SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20032
         (730 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A6BM65 Cluster: Cytochrome oxidase subunit I; n=1; Peri...    94   4e-18
UniRef50_Q4FH11 Cluster: Cytochrome c oxidase subunit I; n=26; B...    87   5e-16
UniRef50_Q30DC3 Cluster: Cytochrome c oxidase subunit I; n=30; P...    87   5e-16
UniRef50_Q58PB7 Cluster: Cytochrome c oxidase subunit I; n=106; ...    75   2e-12
UniRef50_Q9MCX7 Cluster: Cytochrome c oxidase subunit I; n=181; ...    74   4e-12
UniRef50_P60620 Cluster: Cytochrome c oxidase subunit 1; n=2931;...    74   4e-12
UniRef50_Q9MLW1 Cluster: Cytochrome c oxidase subunit I; n=5; Na...    73   7e-12
UniRef50_Q0H8Y3 Cluster: Probable intron-encoded endonuclease aI...    73   1e-11
UniRef50_A2T435 Cluster: Cytochrome c oxidase subunit I; n=126; ...    71   2e-11
UniRef50_Q8SK39 Cluster: Cytochrome c oxidase subunit I; n=455; ...    71   4e-11
UniRef50_Q6ZLV6 Cluster: Cytochrome c oxidase subunit I; n=941; ...    71   4e-11
UniRef50_Q5GGF4 Cluster: Cytochrome c oxidase subunit I; n=2742;...    71   4e-11
UniRef50_Q9MIY8 Cluster: Cytochrome c oxidase subunit 1; n=861; ...    71   4e-11
UniRef50_Q9ZZX1 Cluster: Intron-encoded DNA endonuclease aI5 alp...    70   5e-11
UniRef50_P03878 Cluster: Intron-encoded DNA endonuclease aI4 pre...    70   5e-11
UniRef50_P48866 Cluster: Cytochrome c oxidase subunit 1; n=179; ...    70   5e-11
UniRef50_P00395 Cluster: Cytochrome c oxidase subunit 1; n=44498...    70   7e-11
UniRef50_Q0H8Y1 Cluster: Probable intron-encoded endonuclease aI...    69   9e-11
UniRef50_Q0H8Y0 Cluster: Probable intron-encoded endonuclease aI...    69   9e-11
UniRef50_Q7YEU6 Cluster: Endonuclease; n=4; Fungi/Metazoa group|...    69   1e-10
UniRef50_Q8M352 Cluster: I-SceII DNA endonuclease-like protein; ...    68   3e-10
UniRef50_Q28SZ5 Cluster: Cytochrome-c oxidase; n=50; cellular or...    67   4e-10
UniRef50_Q59IQ0 Cluster: Cytochrome c oxidase subunit I; n=1; Wa...    66   1e-09
UniRef50_A7UG06 Cluster: Cytochrome oxidase subunits 1 and 2 pol...    64   3e-09
UniRef50_Q951H1 Cluster: Cytochrome c oxidase subunit I; n=388; ...    64   4e-09
UniRef50_Q9G8S1 Cluster: Cytochrome c oxidase subunit 1; n=1; Na...    64   4e-09
UniRef50_Q1NET5 Cluster: Cytochrome-c oxidase; n=3; Alphaproteob...    62   2e-08
UniRef50_Q1XA94 Cluster: Cytochrome c oxidase subunit I; n=825; ...    62   2e-08
UniRef50_Q6ED53 Cluster: Cox1-i5 protein; n=2; Candida stellata|...    61   2e-08
UniRef50_Q6ED52 Cluster: Cox1-i4 protein; n=1; Candida stellata|...    61   2e-08
UniRef50_Q6ED51 Cluster: Cox-i3 protein; n=1; Candida stellata|R...    61   2e-08
UniRef50_Q6ED50 Cluster: Cox-i2 protein; n=1; Candida stellata|R...    61   2e-08
UniRef50_Q3L2S5 Cluster: Cytochrome c oxidase subunit I; n=1; Ae...    60   4e-08
UniRef50_A1XI88 Cluster: Cytochrome c oxidase subunit I; n=1; My...    59   1e-07
UniRef50_Q8SHP5 Cluster: Cytochrome c oxidase subunit I; n=15; F...    59   1e-07
UniRef50_Q9B6E6 Cluster: COX1-i5 protein; n=3; Fungi/Metazoa gro...    58   2e-07
UniRef50_P14544 Cluster: Cytochrome c oxidase subunit 1; n=7; Eu...    56   9e-07
UniRef50_Q0H8X8 Cluster: Probable intron-encoded endonuclease aI...    53   6e-06
UniRef50_Q9B8X8 Cluster: Cytochrome c oxidase subunit I; n=517; ...    52   1e-05
UniRef50_Q35061 Cluster: CoxI intron4 ORF; n=3; Marchantia polym...    51   3e-05
UniRef50_Q8HCX2 Cluster: Cytochrome c oxidase subunit I; n=1; Ap...    50   4e-05
UniRef50_O47573 Cluster: Cytochrome c oxidase subunit I; n=42; N...    50   4e-05
UniRef50_Q5W914 Cluster: Cytochrome c oxidase subunit I; n=9; Co...    49   1e-04
UniRef50_A6XEV4 Cluster: Cytochrome c oxidase subunit 1; n=1; Mu...    48   3e-04
UniRef50_Q7YI87 Cluster: Cytochrome oxidase subunit I; n=1; Cela...    47   4e-04
UniRef50_Q9XKD7 Cluster: Cytochrome c oxidase subunit I; n=1; Di...    45   0.002
UniRef50_O67935 Cluster: Cytochrome c oxidase subunit I; n=1; Aq...    44   0.003
UniRef50_Q02766 Cluster: Cytochrome c oxidase subunit 1; n=107; ...    44   0.003
UniRef50_Q9B6E4 Cluster: COX1-i3 protein; n=2; Yarrowia lipolyti...    42   0.015
UniRef50_Q36097 Cluster: Cytochrome c oxidase subunit 1; n=3; Th...    41   0.036
UniRef50_Q98P35 Cluster: Cytochrome C oxidase subunit I; n=16; c...    40   0.047
UniRef50_O99652 Cluster: Cytochrome c oxidase subunit I; n=1; Te...    40   0.082
UniRef50_Q1CZF1 Cluster: Cytochrome c oxidase, subunit I; n=1; M...    39   0.14 
UniRef50_Q0I8U1 Cluster: Cytochrome c oxidase subunit I; n=16; B...    39   0.14 
UniRef50_Q18JR5 Cluster: Cytochrome-c-like terminal oxidase, sub...    39   0.14 
UniRef50_Q85HI4 Cluster: Cytochrome c oxidase subunit I; n=7; Ec...    38   0.19 
UniRef50_Q06473 Cluster: Cytochrome c oxidase subunit 1 (EC 1.9....    38   0.19 
UniRef50_A7H8L4 Cluster: Cytochrome c oxidase subunit I type; n=...    38   0.33 
UniRef50_A7BSH8 Cluster: Cytochrome c oxidase aa3, subunit 1; n=...    38   0.33 
UniRef50_A6C5X9 Cluster: Cytochrome caa3 oxidase; n=3; Bacteria|...    38   0.33 
UniRef50_A0RZ19 Cluster: Heme/copper-type cytochrome/quinol oxid...    38   0.33 
UniRef50_Q34463 Cluster: Cytochrome oxidase subunit I; n=3; Eugl...    37   0.58 
UniRef50_Q5K464 Cluster: Putative DNA endonuclease; n=1; Kluyver...    37   0.58 
UniRef50_P33518 Cluster: Cytochrome c oxidase polypeptide 1; n=4...    37   0.58 
UniRef50_Q6XYE8 Cluster: Cytochrome c oxidase subunit I; n=2; En...    36   1.0  
UniRef50_P11947 Cluster: Cytochrome c oxidase subunit 1; n=48; O...    36   1.3  
UniRef50_A7HEB5 Cluster: Cytochrome-c oxidase; n=2; Cystobacteri...    35   2.3  
UniRef50_A4WT83 Cluster: Cytochrome c, monohaem; n=3; Rhodobacte...    35   2.3  
UniRef50_A0TRU9 Cluster: Cytochrome-c oxidase; n=30; Proteobacte...    35   2.3  
UniRef50_Q94WV3 Cluster: Cytochrome oxidase subunit I; n=1; Pach...    35   2.3  
UniRef50_P98005 Cluster: Cytochrome c oxidase polypeptide I+III ...    34   4.1  
UniRef50_A7QNM5 Cluster: Chromosome undetermined scaffold_133, w...    33   5.4  
UniRef50_A5UVJ0 Cluster: Cytochrome-c oxidase; n=2; Roseiflexus|...    33   7.2  
UniRef50_Q5ABE2 Cluster: Putative uncharacterized protein CLN3; ...    33   9.5  
UniRef50_Q79VD7 Cluster: Cytochrome c oxidase subunit 1; n=93; A...    33   9.5  
UniRef50_P24010 Cluster: Cytochrome c oxidase subunit 1 (EC 1.9....    33   9.5  

>UniRef50_A6BM65 Cluster: Cytochrome oxidase subunit I; n=1;
           Periclimenes thermohydrophilus|Rep: Cytochrome oxidase
           subunit I - Periclimenes thermohydrophilus
          Length = 217

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 51/93 (54%), Positives = 58/93 (62%)
 Frame = -1

Query: 292 KGGG*ESKSYIIYRGNAISGAPSIRGTNQFPNPPXXXXXXXXXXXXKACAVTIVL*I*SS 113
           K GG      +  RGNA+SGAP++ GTNQFPNPP            KA AVT+ L I S 
Sbjct: 126 KEGGSNQNLMLFIRGNAMSGAPNMSGTNQFPNPPIMIGMTMKKIITKAWAVTMTL-IWSF 184

Query: 112 PINDPGFPNSARIKSLKDVPIIPDQIPKIKYNV 14
           PI  PG PNSARIKSL DVP +P   PK+KYNV
Sbjct: 185 PIKLPGCPNSARIKSLSDVPTMPAHAPKMKYNV 217



 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 39/63 (61%), Positives = 46/63 (73%)
 Frame = -2

Query: 435 DEIPAKCSEKIARSTDLPLCAILDESGG*TVHPVPAPFSTILLEINNIREGGRSQNLILF 256
           +E PAKC+EKI  STD P CAI   SGG TVHPVP P STI L  + ++EGG +QNL+LF
Sbjct: 78  EETPAKCNEKIPMSTDAPACAIPLASGGYTVHPVPTPLSTIPLNKSKVKEGGSNQNLMLF 137

Query: 255 IVG 247
           I G
Sbjct: 138 IRG 140



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 34/54 (62%), Positives = 41/54 (75%)
 Frame = -3

Query: 656 YKIGSPPPAGSKNDVFKFRSVNNIVIAPAKTGSDNNNKNAVIPTAHTNKVIDQM 495
           + IGSPPPAGSK +VFKFRSV +IVIAPA TGS++N+K AV  T  TN  +  M
Sbjct: 4   WSIGSPPPAGSKKEVFKFRSVKSIVIAPASTGSESNSKMAVSNTDQTNSGMRSM 57


>UniRef50_Q4FH11 Cluster: Cytochrome c oxidase subunit I; n=26;
           Bilateria|Rep: Cytochrome c oxidase subunit I - Samia
           cynthia ricini (Indian eri silkmoth)
          Length = 510

 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 47/88 (53%), Positives = 50/88 (56%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ F              IVENGAGTG TVYPPLSSNIAH G SVDLAIFSLHLAG
Sbjct: 92  PRMNNMSFWLLPPSLTLLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAG 151

Query: 428 ISSXXXXXXXXXXXXXXXXXXXSFDQLP 511
           ISS                   SFDQ+P
Sbjct: 152 ISSILGAINFITTIINMRMNNLSFDQMP 179



 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 41/57 (71%), Positives = 44/57 (77%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV AVGITAF         AGAIT+LLTDRNLNTSFFDPAGGGDPILY H++  FG
Sbjct: 180 LFVWAVGITAFLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFG 236



 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 45/95 (47%), Positives = 48/95 (50%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXX 188
           +GTLY                   AELG PGSLIGDDQIYNTIVTAHA            
Sbjct: 12  IGTLYFIFGIWAGMVGTSLSLLIRAELGTPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIM 71

Query: 189 XXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPL 293
                N LVPL+LGAPD+AFPR     F   PP L
Sbjct: 72  IGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSL 106


>UniRef50_Q30DC3 Cluster: Cytochrome c oxidase subunit I; n=30;
           Panarthropoda|Rep: Cytochrome c oxidase subunit I -
           Pagyris cymothoe
          Length = 487

 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 47/88 (53%), Positives = 50/88 (56%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ F              IVENGAGTG TVYPPLSSNIAH G SVDLAIFSLHLAG
Sbjct: 68  PRMNNMSFWLLPPSLILLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAG 127

Query: 428 ISSXXXXXXXXXXXXXXXXXXXSFDQLP 511
           ISS                   SFDQ+P
Sbjct: 128 ISSILGAINFITTIINMRINKMSFDQMP 155



 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 39/57 (68%), Positives = 43/57 (75%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LF+ AVGITA          AGAIT+LLTDRNLNTSFFDPAGGGDPILY H++  FG
Sbjct: 156 LFIWAVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFG 212



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 39/70 (55%), Positives = 42/70 (60%)
 Frame = +3

Query: 84  ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR*II 263
           ELG PGSLIGDDQIYNTIVTAHA                 N L+PL+LGAPD+AFPR   
Sbjct: 13  ELGTPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLIPLMLGAPDMAFPRMNN 72

Query: 264 *DFDSYPPPL 293
             F   PP L
Sbjct: 73  MSFWLLPPSL 82


>UniRef50_Q58PB7 Cluster: Cytochrome c oxidase subunit I; n=106;
           Bilateria|Rep: Cytochrome c oxidase subunit I -
           Homalopoma maculosa
          Length = 219

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 37/63 (58%), Positives = 41/63 (65%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ F               VE+GAGTG TVYPPLS N AH G SVDLAIFSLHLAG
Sbjct: 78  PRLNNMSFWFLPPSLSLLLMSAAVESGAGTGWTVYPPLSGNTAHAGPSVDLAIFSLHLAG 137

Query: 428 ISS 436
           +SS
Sbjct: 138 VSS 140



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 35/53 (66%), Positives = 39/53 (73%), Gaps = 1/53 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIY 666
           LFV +V ITA          AGAIT+LLTDRN NTSFFDPAGGGDPILY H++
Sbjct: 166 LFVWSVKITAILLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPILYQHLF 218



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 35/70 (50%), Positives = 40/70 (57%)
 Frame = +3

Query: 84  ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR*II 263
           ELG PGS IG+DQ+YN +VTAHA                 N LVPL+LGAPD+AFPR   
Sbjct: 23  ELGQPGSFIGNDQLYNVVVTAHAFVMIFFLVMPMMIGGFGNWLVPLMLGAPDMAFPRLNN 82

Query: 264 *DFDSYPPPL 293
             F   PP L
Sbjct: 83  MSFWFLPPSL 92


>UniRef50_Q9MCX7 Cluster: Cytochrome c oxidase subunit I; n=181;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Piculus
           rubiginosus
          Length = 504

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 38/63 (60%), Positives = 42/63 (66%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ F               VE GAGTG TVYPPL+ N+AH G SVDLAIFSLHLAG
Sbjct: 96  PRMNNMSFWLXPPSFLLLLASSTVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFSLHLAG 155

Query: 428 ISS 436
           ISS
Sbjct: 156 ISS 158



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 37/82 (45%), Positives = 43/82 (52%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXX 188
           +GTLY                   AELG PG+L+GDDQIYN IVTAHA            
Sbjct: 16  IGTLYLIFGAWAGMIGTALSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIM 75

Query: 189 XXXXXN*LVPLILGAPDIAFPR 254
                N LVPL++GAPD+AFPR
Sbjct: 76  IGGFGNWLVPLMIGAPDMAFPR 97



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV +V ITA          A  IT+LLTDRNLNT+FFDPAGGGDPILY H++  FG
Sbjct: 184 LFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFG 240


>UniRef50_P60620 Cluster: Cytochrome c oxidase subunit 1; n=2931;
           cellular organisms|Rep: Cytochrome c oxidase subunit 1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 527

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 36/57 (63%), Positives = 42/57 (73%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV +V +TAF         AGAIT+LLTDRN NT+FFDPAGGGDPILY H++  FG
Sbjct: 186 LFVWSVLVTAFLLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFG 242



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 33/63 (52%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NNI F              +VE G+GTG TVYPPLS   +H G +VDLAIFSLHL+G
Sbjct: 98  PRLNNISFWLLPPSLLLLLSSALVEVGSGTGWTVYPPLSGITSHSGGAVDLAIFSLHLSG 157

Query: 428 ISS 436
           +SS
Sbjct: 158 VSS 160



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 32/97 (32%), Positives = 41/97 (42%), Gaps = 2/97 (2%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLI--GDDQIYNTIVTAHAXXXXXXXXXX 182
           +GTLY                    EL  PG  I  G+ Q+YN ++TAHA          
Sbjct: 16  IGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMP 75

Query: 183 XXXXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPL 293
                  N  VP+++GAPD+AFPR     F   PP L
Sbjct: 76  AMIGGFGNWFVPILIGAPDMAFPRLNNISFWLLPPSL 112


>UniRef50_Q9MLW1 Cluster: Cytochrome c oxidase subunit I; n=5;
           Naupactini|Rep: Cytochrome c oxidase subunit I -
           Galapaganus collaris
          Length = 406

 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 37/57 (64%), Positives = 41/57 (71%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV AV ITA          AGAIT+LLTDRN+NTSFFDPAGGGDPILY H++   G
Sbjct: 102 LFVWAVEITAILLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLFWFXG 158



 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 31/40 (77%), Positives = 34/40 (85%)
 Frame = +2

Query: 317 VENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 436
           VE GAGTG TV PPLS+NIAH G SVDLAIFSLH+AG+ S
Sbjct: 37  VEKGAGTGWTVSPPLSANIAHEGSSVDLAIFSLHMAGVXS 76


>UniRef50_Q0H8Y3 Cluster: Probable intron-encoded endonuclease aI8
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI8 (EC
           3.1.-.-)]; n=103; Eukaryota|Rep: Probable intron-encoded
           endonuclease aI8 precursor [Contains: Truncated
           non-functional cytochrome oxidase 1; Intron-encoded
           endonuclease aI8 (EC 3.1.-.-)] - Ustilago maydis (Smut
           fungus)
          Length = 645

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 35/57 (61%), Positives = 41/57 (71%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV A+ +TA          AGAIT+LLTDRN NTSF+DPAGGGDPILY H++  FG
Sbjct: 183 LFVWAIFVTAILLLLSLPVLAGAITMLLTDRNFNTSFYDPAGGGDPILYQHLFWFFG 239



 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 36/63 (57%), Positives = 39/63 (61%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NNI F               VE GAGTG TVYPPLS   +H G SVDLAIFSLHL+G
Sbjct: 95  PRLNNISFWLLPPSLILLLASAFVEQGAGTGWTVYPPLSGLQSHSGGSVDLAIFSLHLSG 154

Query: 428 ISS 436
           ISS
Sbjct: 155 ISS 157



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 35/97 (36%), Positives = 42/97 (43%), Gaps = 2/97 (2%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXX 182
           +GTLY                    EL  PG   L GD Q+YN I+TAHA          
Sbjct: 13  IGTLYLIFAVFAAMIGTAFSVLIRMELAAPGVQYLNGDHQLYNVIITAHAFVMIFFMVMP 72

Query: 183 XXXXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPL 293
                  N LVP+++GAPD+AFPR     F   PP L
Sbjct: 73  AMVGGFGNYLVPVMIGAPDMAFPRLNNISFWLLPPSL 109


>UniRef50_A2T435 Cluster: Cytochrome c oxidase subunit I; n=126;
           Fungi/Metazoa group|Rep: Cytochrome c oxidase subunit I
           - Placozoan sp. BZ2423
          Length = 498

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 36/63 (57%), Positives = 41/63 (65%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NNI F              +VE GAGTG TVYPPL+S  AH G SVD+AIFSLHLAG
Sbjct: 96  PRLNNISFWLLPPALFLLLGSSLVEQGAGTGWTVYPPLASIQAHSGGSVDMAIFSLHLAG 155

Query: 428 ISS 436
           +SS
Sbjct: 156 LSS 158



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV +V ITA          AGAIT+LLTDR  NT+FFDPAGGGDPILY H++  FG
Sbjct: 184 LFVWSVLITAILLLLSLPVLAGAITMLLTDRYFNTTFFDPAGGGDPILYQHLFWFFG 240



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 35/96 (36%), Positives = 45/96 (46%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXX 188
           +G+LY                    EL +PGS++GDD +YN IVTAHA            
Sbjct: 16  IGSLYLVFGALSGAIGTAFSMLIRLELSSPGSMLGDDHLYNVIVTAHAFVMIFFLVMPTM 75

Query: 189 XXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPLY 296
                N  VPL++GAPD+AFPR     F   PP L+
Sbjct: 76  IGGFGNWFVPLMIGAPDMAFPRLNNISFWLLPPALF 111


>UniRef50_Q8SK39 Cluster: Cytochrome c oxidase subunit I; n=455;
           cellular organisms|Rep: Cytochrome c oxidase subunit I -
           Pandaka lidwilli
          Length = 507

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 35/63 (55%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ F               +E GAGTG TVYPPL+ N+AH G SVDL IFSLHLAG
Sbjct: 84  PRMNNMSFWLLPPSFLLLLASSGIEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAG 143

Query: 428 ISS 436
           ISS
Sbjct: 144 ISS 146



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 35/82 (42%), Positives = 42/82 (51%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXX 188
           +GTLY                   AEL  PG+L+GDDQIYN IVTAHA            
Sbjct: 4   IGTLYLIFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPIM 63

Query: 189 XXXXXN*LVPLILGAPDIAFPR 254
                N L+PL++GAPD+AFPR
Sbjct: 64  IGGFGNWLIPLMIGAPDMAFPR 85



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/40 (60%), Positives = 26/40 (65%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDP 630
           LFV AV ITA          A  IT+LLTDRNLNT+FFDP
Sbjct: 172 LFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDP 211


>UniRef50_Q6ZLV6 Cluster: Cytochrome c oxidase subunit I; n=941;
           Eukaryota|Rep: Cytochrome c oxidase subunit I -
           Ophisurus macrorhynchos
          Length = 546

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 35/63 (55%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ F               VE GAGTG TVYPPL+ N+AH G SVDL IFSLHLAG
Sbjct: 95  PRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAG 154

Query: 428 ISS 436
           +SS
Sbjct: 155 VSS 157



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 36/82 (43%), Positives = 42/82 (51%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXX 188
           +GTLY                   AEL  PG+L+GDDQIYN IVTAHA            
Sbjct: 15  IGTLYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPVM 74

Query: 189 XXXXXN*LVPLILGAPDIAFPR 254
                N LVPL++GAPD+AFPR
Sbjct: 75  IGGFGNWLVPLMIGAPDMAFPR 96



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 34/57 (59%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV +V +TA          A  IT+LLTDRNLNT+FFDPAGGGDPILY H++  FG
Sbjct: 183 LFVWSVLVTAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFG 239


>UniRef50_Q5GGF4 Cluster: Cytochrome c oxidase subunit I; n=2742;
           Bilateria|Rep: Cytochrome c oxidase subunit I - Cotesia
           melitaearum (Parasitoid wasp)
          Length = 499

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 35/57 (61%), Positives = 41/57 (71%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LF  +V ITA          AGAIT+LLTDRN+NTSFFDP+GGGDPILY H++  FG
Sbjct: 167 LFSWSVFITAILLLLSLPVLAGAITMLLTDRNMNTSFFDPSGGGDPILYQHLFWFFG 223



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 30/57 (52%), Positives = 38/57 (66%)
 Frame = +3

Query: 84  ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           ELG PGSLIG+DQIYN+IVT+HA                 N L+PL+LG+PD++FPR
Sbjct: 24  ELGMPGSLIGNDQIYNSIVTSHAFIMIFFMVMPVMIGGFGNWLIPLMLGSPDMSFPR 80



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 31/63 (49%), Positives = 35/63 (55%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ F               +  G GTG TVYPPLS  + H G SVDL IFSLHLAG
Sbjct: 79  PRMNNMSFWLLIPSLLLLILSMFINVGVGTGWTVYPPLSLILGHGGMSVDLGIFSLHLAG 138

Query: 428 ISS 436
            SS
Sbjct: 139 ASS 141


>UniRef50_Q9MIY8 Cluster: Cytochrome c oxidase subunit 1; n=861;
           root|Rep: Cytochrome c oxidase subunit 1 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 516

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 35/63 (55%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ F               VE GAGTG TVYPPL+ N+AH G SVDL IFSLHLAG
Sbjct: 95  PRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAG 154

Query: 428 ISS 436
           +SS
Sbjct: 155 VSS 157



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV AV +TA          A  IT+LLTDRNLNT+FFDPAGGGDPILY H++  FG
Sbjct: 183 LFVWAVLVTAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFG 239



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 36/82 (43%), Positives = 42/82 (51%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXX 188
           +GTLY                   AEL  PG+L+GDDQIYN IVTAHA            
Sbjct: 15  IGTLYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPIL 74

Query: 189 XXXXXN*LVPLILGAPDIAFPR 254
                N LVPL++GAPD+AFPR
Sbjct: 75  IGGFGNWLVPLMIGAPDMAFPR 96


>UniRef50_Q9ZZX1 Cluster: Intron-encoded DNA endonuclease aI5 alpha
           precursor (DNA endonuclease I-SceIV) [Contains:
           Truncated non-functional cytochrome oxidase 1; DNA
           endonuclease aI5 alpha (EC 3.1.-.-) (Intron-encoded
           endonuclease I- SceIV)]; n=2; Saccharomycetales|Rep:
           Intron-encoded DNA endonuclease aI5 alpha precursor (DNA
           endonuclease I-SceIV) [Contains: Truncated
           non-functional cytochrome oxidase 1; DNA endonuclease
           aI5 alpha (EC 3.1.-.-) (Intron-encoded endonuclease I-
           SceIV)] - Saccharomyces cerevisiae (Baker's yeast)
          Length = 630

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 37/63 (58%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P INNI F              +VE+GAGTG TVYPPLSS  AH G SVDLAIF+LHL  
Sbjct: 96  PRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTS 155

Query: 428 ISS 436
           ISS
Sbjct: 156 ISS 158



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 30/57 (52%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV ++ ITAF         +  IT+LL DRN NTSFF+ +GGGDPILY H++  FG
Sbjct: 184 LFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFG 240



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
 Frame = +3

Query: 84  ELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL  PGS  L G+ Q++N +V  HA                 N L+PL++GA D AFPR
Sbjct: 39  ELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPR 97


>UniRef50_P03878 Cluster: Intron-encoded DNA endonuclease aI4
           precursor (DNA endonuclease I- SceII) [Contains:
           Truncated non-functional cytochrome oxidase 1; DNA
           endonuclease aI4 (EC 3.1.-.-) (Intron-encoded
           endonuclease I-SceII)]; n=4; Saccharomycetales|Rep:
           Intron-encoded DNA endonuclease aI4 precursor (DNA
           endonuclease I- SceII) [Contains: Truncated
           non-functional cytochrome oxidase 1; DNA endonuclease
           aI4 (EC 3.1.-.-) (Intron-encoded endonuclease I-SceII)]
           - Saccharomyces cerevisiae (Baker's yeast)
          Length = 556

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 37/63 (58%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P INNI F              +VE+GAGTG TVYPPLSS  AH G SVDLAIF+LHL  
Sbjct: 96  PRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTS 155

Query: 428 ISS 436
           ISS
Sbjct: 156 ISS 158



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 30/57 (52%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV ++ ITAF         +  IT+LL DRN NTSFF+ +GGGDPILY H++  FG
Sbjct: 184 LFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFG 240



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
 Frame = +3

Query: 84  ELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL  PGS  L G+ Q++N +V  HA                 N L+PL++GA D AFPR
Sbjct: 39  ELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPR 97


>UniRef50_P48866 Cluster: Cytochrome c oxidase subunit 1; n=179;
           cellular organisms|Rep: Cytochrome c oxidase subunit 1 -
           Chondrus crispus (Carragheen)
          Length = 532

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 34/57 (59%), Positives = 41/57 (71%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV ++ +TAF         AGAIT+LLTDRN NTSFFD +GGGDPILY H++  FG
Sbjct: 191 LFVWSILVTAFLLLLAVPVLAGAITMLLTDRNFNTSFFDASGGGDPILYQHLFWFFG 247



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 33/63 (52%), Positives = 39/63 (61%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NNI F              +VE G GTG TVYPPLSS  +H G +VDLAIFSLH++G
Sbjct: 103 PRLNNISFWLLPPSLCLLLMSALVEVGVGTGWTVYPPLSSIQSHSGGAVDLAIFSLHISG 162

Query: 428 ISS 436
            SS
Sbjct: 163 ASS 165



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 32/97 (32%), Positives = 43/97 (44%), Gaps = 2/97 (2%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXX 182
           +GTLY                    EL  P +  L+G+ QIYN ++TAHA          
Sbjct: 21  IGTLYLIFGAFSGVLGGCMSMLIRMELAQPSNHLLLGNHQIYNVLITAHAFLMIFFMVMP 80

Query: 183 XXXXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPL 293
                  N LVP+++G+PD+AFPR     F   PP L
Sbjct: 81  VMIGGFGNWLVPIMIGSPDMAFPRLNNISFWLLPPSL 117


>UniRef50_P00395 Cluster: Cytochrome c oxidase subunit 1; n=44498;
           root|Rep: Cytochrome c oxidase subunit 1 - Homo sapiens
           (Human)
          Length = 513

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 34/63 (53%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG
Sbjct: 95  PRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAG 154

Query: 428 ISS 436
           +SS
Sbjct: 155 VSS 157



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV +V ITA          A  IT+LLTDRNLNT+FFDPAGGGDPILY H++  FG
Sbjct: 183 LFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFG 239



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 39/95 (41%), Positives = 46/95 (48%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXX 188
           +GTLY                   AELG PG+L+G+D IYN IVTAHA            
Sbjct: 15  IGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIM 74

Query: 189 XXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPL 293
                N LVPL++GAPD+AFPR     F   PP L
Sbjct: 75  IGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSL 109


>UniRef50_Q0H8Y1 Cluster: Probable intron-encoded endonuclease aI5
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI5 (EC
           3.1.-.-)]; n=2; Ustilago maydis|Rep: Probable
           intron-encoded endonuclease aI5 precursor [Contains:
           Truncated non-functional cytochrome oxidase 1;
           Intron-encoded endonuclease aI5 (EC 3.1.-.-)] - Ustilago
           maydis (Smut fungus)
          Length = 536

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 36/63 (57%), Positives = 39/63 (61%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NNI F               VE GAGTG TVYPPLS   +H G SVDLAIFSLHL+G
Sbjct: 95  PRLNNISFWLLPPSLILLLASAFVEQGAGTGWTVYPPLSGLQSHSGGSVDLAIFSLHLSG 154

Query: 428 ISS 436
           ISS
Sbjct: 155 ISS 157



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 33/53 (62%), Positives = 39/53 (73%), Gaps = 1/53 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIY 666
           LFV A+ +TA          AGAIT+LLTDRN NTSF+DPAGGGDPILY H++
Sbjct: 183 LFVWAIFVTAILLLLSLPVLAGAITMLLTDRNFNTSFYDPAGGGDPILYQHLF 235



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 35/97 (36%), Positives = 42/97 (43%), Gaps = 2/97 (2%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXX 182
           +GTLY                    EL  PG   L GD Q+YN I+TAHA          
Sbjct: 13  IGTLYLIFAVFAAMIGTAFSVLIRMELAAPGVQYLNGDHQLYNVIITAHAFVMIFFMVMP 72

Query: 183 XXXXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPL 293
                  N LVP+++GAPD+AFPR     F   PP L
Sbjct: 73  AMVGGFGNYLVPVMIGAPDMAFPRLNNISFWLLPPSL 109


>UniRef50_Q0H8Y0 Cluster: Probable intron-encoded endonuclease aI4
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI4 (EC
           3.1.-.-)]; n=3; Basidiomycota|Rep: Probable
           intron-encoded endonuclease aI4 precursor [Contains:
           Truncated non-functional cytochrome oxidase 1;
           Intron-encoded endonuclease aI4 (EC 3.1.-.-)] - Ustilago
           maydis (Smut fungus)
          Length = 530

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 36/63 (57%), Positives = 39/63 (61%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NNI F               VE GAGTG TVYPPLS   +H G SVDLAIFSLHL+G
Sbjct: 95  PRLNNISFWLLPPSLILLLASAFVEQGAGTGWTVYPPLSGLQSHSGGSVDLAIFSLHLSG 154

Query: 428 ISS 436
           ISS
Sbjct: 155 ISS 157



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 35/97 (36%), Positives = 42/97 (43%), Gaps = 2/97 (2%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXX 182
           +GTLY                    EL  PG   L GD Q+YN I+TAHA          
Sbjct: 13  IGTLYLIFAVFAAMIGTAFSVLIRMELAAPGVQYLNGDHQLYNVIITAHAFVMIFFMVMP 72

Query: 183 XXXXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPL 293
                  N LVP+++GAPD+AFPR     F   PP L
Sbjct: 73  AMVGGFGNYLVPVMIGAPDMAFPRLNNISFWLLPPSL 109


>UniRef50_Q7YEU6 Cluster: Endonuclease; n=4; Fungi/Metazoa
           group|Rep: Endonuclease - Saccharomyces servazzii
           (Yeast)
          Length = 675

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 37/63 (58%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P IN+I F              +VE+GAGTG TVYPPLSS  AH G SVDLAIFSLHL  
Sbjct: 96  PRINSIGFWLLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFSLHLTS 155

Query: 428 ISS 436
           ISS
Sbjct: 156 ISS 158



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 31/57 (54%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV A+ ITAF         +  IT+LL DRN NTSFF+ AGGGDPI Y H +  FG
Sbjct: 184 LFVWAIFITAFLLLLSLPVLSAGITMLLMDRNFNTSFFEVAGGGDPIFYQHAFWFFG 240



 Score = 40.3 bits (90), Expect = 0.047
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +3

Query: 84  ELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL  PGS  L G+ Q++N +V  HA                 N ++PL++GA D++FPR
Sbjct: 39  ELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLAMPALIGGFGNYMLPLMIGATDMSFPR 97


>UniRef50_Q8M352 Cluster: I-SceII DNA endonuclease-like protein;
           n=1; Saccharomyces castellii|Rep: I-SceII DNA
           endonuclease-like protein - Saccharomyces castellii
           (Yeast)
          Length = 598

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 35/63 (55%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P INNI F              +VE+GAGTG TVYPPL+S  AH G SVDLAIF+LH+  
Sbjct: 96  PRINNIGFWLLPMGLVCLVTSTLVESGAGTGWTVYPPLASIQAHSGPSVDLAIFALHMTS 155

Query: 428 ISS 436
           ISS
Sbjct: 156 ISS 158



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 31/59 (52%), Positives = 39/59 (66%), Gaps = 1/59 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFGTS 684
           LFV A+ ITA          +  +T+LL DRN NTSFF+ AGGGDPILY H++  FGT+
Sbjct: 184 LFVWAILITAVLLLLTLPVLSAGVTMLLLDRNFNTSFFEVAGGGDPILYEHLFWFFGTT 242



 Score = 39.5 bits (88), Expect = 0.082
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
 Frame = +3

Query: 84  ELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL  PG   L G++Q++N +V  HA                 N ++PL++GA D AFPR
Sbjct: 39  ELAAPGQQYLHGNNQLFNVLVVGHAILMIFFMVMPALIGGFGNYMLPLMIGATDTAFPR 97


>UniRef50_Q28SZ5 Cluster: Cytochrome-c oxidase; n=50; cellular
           organisms|Rep: Cytochrome-c oxidase - Jannaschia sp.
           (strain CCS1)
          Length = 628

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 33/57 (57%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LF  +V +TA+         AGAIT+LLTDRN  T+FFDPAGGGDPIL+ HI+  FG
Sbjct: 289 LFAWSVFVTAWLLLLSLPVLAGAITMLLTDRNFGTTFFDPAGGGDPILFQHIFWFFG 345



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ +              +++ GAG G T YPP+S+      R+VD AIF++H++G
Sbjct: 201 PRLNNLSYWMYVAGTCLAFCSVMIDGGAGPGWTFYPPISAQGVETSRAVDFAIFAVHVSG 260

Query: 428 ISS 436
            SS
Sbjct: 261 ASS 263



 Score = 36.7 bits (81), Expect = 0.58
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 2/60 (3%)
 Frame = +3

Query: 81  AELGNPGSLIG--DDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           A LG    L G  D  ++N ++T H                  N  +PL++GAPD+AFPR
Sbjct: 143 ALLGTMDQLDGNPDGHLWNVLITGHGVLMMFFVVIPALFGGFGNYFMPLMIGAPDMAFPR 202


>UniRef50_Q59IQ0 Cluster: Cytochrome c oxidase subunit I; n=1;
           Watasenia scintillans|Rep: Cytochrome c oxidase subunit
           I - Watasenia scintillans (Sparkling enope)
          Length = 217

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 56/181 (30%), Positives = 73/181 (40%), Gaps = 1/181 (0%)
 Frame = +3

Query: 84  ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR*II 263
           ELG PGSL+ DDQ+YN +VTAH                  N LVPL+LGAPD+AFPR   
Sbjct: 24  ELGQPGSLLNDDQLYNVVVTAHGFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNN 83

Query: 264 *DFDSYPPPLYY*FQEEL*KMVQEQDEQFTPHFHLISHIEEDP*ILLFFHYI*QVFHQL* 443
             F  +P   +Y +     K    +DE  TP + +         + +F  ++  V   L 
Sbjct: 84  MSFGFFPLHWHY-YSFFTVKGGLARDELSTPLYLVTISAGPSVDLAIFPLHLAGVSSILG 142

Query: 444 EXXXXXXXXXXXXXXXXXXXXXXXCMSCRDYSXXXXXXTTCFSWSYYNIINRS-KLKYII 620
                                   C+    Y        TC S SYY IIN    L YII
Sbjct: 143 SYWLYYNNSLYTVSSSSNGTTTFICLISVYYRYPSTPFFTCTSSSYYYIINSPLLLHYII 202

Query: 621 F 623
           +
Sbjct: 203 W 203



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = +2

Query: 383 GRSVDLAIFSLHLAGISS 436
           G SVDLAIF LHLAG+SS
Sbjct: 122 GPSVDLAIFPLHLAGVSS 139


>UniRef50_A7UG06 Cluster: Cytochrome oxidase subunits 1 and 2
           polyprotein; n=1; Phaeosphaeria nodorum SN15|Rep:
           Cytochrome oxidase subunits 1 and 2 polyprotein -
           Phaeosphaeria nodorum SN15
          Length = 789

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 33/57 (57%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LF  AV ITA          AG IT++LTDRN NTSFF+ AGGGDPILY H++  FG
Sbjct: 184 LFAWAVVITAVLLLLSLPVLAGGITMVLTDRNFNTSFFEVAGGGDPILYQHLFWFFG 240



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 32/63 (50%), Positives = 38/63 (60%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NNI +               +ENG GTG T+YPPLS   +H G SVDLAIF LHL+G
Sbjct: 96  PRLNNISYLLLIPSIVLFLFAGGIENGVGTGWTLYPPLSGIQSHSGPSVDLAIFGLHLSG 155

Query: 428 ISS 436
           ISS
Sbjct: 156 ISS 158



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  ELGNPG-SLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL  PG   I D+Q+YN+I+TAHA                 N L+PL LG PD+ FPR
Sbjct: 40  ELSGPGVQYIADNQLYNSIITAHAIIMIFFMVMPALIGGFGNFLLPLGLGGPDMGFPR 97


>UniRef50_Q951H1 Cluster: Cytochrome c oxidase subunit I; n=388;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Picoides
           borealis
          Length = 513

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 33/58 (56%), Positives = 38/58 (65%)
 Frame = +3

Query: 81  AELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           AELG PG+L+GDDQ  N IVTAHA                 N LVPL++GAPD+AFPR
Sbjct: 40  AELGQPGTLLGDDQXXNVIVTAHAFVMIFXMXMPIMIGGFGNWLVPLMIGAPDMAFPR 97



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 17/39 (43%), Positives = 20/39 (51%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLS 364
           P +NN+ F               VE GAGTG TVYPPL+
Sbjct: 96  PRMNNMSFWLLPPSFLLLLASSTVEAGAGTGWTVYPPLA 134


>UniRef50_Q9G8S1 Cluster: Cytochrome c oxidase subunit 1; n=1;
           Naegleria gruberi|Rep: Cytochrome c oxidase subunit 1 -
           Naegleria gruberi
          Length = 633

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 30/57 (52%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV +V +T+F         A AIT+LL DRN NTSF+DP GGGD +LY H++  FG
Sbjct: 187 LFVWSVAVTSFLVIVAIPVLAAAITLLLFDRNFNTSFYDPVGGGDVVLYQHLFWFFG 243



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 31/63 (49%), Positives = 33/63 (52%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN  F                E G GTG TVYPPLSS  +H G SVDL IFS HL G
Sbjct: 99  PRLNNFSFWLLPGAILLAVLATYSEGGPGTGWTVYPPLSSLQSHSGASVDLMIFSFHLVG 158

Query: 428 ISS 436
           I S
Sbjct: 159 IGS 161



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 25/85 (29%), Positives = 32/85 (37%), Gaps = 2/85 (2%)
 Frame = +3

Query: 6   RVGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXX 179
           R+G LY                    EL  PG   L G+   YN I T H          
Sbjct: 16  RIGILYLFFGVFNGFLAVLLSMLMRLELAFPGDQILFGEYHFYNMITTVHGVLMLFVVVM 75

Query: 180 XXXXXXXXN*LVPLILGAPDIAFPR 254
                   N  VP+++GAPD++FPR
Sbjct: 76  PILFGGFGNYFVPILIGAPDMSFPR 100


>UniRef50_Q1NET5 Cluster: Cytochrome-c oxidase; n=3;
           Alphaproteobacteria|Rep: Cytochrome-c oxidase -
           Sphingomonas sp. SKA58
          Length = 556

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV +V +TAF         A AIT+LLTDRN  T+F+D AGGGDP LY H++  FG
Sbjct: 226 LFVWSVLVTAFLLLLALPVLAAAITMLLTDRNFGTTFYDAAGGGDPELYQHLFWFFG 282



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/38 (63%), Positives = 29/38 (76%)
 Frame = +2

Query: 323 NGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 436
           NGAGTG TVY PLS++    G +VD+AI SLH+AG SS
Sbjct: 164 NGAGTGWTVYAPLSTS-GSAGPAVDMAILSLHIAGASS 200



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 15/44 (34%), Positives = 23/44 (52%)
 Frame = +3

Query: 123 IYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           ++N ++TAH                  N  VP+++GAPD+AFPR
Sbjct: 93  LWNVLITAHGLIMVFFMVMPAMIGGFGNWFVPIMIGAPDMAFPR 136


>UniRef50_Q1XA94 Cluster: Cytochrome c oxidase subunit I; n=825;
           Eukaryota|Rep: Cytochrome c oxidase subunit I -
           Paracoccidioides brasiliensis
          Length = 710

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 29/63 (46%), Positives = 36/63 (57%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ +              I+ENG GTG T+YPPLS   +H    VDL IF LHL+G
Sbjct: 122 PRLNNVSYWLLIPSLFLFVFAAIIENGVGTGWTLYPPLSGIQSHSSMGVDLGIFGLHLSG 181

Query: 428 ISS 436
           ISS
Sbjct: 182 ISS 184



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 33/57 (57%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LF  AV ITA          A AIT+LLTDRNLNTSF++ AGGGD ILY H++  FG
Sbjct: 210 LFGWAVVITAVLLLLSLPVLAAAITMLLTDRNLNTSFYELAGGGDAILYQHLFWFFG 266



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  ELGNPG-SLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL  PG   I D+Q+YN+I+T+H                  N L+P+++G PD+AFPR
Sbjct: 66  ELSGPGIQYIEDNQLYNSIITSHGVIMIFFMVMPALIGGFGNFLLPILIGGPDMAFPR 123


>UniRef50_Q6ED53 Cluster: Cox1-i5 protein; n=2; Candida
           stellata|Rep: Cox1-i5 protein - Candida stellata (Yeast)
          Length = 763

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/63 (42%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P INN+ F              +++ G G+G T+YPPL+S  +H G S+D+AIF+LHL+G
Sbjct: 113 PRINNLAFVVLLPSMLFAVLSCLIDEGPGSGWTLYPPLTSLQSHSGSSIDMAIFALHLSG 172

Query: 428 ISS 436
           +SS
Sbjct: 173 LSS 175



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 30/57 (52%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV +V ITA          A  +T+LL DRN NTSFF  +GGGDP+LY HI+  FG
Sbjct: 201 LFVWSVLITAVLIILALPVLAAGLTMLLMDRNFNTSFFVVSGGGDPLLYEHIFWFFG 257



 Score = 39.5 bits (88), Expect = 0.082
 Identities = 20/54 (37%), Positives = 28/54 (51%)
 Frame = +3

Query: 93  NPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           NP  L+ + Q++N ++TAHA                 N LVPL +G+ D AFPR
Sbjct: 61  NPQILMHNGQLWNVLITAHALFMVFYLVMPITMGALANYLVPLQIGSNDTAFPR 114


>UniRef50_Q6ED52 Cluster: Cox1-i4 protein; n=1; Candida
           stellata|Rep: Cox1-i4 protein - Candida stellata (Yeast)
          Length = 676

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/63 (42%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P INN+ F              +++ G G+G T+YPPL+S  +H G S+D+AIF+LHL+G
Sbjct: 113 PRINNLAFVVLLPSMLFAVLSCLIDEGPGSGWTLYPPLTSLQSHSGSSIDMAIFALHLSG 172

Query: 428 ISS 436
           +SS
Sbjct: 173 LSS 175



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 30/57 (52%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV +V ITA          A  +T+LL DRN NTSFF  +GGGDP+LY HI+  FG
Sbjct: 201 LFVWSVLITAVLIILALPVLAAGLTMLLMDRNFNTSFFVVSGGGDPLLYEHIFWFFG 257



 Score = 39.5 bits (88), Expect = 0.082
 Identities = 20/54 (37%), Positives = 28/54 (51%)
 Frame = +3

Query: 93  NPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           NP  L+ + Q++N ++TAHA                 N LVPL +G+ D AFPR
Sbjct: 61  NPQILMHNGQLWNVLITAHALFMVFYLVMPITMGALANYLVPLQIGSNDTAFPR 114


>UniRef50_Q6ED51 Cluster: Cox-i3 protein; n=1; Candida stellata|Rep:
           Cox-i3 protein - Candida stellata (Yeast)
          Length = 588

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/63 (42%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P INN+ F              +++ G G+G T+YPPL+S  +H G S+D+AIF+LHL+G
Sbjct: 113 PRINNLAFVVLLPSMLFAVLSCLIDEGPGSGWTLYPPLTSLQSHSGSSIDMAIFALHLSG 172

Query: 428 ISS 436
           +SS
Sbjct: 173 LSS 175



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 30/57 (52%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV +V ITA          A  +T+LL DRN NTSFF  +GGGDP+LY HI+  FG
Sbjct: 201 LFVWSVLITAVLIILALPVLAAGLTMLLMDRNFNTSFFVVSGGGDPLLYEHIFWFFG 257



 Score = 39.5 bits (88), Expect = 0.082
 Identities = 20/54 (37%), Positives = 28/54 (51%)
 Frame = +3

Query: 93  NPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           NP  L+ + Q++N ++TAHA                 N LVPL +G+ D AFPR
Sbjct: 61  NPQILMHNGQLWNVLITAHALFMVFYLVMPITMGALANYLVPLQIGSNDTAFPR 114


>UniRef50_Q6ED50 Cluster: Cox-i2 protein; n=1; Candida stellata|Rep:
           Cox-i2 protein - Candida stellata (Yeast)
          Length = 586

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/63 (42%), Positives = 40/63 (63%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P INN+ F              +++ G G+G T+YPPL+S  +H G S+D+AIF+LHL+G
Sbjct: 113 PRINNLAFVVLLPSMLFAVLSCLIDEGPGSGWTLYPPLTSLQSHSGSSIDMAIFALHLSG 172

Query: 428 ISS 436
           +SS
Sbjct: 173 LSS 175



 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 28/53 (52%), Positives = 34/53 (64%), Gaps = 1/53 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIY 666
           LFV +V ITA          A  +T+LL DRN NTSFF  +GGGDP+LY HI+
Sbjct: 201 LFVWSVLITAVLIILALPVLAAGLTMLLMDRNFNTSFFVVSGGGDPLLYEHIF 253



 Score = 39.5 bits (88), Expect = 0.082
 Identities = 20/54 (37%), Positives = 28/54 (51%)
 Frame = +3

Query: 93  NPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           NP  L+ + Q++N ++TAHA                 N LVPL +G+ D AFPR
Sbjct: 61  NPQILMHNGQLWNVLITAHALFMVFYLVMPITMGALANYLVPLQIGSNDTAFPR 114


>UniRef50_Q3L2S5 Cluster: Cytochrome c oxidase subunit I; n=1; Aedes
           cretinus|Rep: Cytochrome c oxidase subunit I - Aedes
           cretinus
          Length = 153

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 30/55 (54%), Positives = 34/55 (61%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFS 412
           P +NN+ F              +VENGAGTG TVYPPLSS  AH G SVDLAI+S
Sbjct: 11  PRMNNMSFWMLPPSLTLLLSSSMVENGAGTGWTVYPPLSSGTAHAGASVDLAIYS 65



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/55 (41%), Positives = 27/55 (49%), Gaps = 1/55 (1%)
 Frame = +3

Query: 516 CMSCRDYSXXXXXXTTCFSWSYYNIINRSKLKYIIF*SCWRRRPNFIS-HLFDFW 677
           CM C +Y        TCFS S+Y IIN  K KY IF   W   P  +S  +  FW
Sbjct: 97  CMICCNYCYFITSFFTCFSSSHYYIINWPKSKYFIFWPNWSSSPYSLSTFILIFW 151


>UniRef50_A1XI88 Cluster: Cytochrome c oxidase subunit I; n=1;
           Myrmarachne sp. G FSC-2006|Rep: Cytochrome c oxidase
           subunit I - Myrmarachne sp. G FSC-2006
          Length = 129

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 28/41 (68%), Positives = 31/41 (75%)
 Frame = +2

Query: 314 IVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 436
           +VE G G G TVYPPL+S + H G SVD AIFSLHLAG SS
Sbjct: 12  MVEMGVGAGWTVYPPLASVVGHGGSSVDFAIFSLHLAGASS 52


>UniRef50_Q8SHP5 Cluster: Cytochrome c oxidase subunit I; n=15;
           Fungi/Metazoa group|Rep: Cytochrome c oxidase subunit I
           - Trichoderma reesei (Hypocrea jecorina)
          Length = 635

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 32/67 (47%), Positives = 39/67 (58%), Gaps = 4/67 (5%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TV----YPPLSSNIAHRGRSVDLAIFSL 415
           P +NNI F              I+E G GTG T+    YPPLS   +H G SVDLAIF+L
Sbjct: 124 PRLNNISFWLLPPSLLLLVFSAIIEGGVGTGWTLLKDKYPPLSGLQSHSGPSVDLAIFAL 183

Query: 416 HLAGISS 436
           HL+G+SS
Sbjct: 184 HLSGVSS 190



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 23/34 (67%), Positives = 29/34 (85%), Gaps = 1/34 (2%)
 Frame = +1

Query: 580 ITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           IT++LTDRN NTSFF+ AGGGDPIL+ H++  FG
Sbjct: 232 ITMVLTDRNFNTSFFEVAGGGDPILFQHLFWFFG 265



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 32/96 (33%), Positives = 42/96 (43%), Gaps = 1/96 (1%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPG-SLIGDDQIYNTIVTAHAXXXXXXXXXXX 185
           +GTLY                    EL  PG   I ++Q+YN+I+TAHA           
Sbjct: 43  IGTLYLIFALFSGLLGTAFSVLIRLELSGPGVQFIANNQLYNSIITAHAILMIFFMVMPA 102

Query: 186 XXXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPL 293
                 N L+PL++G PD+AFPR     F   PP L
Sbjct: 103 LIGGFGNFLMPLMIGGPDMAFPRLNNISFWLLPPSL 138


>UniRef50_Q9B6E6 Cluster: COX1-i5 protein; n=3; Fungi/Metazoa
           group|Rep: COX1-i5 protein - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 608

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 31/61 (50%), Positives = 37/61 (60%)
 Frame = +2

Query: 254 INNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGIS 433
           +NNI F              +VE GAGTG TVY PL+   +H G +VDLAIFSLHL+G S
Sbjct: 103 LNNISFWLLVPSLILILTSALVEAGAGTGWTVYFPLAGIQSHSGPAVDLAIFSLHLSGFS 162

Query: 434 S 436
           S
Sbjct: 163 S 163



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIY 666
           LF  AV  TA          A  +T+ + DRN NTSFF+ AGGGD +LY H++
Sbjct: 189 LFAWAVLFTAILLLLSLPVLAAGLTMGIFDRNFNTSFFEYAGGGDAVLYQHLF 241



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +3

Query: 84  ELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL N GS  L G+ Q +N ++TAHA                 N L+PL+LGA D+AF R
Sbjct: 44  ELANTGSPFLHGNTQAFNVVITAHAILMIFFFVMPALVGGFGNYLMPLMLGASDMAFAR 102


>UniRef50_P14544 Cluster: Cytochrome c oxidase subunit 1; n=7;
           Eukaryota|Rep: Cytochrome c oxidase subunit 1 -
           Leishmania tarentolae (Sauroleishmania tarentolae)
          Length = 549

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LF+ A  ITA          AG +T++L DRN NTSF+D  GGGD IL+ HI+  FG
Sbjct: 186 LFIWAALITAILLIITLPVLAGGVTLILCDRNFNTSFYDVVGGGDLILFQHIFWFFG 242



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+ F              + E G G G T+YP L     H   + D  +F++HL G
Sbjct: 98  PRLNNMSFWMYLAGFGCVVNGFLTEEGMGVGWTLYPTLICIDFHSSLACDFVMFAVHLLG 157

Query: 428 ISS 436
           ISS
Sbjct: 158 ISS 160



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = +3

Query: 99  GSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           G L GD Q YN ++T+H                  N  +P++ G PD+ FPR
Sbjct: 48  GILFGDYQFYNVLITSHGLIMVFAFIMPVMMGGLVNYFIPVMAGFPDMVFPR 99


>UniRef50_Q0H8X8 Cluster: Probable intron-encoded endonuclease aI2
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI2 (EC
           3.1.-.-)]; n=2; Ustilago maydis|Rep: Probable
           intron-encoded endonuclease aI2 precursor [Contains:
           Truncated non-functional cytochrome oxidase 1;
           Intron-encoded endonuclease aI2 (EC 3.1.-.-)] - Ustilago
           maydis (Smut fungus)
          Length = 533

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 35/97 (36%), Positives = 42/97 (43%), Gaps = 2/97 (2%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXX 182
           +GTLY                    EL  PG   L GD Q+YN I+TAHA          
Sbjct: 13  IGTLYLIFAVFAAMIGTAFSVLIRMELAAPGVQYLNGDHQLYNVIITAHAFVMIFFMVMP 72

Query: 183 XXXXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPL 293
                  N LVP+++GAPD+AFPR     F   PP L
Sbjct: 73  AMVGGFGNYLVPVMIGAPDMAFPRLNNISFWLLPPSL 109


>UniRef50_Q9B8X8 Cluster: Cytochrome c oxidase subunit I; n=517;
           Bilateria|Rep: Cytochrome c oxidase subunit I -
           Schistosoma mansoni (Blood fluke)
          Length = 609

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 1/37 (2%)
 Frame = +1

Query: 571 AGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           A  IT+LL DRN  T+FF+P+GGGDPIL+ H++  FG
Sbjct: 293 ASGITMLLFDRNFGTAFFEPSGGGDPILFQHLFWFFG 329



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 21/37 (56%), Positives = 24/37 (64%)
 Frame = +2

Query: 326 GAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 436
           G G G T+YPPLS      G  VD  +FSLHLAG+SS
Sbjct: 217 GCGIGWTLYPPLSI-WEGSGFGVDYLMFSLHLAGVSS 252


>UniRef50_Q35061 Cluster: CoxI intron4 ORF; n=3; Marchantia
           polymorpha|Rep: CoxI intron4 ORF - Marchantia polymorpha
           (Liverwort)
          Length = 434

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 31/97 (31%), Positives = 42/97 (43%), Gaps = 2/97 (2%)
 Frame = +3

Query: 9   VGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLI--GDDQIYNTIVTAHAXXXXXXXXXX 182
           +GTLY                    EL  PG+ I  G+ Q+YN ++TAHA          
Sbjct: 17  IGTLYLIFGAIAGVMGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMP 76

Query: 183 XXXXXXXN*LVPLILGAPDIAFPR*II*DFDSYPPPL 293
                  N  VP+++G+PD+AFPR     F   PP L
Sbjct: 77  AMIGGFGNWFVPILIGSPDMAFPRLNNISFWLLPPSL 113


>UniRef50_Q8HCX2 Cluster: Cytochrome c oxidase subunit I; n=1;
           Aplidium nordmanni|Rep: Cytochrome c oxidase subunit I -
           Aplidium nordmanni
          Length = 227

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 28/63 (44%), Positives = 33/63 (52%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P + N+ F               +  G G    VYPP SS +AH   +VDL IF LHLAG
Sbjct: 85  PRLXNMSFWLLPPSLXXLCLSVFIGXGVGXXWXVYPPXSSGLAHSSGAVDLGIFXLHLAG 144

Query: 428 ISS 436
           ISS
Sbjct: 145 ISS 147


>UniRef50_O47573 Cluster: Cytochrome c oxidase subunit I; n=42;
           Nematoda|Rep: Cytochrome c oxidase subunit I -
           Onchocerca volvulus
          Length = 548

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           +FV    +T+F         AG++  LL DRN NTSF+D   GG+P+LY H++  FG
Sbjct: 193 MFVWTSYLTSFLLVLSVPVLAGSLLFLLLDRNFNTSFYDTKKGGNPLLYQHLFWFFG 249



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +3

Query: 84  ELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL +PG     G  Q+YN+++T H                  N ++PL+LGAP++AFPR
Sbjct: 49  ELSSPGGHLFFGSGQVYNSVLTMHGVLMIFFLVMPILIGGFGNWMLPLMLGAPEMAFPR 107


>UniRef50_Q5W914 Cluster: Cytochrome c oxidase subunit I; n=9;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Lingula
           unguis
          Length = 573

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/63 (38%), Positives = 34/63 (53%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 427
           P +NN+                +   G G G T+YPPLS++    G  +DLA+FSLH+AG
Sbjct: 97  PRLNNLSVWLALGSLFLMCMAFLSSGGLGCGWTMYPPLSNSEFMDGLPIDLAVFSLHMAG 156

Query: 428 ISS 436
           +SS
Sbjct: 157 MSS 159



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/37 (54%), Positives = 28/37 (75%), Gaps = 1/37 (2%)
 Frame = +1

Query: 571 AGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           A  +T+LL DR+ +TSF+ P GGGDPIL+ H++  FG
Sbjct: 206 AAGLTLLLLDRHFSTSFYYPEGGGDPILWQHLFWFFG 242


>UniRef50_A6XEV4 Cluster: Cytochrome c oxidase subunit 1; n=1;
           Munidopsis verrucosus|Rep: Cytochrome c oxidase subunit
           1 - Munidopsis verrucosus
          Length = 154

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/27 (77%), Positives = 25/27 (92%)
 Frame = +2

Query: 356 PLSSNIAHRGRSVDLAIFSLHLAGISS 436
           PL+S+IAH G SVD+AIFSLHLAG+SS
Sbjct: 72  PLASSIAHAGASVDMAIFSLHLAGVSS 98


>UniRef50_Q7YI87 Cluster: Cytochrome oxidase subunit I; n=1;
           Celatoblatta vulgaris|Rep: Cytochrome oxidase subunit I
           - Celatoblatta vulgaris
          Length = 134

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/35 (57%), Positives = 23/35 (65%)
 Frame = +3

Query: 519 MSCRDYSXXXXXXTTCFSWSYYNIINRSKLKYIIF 623
           M C +YS      +TC  WSYYN IN SKLKYI+F
Sbjct: 84  MICSNYSFTIIIVSTCSCWSYYNTINWSKLKYILF 118


>UniRef50_Q9XKD7 Cluster: Cytochrome c oxidase subunit I; n=1;
           Dicyema misakiense|Rep: Cytochrome c oxidase subunit I -
           Dicyema misakiense
          Length = 473

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/37 (51%), Positives = 27/37 (72%), Gaps = 1/37 (2%)
 Frame = +1

Query: 571 AGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           A  IT++LTD++L T F+D   GGDP+LY H++  FG
Sbjct: 187 AVGITLILTDKHLGTCFYDATMGGDPLLYQHLFWFFG 223



 Score = 36.7 bits (81), Expect = 0.58
 Identities = 20/36 (55%), Positives = 24/36 (66%)
 Frame = +2

Query: 329 AGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 436
           A  G T YPPLSS       SV+ ++FSLHLAGI+S
Sbjct: 112 ASAGWTFYPPLSS----LSPSVEFSVFSLHLAGIAS 143


>UniRef50_O67935 Cluster: Cytochrome c oxidase subunit I; n=1;
           Aquifex aeolicus|Rep: Cytochrome c oxidase subunit I -
           Aquifex aeolicus
          Length = 485

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +1

Query: 571 AGAITILLTDRNLNTSFFDPAGGGDPILY 657
           AGA+T+L  D+ L T+FF+PA GGDP++Y
Sbjct: 159 AGAVTMLFLDKYLGTNFFNPAKGGDPLIY 187



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 18/53 (33%), Positives = 26/53 (49%)
 Frame = +3

Query: 96  PGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           PG  + D + YN ++T H                  N L+PL++GA D+AFPR
Sbjct: 2   PGMQVVDFKTYNYLLTGHGVGMLFWWAIAAHIGGFGNFLLPLMIGAKDVAFPR 54


>UniRef50_Q02766 Cluster: Cytochrome c oxidase subunit 1; n=107;
           Alveolata|Rep: Cytochrome c oxidase subunit 1 -
           Plasmodium falciparum
          Length = 476

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/36 (52%), Positives = 25/36 (69%), Gaps = 1/36 (2%)
 Frame = +1

Query: 574 GAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           G + +LL+D + NT FFDP   GDPILY H++  FG
Sbjct: 210 GGVLMLLSDLHFNTLFFDPTFAGDPILYQHLFWFFG 245



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = +2

Query: 248 PTINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGR-SVDLAIFSLHLA 424
           P IN+I                  E G GTG T+YPPLS+++      +VD+ IF L ++
Sbjct: 100 PRINSISLLLQPIAFVLVILSTAAEFGGGTGWTLYPPLSTSLMSLSPVAVDVIIFGLLVS 159

Query: 425 GISS 436
           G++S
Sbjct: 160 GVAS 163


>UniRef50_Q9B6E4 Cluster: COX1-i3 protein; n=2; Yarrowia
           lipolytica|Rep: COX1-i3 protein - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 457

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +3

Query: 84  ELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL N GS  L G+ Q +N ++TAHA                 N L+PL+LGA D+AF R
Sbjct: 44  ELANTGSPFLHGNTQAFNVVITAHAILMIFFFVMPALVGGFGNYLMPLMLGASDMAFAR 102


>UniRef50_Q36097 Cluster: Cytochrome c oxidase subunit 1; n=3;
           Theileria|Rep: Cytochrome c oxidase subunit 1 -
           Theileria parva
          Length = 481

 Score = 40.7 bits (91), Expect = 0.036
 Identities = 20/40 (50%), Positives = 30/40 (75%)
 Frame = +2

Query: 317 VENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 436
           +E G+GTG T+YPPLS+++++ G  +D  IF L  AGI+S
Sbjct: 126 LEIGSGTGWTLYPPLSTSLSNVG--IDFIIFGLLAAGIAS 163



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +1

Query: 523 AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           ++ +T+F              ++  DR+ NT FF+ +  GDP+LY H++  FG
Sbjct: 193 SIVLTSFLLLLSLPVVTAVFLMVFLDRHYNTMFFESSNSGDPVLYQHLFWFFG 245


>UniRef50_Q98P35 Cluster: Cytochrome C oxidase subunit I; n=16;
           cellular organisms|Rep: Cytochrome C oxidase subunit I -
           Rhizobium loti (Mesorhizobium loti)
          Length = 623

 Score = 40.3 bits (90), Expect = 0.047
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV ++ +T+F           A T L+ DR + T FF+PA GGD +L+ H++  FG
Sbjct: 199 LFVWSMLVTSFLVILAMPAIMIASTSLILDRLVGTHFFNPAEGGDVLLWQHLFWFFG 255


>UniRef50_O99652 Cluster: Cytochrome c oxidase subunit I; n=1;
           Tetragona dorsalis ziegleri|Rep: Cytochrome c oxidase
           subunit I - Tetragona dorsalis ziegleri
          Length = 111

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILYHIYL-IFG 678
           LF  ++ IT           AG IT+LL+DRN N  FF   GG  PIL+   L +FG
Sbjct: 16  LFSWSISITVNLSILSLPMLAGTITMLLSDRNFNKFFFILIGGEYPILHQYMLWLFG 72


>UniRef50_Q1CZF1 Cluster: Cytochrome c oxidase, subunit I; n=1;
           Myxococcus xanthus DK 1622|Rep: Cytochrome c oxidase,
           subunit I - Myxococcus xanthus (strain DK 1622)
          Length = 556

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 21/57 (36%), Positives = 25/57 (43%)
 Frame = +3

Query: 84  ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL  PG  I D   YN   T H                  N ++PL+LGA D+AFPR
Sbjct: 70  ELLTPGPTIMDAMTYNRTFTLHGLVMIFLFMIPAIPAVFGNFMLPLMLGAKDVAFPR 126



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
 Frame = +1

Query: 574 GAITILLTDRNL-NTSFFDPAGGGDPILY-HIYLIF 675
           G + +L+T  NL     FDPA GGDP+L+ H++  +
Sbjct: 229 GLLLVLVTVENLFGFGMFDPARGGDPVLFQHLFWFY 264


>UniRef50_Q0I8U1 Cluster: Cytochrome c oxidase subunit I; n=16;
           Bacteria|Rep: Cytochrome c oxidase subunit I -
           Synechococcus sp. (strain CC9311)
          Length = 564

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +1

Query: 574 GAITILLTDRNLNTSFFDPAGGGDPILYHIYLIF 675
           G   +LL D +  TSFF P GGGDP+L+  +  F
Sbjct: 230 GGAVMLLFDLSFGTSFFRPEGGGDPVLFQHFFWF 263



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 18/57 (31%), Positives = 27/57 (47%)
 Frame = +3

Query: 84  ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL  P + + D  +YN + T H                  N L+P ++GAPD+AFP+
Sbjct: 64  ELITPPADLVDPSVYNGLYTMHGTVMLFLFLFPILNGFN-NLLIPTMIGAPDMAFPK 119


>UniRef50_Q18JR5 Cluster: Cytochrome-c-like terminal oxidase,
           subunit I; n=2; Halobacteriaceae|Rep: Cytochrome-c-like
           terminal oxidase, subunit I - Haloquadratum walsbyi
           (strain DSM 16790)
          Length = 634

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 84  ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL +PG  +  +  YN+++T+H                  N L+PL++GA D+AFPR
Sbjct: 122 ELADPGMTVISNTFYNSLLTSHGITMLFLFATPIIAAFS-NYLIPLLIGADDMAFPR 177



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
 Frame = +1

Query: 577 AITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           AI +LL DRN  TSFF  AG G  IL+ H++  FG
Sbjct: 292 AIMMLLFDRNFGTSFF--AGEGGAILWQHLFWFFG 324


>UniRef50_Q85HI4 Cluster: Cytochrome c oxidase subunit I; n=7;
           Echinoida|Rep: Cytochrome c oxidase subunit I -
           Echinometra oblonga
          Length = 386

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 16/26 (61%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 604 NLNTSFFDPAGGGDPILY-HIYLIFG 678
           N  T+FFDPAGGGD IL+ H++  FG
Sbjct: 191 NYYTTFFDPAGGGDXILFQHLFXFFG 216


>UniRef50_Q06473 Cluster: Cytochrome c oxidase subunit 1 (EC
           1.9.3.1) (Cytochrome c oxidase polypeptide I)
           (Cytochrome aa3 subunit 1) (Oxidase aa(3) subunit 1);
           n=59; Cyanobacteria|Rep: Cytochrome c oxidase subunit 1
           (EC 1.9.3.1) (Cytochrome c oxidase polypeptide I)
           (Cytochrome aa3 subunit 1) (Oxidase aa(3) subunit 1) -
           Synechocystis sp. (strain PCC 6803)
          Length = 551

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = +1

Query: 571 AGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIF 675
           A A+ +L  D    TSFF+P GGGDP++Y H++  +
Sbjct: 214 ASALILLSFDLIAGTSFFNPVGGGDPVVYQHLFWFY 249


>UniRef50_A7H8L4 Cluster: Cytochrome c oxidase subunit I type; n=38;
           Bacteria|Rep: Cytochrome c oxidase subunit I type -
           Anaeromyxobacter sp. Fw109-5
          Length = 555

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 19/57 (33%), Positives = 26/57 (45%)
 Frame = +3

Query: 84  ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           EL  PG  I D   YN + T H                  N L+P+++GA D+AFP+
Sbjct: 63  ELLTPGPTIMDAMTYNRMFTLHGVVMIFLFMIPAIPSGFGNFLLPIMIGAKDVAFPK 119


>UniRef50_A7BSH8 Cluster: Cytochrome c oxidase aa3, subunit 1; n=1;
           Beggiatoa sp. PS|Rep: Cytochrome c oxidase aa3, subunit
           1 - Beggiatoa sp. PS
          Length = 525

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 25/84 (29%), Positives = 31/84 (36%), Gaps = 1/84 (1%)
 Frame = +3

Query: 6   RVGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDD-QIYNTIVTAHAXXXXXXXXXX 182
           RVG LY                    EL   G  I DD  +YNT +  H           
Sbjct: 16  RVGILYLIGSIAAFAVAGIMAMLIRLELSQIGPTITDDPSVYNTWLYFHGAAMILAFQIP 75

Query: 183 XXXXXXXN*LVPLILGAPDIAFPR 254
                  N  +PL++GA D+AFPR
Sbjct: 76  ALTGFFANYFIPLMIGAKDVAFPR 99



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +1

Query: 577 AITILLTDRNLNTSFFDPAGGGDPILY 657
           A+T+L  D+ + T FFD A GGD + Y
Sbjct: 205 AVTMLTFDKYIGTHFFDAAAGGDALTY 231


>UniRef50_A6C5X9 Cluster: Cytochrome caa3 oxidase; n=3;
           Bacteria|Rep: Cytochrome caa3 oxidase - Planctomyces
           maris DSM 8797
          Length = 754

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 17/35 (48%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +1

Query: 577 AITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           A+ +LL DR L ++FFDP  GG  +L+ H + IFG
Sbjct: 224 ALAMLLIDRWLGSAFFDPTRGGSAVLWQHYFWIFG 258


>UniRef50_A0RZ19 Cluster: Heme/copper-type cytochrome/quinol
           oxidase, subunit 1; n=2; Thermoprotei|Rep:
           Heme/copper-type cytochrome/quinol oxidase, subunit 1 -
           Cenarchaeum symbiosum
          Length = 508

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 18/33 (54%), Positives = 24/33 (72%), Gaps = 1/33 (3%)
 Frame = +1

Query: 571 AGAITILLTDRNLNTSFFDPAGGGDPILY-HIY 666
           A A+ +LLTDR   + FF+PA GGDPI Y H++
Sbjct: 205 AAALLMLLTDRLGVSGFFNPAVGGDPIAYAHLF 237


>UniRef50_Q34463 Cluster: Cytochrome oxidase subunit I; n=3; Euglena
           gracilis|Rep: Cytochrome oxidase subunit I - Euglena
           gracilis
          Length = 495

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 1/35 (2%)
 Frame = +1

Query: 577 AITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           AIT LL DRN+N++ +D    GDP+LY H++  FG
Sbjct: 217 AITGLLLDRNINSTIYDVI--GDPVLYQHLFWFFG 249



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 16/35 (45%), Positives = 25/35 (71%), Gaps = 1/35 (2%)
 Frame = +2

Query: 335 TG*TVYPPLSSNIAHR-GRSVDLAIFSLHLAGISS 436
           +G T+YPPLS+  A   G ++DL++  +H+ GISS
Sbjct: 135 SGWTLYPPLSTRDADNIGVNIDLSLLVVHVLGISS 169


>UniRef50_Q5K464 Cluster: Putative DNA endonuclease; n=1;
           Kluyveromyces thermotolerans|Rep: Putative DNA
           endonuclease - Kluyveromyces thermotolerans (Yeast)
          Length = 542

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = +3

Query: 84  ELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR* 257
           EL  PG+  L G+ Q++N +V  HA                 N L+PL++GA D++F R 
Sbjct: 39  ELAAPGNQYLGGNHQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGASDMSFARL 98

Query: 258 II*DFDSYPPPL 293
               F   PP L
Sbjct: 99  NNISFWLLPPAL 110


>UniRef50_P33518 Cluster: Cytochrome c oxidase polypeptide 1; n=4;
           Halobacteriaceae|Rep: Cytochrome c oxidase polypeptide 1
           - Halobacterium salinarium (Halobacterium halobium)
          Length = 593

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +1

Query: 577 AITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           A+ +LL DRN  T+FF  A GGDPI + H++  FG
Sbjct: 260 ALIMLLLDRNFGTTFFTVA-GGDPIFWQHLFWFFG 293


>UniRef50_Q6XYE8 Cluster: Cytochrome c oxidase subunit I; n=2;
           Endopterygota|Rep: Cytochrome c oxidase subunit I -
           Copitarsia incommoda
          Length = 150

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 19/38 (50%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +3

Query: 603 KLKYIIF*SCWRRRPNFIS-HLFDFWDILKLYFNFTRI 713
           K KYIIF S W     F+S  +  FW    LYFNFT I
Sbjct: 7   KFKYIIFWSSWSSWSYFMSTFILIFWTPSSLYFNFTSI 44


>UniRef50_P11947 Cluster: Cytochrome c oxidase subunit 1; n=48;
           Oligohymenophorea|Rep: Cytochrome c oxidase subunit 1 -
           Tetrahymena pyriformis
          Length = 698

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +1

Query: 577 AITILLTDRNLNTSFFDPAGGGDPIL-YHIYLIFG 678
           A+ ++  DR+  T+FF+ A GGDPIL  H++  FG
Sbjct: 366 AVIMMAFDRHWQTTFFEYAYGGDPILSQHLFWFFG 400


>UniRef50_A7HEB5 Cluster: Cytochrome-c oxidase; n=2;
           Cystobacterineae|Rep: Cytochrome-c oxidase -
           Anaeromyxobacter sp. Fw109-5
          Length = 596

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 6/55 (10%)
 Frame = +1

Query: 532 ITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPA-----GGGDPILY-HIYLIFG 678
           +TA            A  +LL DR+  T FF        GGGDPIL+ H++ IFG
Sbjct: 223 LTAILNALFVPVLGSAALLLLLDRSFGTEFFVAGASAVRGGGDPILWQHLFWIFG 277



 Score = 32.7 bits (71), Expect = 9.5
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +2

Query: 329 AGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 436
           AG G T Y PLS+N+   G    L + ++ + G+SS
Sbjct: 155 AGAGWTTYTPLSTNVGMPGMGQTLVVAAIFVTGVSS 190


>UniRef50_A4WT83 Cluster: Cytochrome c, monohaem; n=3;
           Rhodobacteraceae|Rep: Cytochrome c, monohaem -
           Rhodobacter sphaeroides ATCC 17025
          Length = 878

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%)
 Frame = +1

Query: 598 DRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           +R  +  FFDP  GGDP+L+ H++ IFG
Sbjct: 254 ERGFDWPFFDPERGGDPLLWQHLFWIFG 281


>UniRef50_A0TRU9 Cluster: Cytochrome-c oxidase; n=30;
           Proteobacteria|Rep: Cytochrome-c oxidase - Burkholderia
           cenocepacia MC0-3
          Length = 1004

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%)
 Frame = +1

Query: 577 AITILLTDRNLNTSFFDPAGGGDPILY-HIYLIF 675
           A  +L  DRN  T FFD A GG P+L+ H++ +F
Sbjct: 241 AFLLLWLDRNAGTHFFDVAHGGRPLLWQHLFWMF 274


>UniRef50_Q94WV3 Cluster: Cytochrome oxidase subunit I; n=1;
           Pachymerium ferrugineum|Rep: Cytochrome oxidase subunit
           I - Pachymerium ferrugineum
          Length = 219

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 21/55 (38%), Positives = 26/55 (47%)
 Frame = +1

Query: 253 DK*YKILTPTPLPYIINFKKNCRKWCRNRMNSLPPTFI*YRT*RKIRRSCYFFTT 417
           +K +KIL  TPL Y  N    C K C + +NSLP     Y T    R   +F  T
Sbjct: 81  NKQFKILIITPLTYTTNSIYGCSKRCSHSVNSLPAPCCKYLTLGPFRSYNHFCPT 135


>UniRef50_P98005 Cluster: Cytochrome c oxidase polypeptide I+III (EC
           1.9.3.1) (Cytochrome c aa(3) subunit 1); n=2; Thermus
           thermophilus|Rep: Cytochrome c oxidase polypeptide I+III
           (EC 1.9.3.1) (Cytochrome c aa(3) subunit 1) - Thermus
           thermophilus (strain HB8 / ATCC 27634 / DSM 579)
          Length = 791

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = +1

Query: 577 AITILLTDRNLNTSFFDPAGGGDPILYHIYLIF 675
           A  ++L +R +  S+F+PA GGDP+L+  +  F
Sbjct: 215 ATLLVLLERKIGLSWFNPAVGGDPVLFQQFFWF 247


>UniRef50_A7QNM5 Cluster: Chromosome undetermined scaffold_133,
           whole genome shotgun sequence; n=2; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_133, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 492

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +3

Query: 630 CWRRRPNFISHLFDFWDILKLY 695
           CW +  +F+ HLFD + ILKL+
Sbjct: 141 CWHKHGSFLEHLFDMYKILKLW 162


>UniRef50_A5UVJ0 Cluster: Cytochrome-c oxidase; n=2;
           Roseiflexus|Rep: Cytochrome-c oxidase - Roseiflexus sp.
           RS-1
          Length = 641

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 1/57 (1%)
 Frame = +1

Query: 511 LFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           LFV    + AF           A   LL DR+  T FF P  GGD +L+ H++  FG
Sbjct: 201 LFVWMQLVVAFILIFAFPVLTVATIQLLFDRHFGTRFFLPNLGGDAVLWQHLFWFFG 257


>UniRef50_Q5ABE2 Cluster: Putative uncharacterized protein CLN3;
           n=1; Candida albicans|Rep: Putative uncharacterized
           protein CLN3 - Candida albicans (Yeast)
          Length = 785

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
 Frame = -3

Query: 656 YKIGSPPPAGSKNDVFKFRSVNN---IVIAPAKTGSDNNNKNAVIPTAH 519
           Y++ +PP + +KN   K  S NN     IA   T ++NNN N+ +P  H
Sbjct: 572 YQMVTPPNSANKNSN-KSNSANNNNTTTIATTTTTTNNNNNNSQLPAPH 619


>UniRef50_Q79VD7 Cluster: Cytochrome c oxidase subunit 1; n=93;
           Actinobacteria (class)|Rep: Cytochrome c oxidase subunit
           1 - Corynebacterium glutamicum (Brevibacterium flavum)
          Length = 584

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 19/58 (32%), Positives = 27/58 (46%)
 Frame = +3

Query: 81  AELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 254
           AEL  PG     ++ +N + T H                  N ++PL +GAPD+AFPR
Sbjct: 65  AELFTPGLQFLSNEQFNQLFTMHGTVMLLLYGTPIVWGFA-NYVLPLQIGAPDVAFPR 121


>UniRef50_P24010 Cluster: Cytochrome c oxidase subunit 1 (EC
           1.9.3.1) (Cytochrome c oxidase polypeptide I)
           (Cytochrome aa3 subunit 1) (Caa-3605 subunit 1) (Oxidase
           aa(3) subunit 1); n=13; Bacillaceae|Rep: Cytochrome c
           oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c oxidase
           polypeptide I) (Cytochrome aa3 subunit 1) (Caa-3605
           subunit 1) (Oxidase aa(3) subunit 1) - Bacillus subtilis
          Length = 622

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 12/34 (35%), Positives = 24/34 (70%), Gaps = 1/34 (2%)
 Frame = +1

Query: 580 ITILLTDRNLNTSFFDPAGGGDPILY-HIYLIFG 678
           + +++ DR   T+FF+P  GG+ +++ H++ IFG
Sbjct: 215 LALMMLDRLFGTNFFNPELGGNTVIWEHLFWIFG 248


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 566,169,461
Number of Sequences: 1657284
Number of extensions: 9508143
Number of successful extensions: 20131
Number of sequences better than 10.0: 76
Number of HSP's better than 10.0 without gapping: 19205
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20074
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 58853922985
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -