 255
             KN+  CP +N+DKL
Sbjct: 114 KLKNQTVCPTINIDKL 129



 Score = 36.7 bits (81), Expect = 0.28
 Identities = 23/84 (27%), Positives = 34/84 (40%)
 Frame = +3

Query: 213 KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQPVIV 392
           K Q    +  +   WTLV  + R + A     + PVI++              P QPV+V
Sbjct: 116 KNQTVCPTINIDKLWTLVGTEKREECAKNTS-QAPVIDLTDHGIFKLLGKGQLPNQPVVV 174

Query: 393 XXXXXXXXXXXXXXDVGGACVLSA 464
                         +VGGAC+L+A
Sbjct: 175 KCRYISKLAEKKIKEVGGACILTA 198


>UniRef50_A1BQ56 Cluster: Ribosomal protein L27a; n=4;
           Bilateria|Rep: Ribosomal protein L27a - Ascaris suum
           (Pig roundworm) (Ascaris lumbricoides)
          Length = 133

 Score = 91.9 bits (218), Expect = 7e-18
 Identities = 36/45 (80%), Positives = 40/45 (88%)
 Frame = +1

Query: 121 NAGGEHHHRINMDKYHPGYFGKLGMRNFHFRKNKNFCPVLNLDKL 255
           NAGG+HHHRIN DKYHPGYFGK+GMRNFH RKN  +CP +NLDKL
Sbjct: 20  NAGGQHHHRINFDKYHPGYFGKVGMRNFHVRKNGLYCPTVNLDKL 64



 Score = 55.2 bits (127), Expect = 7e-07
 Identities = 31/70 (44%), Positives = 36/70 (51%)
 Frame = +3

Query: 255 WTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQPVIVXXXXXXXXXXXXXX 434
           W+LVSE+TR  YA   D K PVI++VKA           PKQPVIV              
Sbjct: 65  WSLVSEKTRTTYAEKKD-KAPVIDVVKAGYFKVLGKGLLPKQPVIVKAKFFSRTAEQKIK 123

Query: 435 DVGGACVLSA 464
            VGGAC+L A
Sbjct: 124 GVGGACILVA 133


>UniRef50_Q00454 Cluster: 60S ribosomal protein L27a; n=3;
           Eukaryota|Rep: 60S ribosomal protein L27a - Tetrahymena
           thermophila
          Length = 149

 Score = 90.6 bits (215), Expect = 2e-17
 Identities = 43/80 (53%), Positives = 50/80 (62%), Gaps = 2/80 (2%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXN--AGGEHHHRINMDKYHPGYFGKLGM 195
           M +  KKTRKLRGHVS                    AGG HHHRI M+K+HPGY+GKLGM
Sbjct: 1   MVSHLKKTRKLRGHVSHGHGRVGKHRKGGCRGGRGKAGGMHHHRILMEKWHPGYYGKLGM 60

Query: 196 RNFHFRKNKNFCPVLNLDKL 255
           R FH +KN   CPV+N+DKL
Sbjct: 61  RTFHLKKNPLHCPVVNIDKL 80



 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 29/70 (41%), Positives = 35/70 (50%)
 Frame = +3

Query: 255 WTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQPVIVXXXXXXXXXXXXXX 434
           W+LVS+ TR KYA     KVPVI++ KA           P QPV+V              
Sbjct: 81  WSLVSDATRQKYAEDKK-KVPVIDVTKAGFFKVLGKGRLPNQPVVVKAKYFSKTAERRIV 139

Query: 435 DVGGACVLSA 464
            VGGACVL+A
Sbjct: 140 AVGGACVLTA 149


>UniRef50_Q9AW02 Cluster: 60S ribosomal protein L27A; n=3;
           Eukaryota|Rep: 60S ribosomal protein L27A - Guillardia
           theta (Cryptomonas phi)
          Length = 144

 Score = 69.3 bits (162), Expect = 4e-11
 Identities = 32/78 (41%), Positives = 43/78 (55%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M T  +++RK RGHVS                 N+GG+HHH+I  +KYH  +FGK GMR 
Sbjct: 1   MPTDIRRSRKKRGHVSSGHGRVGKHRKHPGGRGNSGGQHHHKIFFEKYHKKHFGKTGMRY 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           +   K  NF   +NLDK+
Sbjct: 61  YRKLKQNNFNKSINLDKI 78


>UniRef50_O62581 Cluster: 60S ribosomal protein L27a; n=1;
           Encephalitozoon cuniculi|Rep: 60S ribosomal protein L27a
           - Encephalitozoon cuniculi
          Length = 147

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 27/78 (34%), Positives = 38/78 (48%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M    KKTRKLRGHVS                  AGG  H +    ++HP Y GK GMR 
Sbjct: 1   MTDRVKKTRKLRGHVSHGYGRVGKHRKHSGGRGLAGGFSHMKTFFTRFHPDYHGKRGMRV 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           +H ++N ++   ++  +L
Sbjct: 61  YHRKENSDYARPISSARL 78


>UniRef50_Q4P992 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 187

 Score = 52.4 bits (120), Expect = 5e-06
 Identities = 25/50 (50%), Positives = 26/50 (52%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHP 171
           M T   KTRK RGHVS                  AGG+HHHR NMDKYHP
Sbjct: 1   MPTHLSKTRKHRGHVSAGNGRVGKHRKHPGGRGLAGGQHHHRTNMDKYHP 50



 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 19/42 (45%), Positives = 27/42 (64%)
 Frame = +1

Query: 130 GEHHHRINMDKYHPGYFGKLGMRNFHFRKNKNFCPVLNLDKL 255
           G     ++ +     YFGK+GMR+FH  +N +F PV+NLDKL
Sbjct: 77  GSQEMEVDREIGRDSYFGKVGMRHFHLTRNSSFRPVVNLDKL 118


>UniRef50_Q3LW97 Cluster: Ribosomal protein L27a; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L27a - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 151

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 24/68 (35%), Positives = 33/68 (48%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M T  KK+RK+RG  S                  +GG+HHH+I  ++Y   YF K GMR 
Sbjct: 1   MVTKLKKSRKMRGKNSSGHGRINKHRKNPGGKGKSGGQHHHKIIFERYRETYFRKTGMRI 60

Query: 202 FHFRKNKN 225
           ++  K  N
Sbjct: 61  YNLEKTLN 68


>UniRef50_A7QSF4 Cluster: Chromosome chr12 scaffold_159, whole
           genome shotgun sequence; n=3; Vitis vinifera|Rep:
           Chromosome chr12 scaffold_159, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 151

 Score = 50.0 bits (114), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 27/33 (81%)
 Frame = +1

Query: 157 DKYHPGYFGKLGMRNFHFRKNKNFCPVLNLDKL 255
           DK+HPG FGK+GMR+FH  + K  CP++++DKL
Sbjct: 28  DKHHPGNFGKVGMRHFHKLRIKLHCPIVHIDKL 60


>UniRef50_Q9LPV3 Cluster: Putative 60S ribosomal protein L27a-1;
           n=1; Arabidopsis thaliana|Rep: Putative 60S ribosomal
           protein L27a-1 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 104

 Score = 39.1 bits (87), Expect = 0.053
 Identities = 30/80 (37%), Positives = 37/80 (46%), Gaps = 2/80 (2%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGK--LGM 195
           M TS+KKTR LR HVS                       H R    +  PG  G   +GM
Sbjct: 1   MTTSRKKTRNLREHVSVG---------------------HGRFGKHRKLPGSRGNAGVGM 39

Query: 196 RNFHFRKNKNFCPVLNLDKL 255
           R FH  +NK +C ++NLDKL
Sbjct: 40  RYFHKLRNKFYCQIVNLDKL 59


>UniRef50_UPI0000DA3FAD Cluster: PREDICTED: similar to 60S ribosomal
           protein L27a; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to 60S ribosomal protein L27a - Rattus
           norvegicus
          Length = 86

 Score = 38.7 bits (86), Expect = 0.070
 Identities = 21/51 (41%), Positives = 24/51 (47%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPG 174
           M+   +KTRK +GHVS                 NAGGEH HRIN     PG
Sbjct: 1   MSGRLRKTRKFQGHVSDSHSRISKHHKHRGGQRNAGGEHLHRINCYYKVPG 51


>UniRef50_P53143 Cluster: Putative uncharacterized protein YGL102C;
           n=2; Saccharomycetaceae|Rep: Putative uncharacterized
           protein YGL102C - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 142

 Score = 34.7 bits (76), Expect = 1.1
 Identities = 18/57 (31%), Positives = 28/57 (49%)
 Frame = -2

Query: 243 VQNWTEILVLSKVEISHTKFAKVSRMVLVHVDXXXXXXXXXXXXXXXXXVLSDTTMS 73
           VQ+W   + L  VE+SHT   +++ MV +HV+                 VL+DTT +
Sbjct: 79  VQDWLPEMSLLLVEVSHTNLTEITWMVFIHVNSVVMLTTGHTSTTGVLSVLTDTTFT 135


>UniRef50_A4ANL3 Cluster: Putative lipoprotein; n=1;
           Flavobacteriales bacterium HTCC2170|Rep: Putative
           lipoprotein - Flavobacteriales bacterium HTCC2170
          Length = 535

 Score = 33.9 bits (74), Expect = 2.0
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = -1

Query: 454 TQAPPTSLIFFSADFEKNFAFTMTGCLGSLPL 359
           T A   SL FFS D + N A T  GCLG+ P+
Sbjct: 306 TDAEGNSLYFFSLDTKDNSACTSAGCLGAWPV 337


>UniRef50_Q9ZQM0 Cluster: Putative non-LTR retroelement reverse
           transcriptase; n=1; Arabidopsis thaliana|Rep: Putative
           non-LTR retroelement reverse transcriptase - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 1044

 Score = 33.1 bits (72), Expect = 3.5
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +3

Query: 156 GQVPSWILWQTWYEKFPL*KEQEFLSSFEL 245
           GQ+P WILW  W  +  L  EQ+ +SS +L
Sbjct: 842 GQLPIWILWNLWNCRNKLIFEQKHISSMDL 871


>UniRef50_A7RPS0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 306

 Score = 31.9 bits (69), Expect = 8.0
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = -1

Query: 229 RNSCSF*SGNFSYQVCQSIQDGTCPC*FCDGAHHQHYHDLLDAYGA 92
           R+SC   +  F   +C+S    T PC   D  H +H  DL+D  GA
Sbjct: 108 RSSCQ--ARCFMNNLCRSYNYNTTPCQLSDSDHLEHPSDLVDKPGA 151


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 459,080,676
Number of Sequences: 1657284
Number of extensions: 8617124
Number of successful extensions: 20201
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 19487
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20182
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 28437262108
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -