SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20033
         (694 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8SYY6 Cluster: RE27904p; n=8; Coelomata|Rep: RE27904p ...   100   3e-20
UniRef50_Q8MXH3 Cluster: Putative uncharacterized protein T09A12...    83   8e-15
UniRef50_Q7ZUJ1 Cluster: Zgc:56419; n=5; Euteleostomi|Rep: Zgc:5...    79   1e-13
UniRef50_Q9Y6X1 Cluster: Ribosome-attached membrane protein 4; n...    79   1e-13
UniRef50_Q238X7 Cluster: Ribosome associated membrane protein RA...    62   1e-08
UniRef50_Q5BTC1 Cluster: SJCHGC02042 protein; n=1; Schistosoma j...    58   2e-07
UniRef50_A7QP46 Cluster: Chromosome chr1 scaffold_136, whole gen...    57   5e-07
UniRef50_Q9FZK2 Cluster: F17L21.12; n=13; Magnoliophyta|Rep: F17...    52   1e-05
UniRef50_A0D197 Cluster: Chromosome undetermined scaffold_34, wh...    52   1e-05
UniRef50_Q0IRG8 Cluster: Os11g0637400 protein; n=11; Liliopsida|...    51   2e-05
UniRef50_A3CD52 Cluster: Putative uncharacterized protein; n=2; ...    51   2e-05
UniRef50_Q7RG55 Cluster: Arabidopsis thaliana F17L21.12-related;...    50   4e-05
UniRef50_Q5CPN8 Cluster: Putative uncharacterized protein; n=1; ...    50   5e-05
UniRef50_A5KBT3 Cluster: Ribosome associated membrane protein RA...    49   9e-05
UniRef50_UPI0000E1FFEC Cluster: PREDICTED: similar to ribosome a...    48   2e-04
UniRef50_UPI0000D9E6A9 Cluster: PREDICTED: similar to ribosome a...    42   0.011
UniRef50_Q5ATU0 Cluster: Putative uncharacterized protein; n=1; ...    35   2.2  
UniRef50_Q553P6 Cluster: Putative uncharacterized protein; n=1; ...    34   2.9  
UniRef50_Q7MQL9 Cluster: Putative uncharacterized protein; n=1; ...    33   5.0  
UniRef50_A6DKY0 Cluster: Putative uncharacterized protein; n=1; ...    33   8.8  

>UniRef50_Q8SYY6 Cluster: RE27904p; n=8; Coelomata|Rep: RE27904p -
           Drosophila melanogaster (Fruit fly)
          Length = 64

 Score =  100 bits (240), Expect = 3e-20
 Identities = 45/56 (80%), Positives = 50/56 (89%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           MAP QRMR+ANE ASK +TMRGNVPK++K KE QYPV PWLLALFIFVVCGSA+FQ
Sbjct: 1   MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQ 56


>UniRef50_Q8MXH3 Cluster: Putative uncharacterized protein T09A12.5;
           n=2; Bilateria|Rep: Putative uncharacterized protein
           T09A12.5 - Caenorhabditis elegans
          Length = 63

 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 35/56 (62%), Positives = 43/56 (76%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           MAPKQRM +AN   SKN+T RGNVPK  K  E ++P + WL+ LFIFVVCGSA+F+
Sbjct: 1   MAPKQRMAVANAQFSKNVTQRGNVPKGNKTNESKFPTSQWLIGLFIFVVCGSAIFE 56


>UniRef50_Q7ZUJ1 Cluster: Zgc:56419; n=5; Euteleostomi|Rep:
           Zgc:56419 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 66

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 37/57 (64%), Positives = 47/57 (82%), Gaps = 1/57 (1%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTK-EKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           M  KQR+R+ANE  SKNIT+RGNV K+T+  +E++  V PWLLALF+FVVCGSA+FQ
Sbjct: 1   MVAKQRIRMANEKHSKNITLRGNVAKSTRGTQEEKAVVGPWLLALFVFVVCGSAIFQ 57


>UniRef50_Q9Y6X1 Cluster: Ribosome-attached membrane protein 4;
           n=33; Eumetazoa|Rep: Ribosome-attached membrane protein
           4 - Homo sapiens (Human)
          Length = 66

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 38/57 (66%), Positives = 45/57 (78%), Gaps = 1/57 (1%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQ 255
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQ 57


>UniRef50_Q238X7 Cluster: Ribosome associated membrane protein RAMP4
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Ribosome associated membrane protein RAMP4
           containing protein - Tetrahymena thermophila SB210
          Length = 107

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 26/53 (49%), Positives = 40/53 (75%)
 Frame = +1

Query: 97  KQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           KQ+M++ + + +KN+T RG VP + K KE++  V PW+L +F+FVV GSA+FQ
Sbjct: 48  KQQMKLKSNLHNKNVTNRGKVPSSLKSKEEK-SVGPWVLGIFLFVVVGSAIFQ 99


>UniRef50_Q5BTC1 Cluster: SJCHGC02042 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC02042 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 79

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/57 (45%), Positives = 37/57 (64%)
 Frame = +1

Query: 85  KMAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           +M+  QRM++ N  A  N+  RGNVPK+ K  + Q  +   +L L +FVVCGSAVF+
Sbjct: 14  RMSASQRMKVQNGKAHGNVVNRGNVPKSLKSSDSQSNMNACILGLIVFVVCGSAVFE 70


>UniRef50_A7QP46 Cluster: Chromosome chr1 scaffold_136, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_136, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 105

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 25/41 (60%), Positives = 31/41 (75%)
 Frame = +1

Query: 133 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           KNIT RG+VP+TT +K   YPV P LL  F+FVV GS++FQ
Sbjct: 54  KNITKRGSVPETTTKKGSDYPVGPVLLGFFVFVVIGSSLFQ 94


>UniRef50_Q9FZK2 Cluster: F17L21.12; n=13; Magnoliophyta|Rep:
           F17L21.12 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 77

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 24/41 (58%), Positives = 29/41 (70%)
 Frame = +1

Query: 133 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           KNI  RG VP+TT +K   YPV P LL  F+FVV GS++FQ
Sbjct: 26  KNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQ 66


>UniRef50_A0D197 Cluster: Chromosome undetermined scaffold_34, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_34,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 75

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/52 (44%), Positives = 35/52 (67%)
 Frame = +1

Query: 100 QRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           Q M++ ++    N+  +G VPK+  +KE+  PV P LL +F+FVV GSA+FQ
Sbjct: 13  QTMKLRSQNYQGNVNKQGKVPKSLIKKEENLPVGPILLGVFLFVVVGSALFQ 64


>UniRef50_Q0IRG8 Cluster: Os11g0637400 protein; n=11;
           Liliopsida|Rep: Os11g0637400 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 573

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/37 (62%), Positives = 28/37 (75%)
 Frame = +1

Query: 133 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGS 243
           KNIT RG+VP+TT +K + YPV P +L  FIFVV GS
Sbjct: 27  KNITKRGSVPETTVKKGNDYPVGPLVLGFFIFVVIGS 63


>UniRef50_A3CD52 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 460

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/37 (62%), Positives = 28/37 (75%)
 Frame = +1

Query: 133 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGS 243
           KNIT RG+VP+TT +K + YPV P +L  FIFVV GS
Sbjct: 17  KNITKRGSVPETTVKKGNDYPVGPLVLGFFIFVVIGS 53


>UniRef50_Q7RG55 Cluster: Arabidopsis thaliana F17L21.12-related;
           n=3; Plasmodium|Rep: Arabidopsis thaliana
           F17L21.12-related - Plasmodium yoelii yoelii
          Length = 67

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/56 (44%), Positives = 33/56 (58%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           MA  +++    E    NIT RGNVP +  +K  +Y V P LL +FIF+V GS V Q
Sbjct: 1   MASNRKINKKIETFDNNITNRGNVPTSIAKKGKKYTVGPILLGIFIFIVIGSVVIQ 56


>UniRef50_Q5CPN8 Cluster: Putative uncharacterized protein; n=1;
           Cryptosporidium parvum Iowa II|Rep: Putative
           uncharacterized protein - Cryptosporidium parvum Iowa II
          Length = 65

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 25/56 (44%), Positives = 36/56 (64%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           MA  +  ++  E+  KNI  RG+V  ++ +K+  YPV P+ L LFIFVV GSA+ Q
Sbjct: 1   MAQSRFTKLKGELYEKNIDKRGSV--SSSKKKSGYPVGPFALGLFIFVVIGSAIIQ 54


>UniRef50_A5KBT3 Cluster: Ribosome associated membrane protein
           RAMP4, putative; n=3; Plasmodium|Rep: Ribosome
           associated membrane protein RAMP4, putative - Plasmodium
           vivax
          Length = 102

 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 24/58 (41%), Positives = 34/58 (58%)
 Frame = +1

Query: 82  NKMAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           +KMA  +++         NIT RGNVP +  +K  ++PV P LL +F+FVV GS   Q
Sbjct: 33  SKMASNRKISQKINAFDNNITHRGNVPASLVKKGKKHPVGPILLVIFVFVVIGSVFIQ 90


>UniRef50_UPI0000E1FFEC Cluster: PREDICTED: similar to ribosome
           attached membrane protein 4; n=1; Pan troglodytes|Rep:
           PREDICTED: similar to ribosome attached membrane protein
           4 - Pan troglodytes
          Length = 231

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 160 PKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           P+     E++  V PWLLALFIFVVCGSA+FQ
Sbjct: 191 PRPRNAPEEKASVGPWLLALFIFVVCGSAIFQ 222


>UniRef50_UPI0000D9E6A9 Cluster: PREDICTED: similar to ribosome
           associated membrane protein 4; n=1; Macaca mulatta|Rep:
           PREDICTED: similar to ribosome associated membrane
           protein 4 - Macaca mulatta
          Length = 177

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 20/30 (66%), Positives = 23/30 (76%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKE 177
           M  KQR+R+ANE  SKNIT RGNV KT K+
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTLKK 30


>UniRef50_Q5ATU0 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 78

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYP-VAPWLLALFIFVVCGSAVFQ 255
           M    + R ANE  +K+   +   PKTT  K +  P ++   + L  FVVCG  VF+
Sbjct: 1   MTQTPQQRRANEKFAKHEASKRGKPKTTTTKHNTKPSLSTGWVVLLAFVVCGGLVFE 57


>UniRef50_Q553P6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 59

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 19/56 (33%), Positives = 31/56 (55%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           M+  + +R  ++   +NI  RG    + K+KED   + P++L   IFVV GS + Q
Sbjct: 1   MSQSRTLRQKSQKYQENIEKRGVA--SPKKKEDGLNINPYVLGFIIFVVVGSTLLQ 54


>UniRef50_Q7MQL9 Cluster: Putative uncharacterized protein; n=1;
           Wolinella succinogenes|Rep: Putative uncharacterized
           protein - Wolinella succinogenes
          Length = 377

 Score = 33.5 bits (73), Expect = 5.0
 Identities = 14/27 (51%), Positives = 16/27 (59%)
 Frame = -3

Query: 260 DYWNTAEPHTTKMKRARSQGATGYWSS 180
           DY N  E H  KMK   S+G  GYWS+
Sbjct: 80  DYVNGIEFHDKKMKEIASKGVAGYWSA 106


>UniRef50_A6DKY0 Cluster: Putative uncharacterized protein; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Putative
           uncharacterized protein - Lentisphaera araneosa HTCC2155
          Length = 332

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 1/42 (2%)
 Frame = +2

Query: 254 NNPINKT-SLNHEDNWRTAIENTIK*QHYPSKVRHNLHQHLF 376
           NN INK  +L+   N   A    IK Q    K  HNLH+H F
Sbjct: 125 NNKINKLLALSKSSNQHEATNAAIKAQALMDKYNHNLHEHNF 166


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 672,773,709
Number of Sequences: 1657284
Number of extensions: 13465136
Number of successful extensions: 30601
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 29759
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30593
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54545459628
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -