SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-lik...   279   5e-74
UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397; ro...   279   5e-74
UniRef50_P13905 Cluster: Elongation factor 1-alpha; n=2224; cell...   248   1e-64
UniRef50_Q5EMT9 Cluster: Elongation factor 1-alpha-like protein;...   245   7e-64
UniRef50_UPI0000EB0538 Cluster: UPI0000EB0538 related cluster; n...   217   3e-55
UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porph...   207   2e-52
UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellul...   186   6e-46
UniRef50_P90922 Cluster: Putative uncharacterized protein; n=3; ...   180   2e-44
UniRef50_Q9Y450 Cluster: HBS1-like protein; n=43; Euteleostomi|R...   175   1e-42
UniRef50_O93729 Cluster: Elongation factor 1-alpha; n=20; Archae...   166   4e-40
UniRef50_A2QW82 Cluster: Contig An11c0160, complete genome; n=8;...   163   3e-39
UniRef50_Q8IIC9 Cluster: Translation elongation factor EF-1, sub...   163   5e-39
UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1; Pneum...   163   5e-39
UniRef50_P15170 Cluster: G1 to S phase transition protein 1 homo...   163   5e-39
UniRef50_A6RA16 Cluster: Putative uncharacterized protein; n=1; ...   161   1e-38
UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor...   161   1e-38
UniRef50_UPI0000D55B6A Cluster: PREDICTED: similar to CG1898-PA;...   161   2e-38
UniRef50_A2AX44 Cluster: Translation elongation factor 1 like; n...   161   2e-38
UniRef50_O45622 Cluster: Putative uncharacterized protein; n=2; ...   161   2e-38
UniRef50_Q86NR4 Cluster: RE29053p; n=5; Diptera|Rep: RE29053p - ...   160   3e-38
UniRef50_A6RVA8 Cluster: Putative uncharacterized protein; n=1; ...   160   3e-38
UniRef50_Q00WU5 Cluster: EF-1 alpha-like protein; n=1; Ostreococ...   159   5e-38
UniRef50_Q9NCN7 Cluster: Eukaryotic release factor 3 GTPase subu...   158   1e-37
UniRef50_P32769 Cluster: Elongation factor 1 alpha-like protein;...   158   1e-37
UniRef50_Q5UHI3 Cluster: EF-1 alpha-like protein; n=6; Eukaryota...   158   1e-37
UniRef50_Q7YZN7 Cluster: Hsp70 subfamily B suppressor 1; n=3; Di...   157   2e-37
UniRef50_Q4P6P7 Cluster: Putative uncharacterized protein; n=1; ...   157   2e-37
UniRef50_A3LY56 Cluster: Predicted protein; n=2; Pichia|Rep: Pre...   157   2e-37
UniRef50_A5X901 Cluster: Elongation factor 1-alpha; n=2; Chilodo...   156   4e-37
UniRef50_Q96TP0 Cluster: Elongation factor 1 alpha; n=5; Fungi/M...   156   6e-37
UniRef50_Q6BVD7 Cluster: Similar to sp|P32769 Saccharomyces cere...   155   8e-37
UniRef50_Q9NCN8 Cluster: Eukaryotic release factor 3 GTPase subu...   155   1e-36
UniRef50_O74774 Cluster: Elongation factor 1 alpha related prote...   154   2e-36
UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1; ...   153   3e-36
UniRef50_Q759Q2 Cluster: ADR221Cp; n=3; Saccharomycetales|Rep: A...   152   7e-36
UniRef50_UPI0000499ED8 Cluster: guanine nucleotide regulatory pr...   152   1e-35
UniRef50_Q9HGI4 Cluster: Eukaryotic peptide chain release factor...   152   1e-35
UniRef50_A4ZCD1 Cluster: GTP-binding protein; n=9; Magnoliophyta...   151   1e-35
UniRef50_A7RM15 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...   151   1e-35
UniRef50_O13354 Cluster: Eukaryotic peptide chain release factor...   151   2e-35
UniRef50_P05453 Cluster: Eukaryotic peptide chain release factor...   149   7e-35
UniRef50_Q5KLM5 Cluster: Putative uncharacterized protein; n=2; ...   149   9e-35
UniRef50_Q5KFJ4 Cluster: Translation release factor, putative; n...   149   9e-35
UniRef50_Q23TC1 Cluster: Elongation factor Tu C-terminal domain ...   148   1e-34
UniRef50_A4R2K6 Cluster: Putative uncharacterized protein; n=1; ...   148   1e-34
UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1, sub...   146   5e-34
UniRef50_Q4E4V1 Cluster: Elongation factor 1-alpha (EF-1-alpha),...   145   8e-34
UniRef50_Q2U0M0 Cluster: Translation elongation factor EF-1 alph...   145   8e-34
UniRef50_Q2GS47 Cluster: Putative uncharacterized protein; n=1; ...   145   1e-33
UniRef50_Q6JIY6 Cluster: Translation elongation factor 1 alpha; ...   144   2e-33
UniRef50_Q4QGW5 Cluster: Eukaryotic release factor 3, putative; ...   143   4e-33
UniRef50_Q9NCN6 Cluster: Eukaryotic release factor 3 GTPase subu...   139   5e-32
UniRef50_Q2ABX8 Cluster: Elongation factor 1-alpha; n=1; Megacop...   139   5e-32
UniRef50_Q6CFF3 Cluster: Similar to tr|Q9WTY5 Mus musculus ERFS;...   138   9e-32
UniRef50_Q9NCN5 Cluster: Eukaryotic release factor 3 GTPase subu...   138   2e-31
UniRef50_Q8SRN3 Cluster: TRANSLATION ELONGATION FACTOR 1-ALPHA; ...   137   3e-31
UniRef50_Q7YZN9 Cluster: Eukaryotic release factor 3; n=2; Dicty...   135   1e-30
UniRef50_A0E926 Cluster: Chromosome undetermined scaffold_84, wh...   134   2e-30
UniRef50_A4RWT6 Cluster: Predicted protein; n=2; Ostreococcus|Re...   134   3e-30
UniRef50_A5JHE1 Cluster: Translation elongation factor EF-1 alph...   134   3e-30
UniRef50_UPI00006CC36B Cluster: Elongation factor Tu C-terminal ...   132   6e-30
UniRef50_Q8SS29 Cluster: TRANSLATION ELONGATION FACTOR 1 ALPHA; ...   132   8e-30
UniRef50_UPI000150A7E9 Cluster: Elongation factor Tu C-terminal ...   131   2e-29
UniRef50_Q9LM39 Cluster: T10O22.4; n=7; Magnoliophyta|Rep: T10O2...   131   2e-29
UniRef50_Q4FW53 Cluster: Hsp70 subfamily B suppressor 1; n=3; Le...   131   2e-29
UniRef50_Q7R087 Cluster: GLP_56_7099_8961; n=2; Giardia intestin...   123   4e-27
UniRef50_A2FN77 Cluster: Elongation factor Tu C-terminal domain ...   118   1e-25
UniRef50_Q96TK8 Cluster: Translation elongation factor 1 alpha; ...   117   3e-25
UniRef50_A4XJZ8 Cluster: Sulfate adenylyltransferase, large subu...   111   2e-23
UniRef50_Q97MT1 Cluster: GTPase, sulfate adenylate transferase s...   110   3e-23
UniRef50_Q259E7 Cluster: H0801D08.2 protein; n=5; Oryza sativa|R...   110   3e-23
UniRef50_Q89UE2 Cluster: NodQ bifunctional enzyme; n=12; Rhizobi...   110   4e-23
UniRef50_Q95UT7 Cluster: Elongation factor 1 alpha short form; n...   109   9e-23
UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large subu...   107   4e-22
UniRef50_Q5CWA0 Cluster: HBS1 eRFS. GTpase; n=2; Cryptosporidium...   106   5e-22
UniRef50_Q74CF6 Cluster: Elongation factor Tu GTP binding domain...   105   1e-21
UniRef50_UPI0000E47BF2 Cluster: PREDICTED: similar to elongation...   102   8e-21
UniRef50_UPI0000499770 Cluster: elongation factor-1alpha; n=1; E...   102   8e-21
UniRef50_Q24TA2 Cluster: Adenylylsulfate kinase/sulfate adenylyl...   102   1e-20
UniRef50_UPI0000DD78A4 Cluster: PREDICTED: similar to statin-lik...   101   2e-20
UniRef50_A0BL72 Cluster: Chromosome undetermined scaffold_113, w...   100   3e-20
UniRef50_A4LX06 Cluster: Sulfate adenylyltransferase; n=1; Geoba...    99   1e-19
UniRef50_Q6WZ47 Cluster: Elongation factor-1 alpha; n=3; Coeloma...    98   2e-19
UniRef50_Q19AS6 Cluster: Translation elongation factor 1 alpha; ...    97   3e-19
UniRef50_Q0G239 Cluster: Binfunctional sulfate adenylyltransfera...    95   2e-18
UniRef50_Q8AAP9 Cluster: Sulfate adenylyltransferase subunit 1; ...    95   2e-18
UniRef50_Q46516 Cluster: ORFC 179; n=1; Desulfurococcus mobilis|...    94   3e-18
UniRef50_Q5FSE8 Cluster: Sulfate adenylyltransferase subunit 1 /...    91   2e-17
UniRef50_P56893 Cluster: Sulfate adenylyltransferase subunit 1; ...    90   4e-17
UniRef50_Q7UMW2 Cluster: Bifunctional enzyme cysN/cysC [Includes...    89   1e-16
UniRef50_Q0YG57 Cluster: Small GTP-binding protein domain:Sulfat...    87   3e-16
UniRef50_Q7M9D1 Cluster: GTPASE, SULFATE ADENYLATE TRANSFERASE S...    87   5e-16
UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial pre...    86   7e-16
UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4; Fungi/M...    86   9e-16
UniRef50_Q5BEE6 Cluster: Elongation factor Tu; n=1; Emericella n...    86   9e-16
UniRef50_Q0A978 Cluster: Sulfate adenylyltransferase, large subu...    84   3e-15
UniRef50_Q8IFW1 Cluster: Elongation factor-1 alpha; n=1; Exoneur...    84   3e-15
UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9; Ac...    84   3e-15
UniRef50_Q22GX7 Cluster: Elongation factor Tu C-terminal domain ...    84   3e-15
UniRef50_Q9PD78 Cluster: Bifunctional enzyme cysN/cysC [Includes...    84   3e-15
UniRef50_UPI0000F308E4 Cluster: UPI0000F308E4 related cluster; n...    84   4e-15
UniRef50_A6GJE6 Cluster: Sulfate adenylyltransferase, large subu...    83   7e-15
UniRef50_Q2S507 Cluster: Sulfate adenylyltransferase, large subu...    82   1e-14
UniRef50_Q9RGE9 Cluster: Sulfate adenylyltransferase subunit Cys...    82   1e-14
UniRef50_Q9L9U8 Cluster: Putative ATP sulfurylase large subunit;...    82   1e-14
UniRef50_A0EFI6 Cluster: Elongation factor Tu; n=3; Paramecium t...    82   1e-14
UniRef50_A2WJZ4 Cluster: Putative uncharacterized protein; n=1; ...    81   2e-14
UniRef50_Q83JX8 Cluster: Sulfate adenylyltransferase subunit 1; ...    81   2e-14
UniRef50_Q10600 Cluster: Bifunctional enzyme cysN/cysC [Includes...    81   3e-14
UniRef50_UPI000050FE96 Cluster: COG2895: GTPases - Sulfate adeny...    81   4e-14
UniRef50_Q82L80 Cluster: Putative sulfate adenylyltransferase la...    81   4e-14
UniRef50_A3HVR6 Cluster: Sulfate adenylyltransferase subunit 1; ...    80   5e-14
UniRef50_Q39DS0 Cluster: Sulfate adenylyltransferase, large subu...    80   6e-14
UniRef50_Q8ZMF5 Cluster: Sulfate adenylyltransferase subunit 1; ...    80   6e-14
UniRef50_Q0SH95 Cluster: CysN/CysC bifunctional enzyme; n=14; Ac...    79   1e-13
UniRef50_Q8ZBP2 Cluster: Sulfate adenylyltransferase subunit 1; ...    78   2e-13
UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial pre...    78   2e-13
UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular org...    77   3e-13
UniRef50_A6GM01 Cluster: Bifunctional sulfate adenylyltransferas...    77   6e-13
UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu), mitochond...    77   6e-13
UniRef50_UPI00006CBD5B Cluster: Elongation factor Tu, mitochondr...    76   8e-13
UniRef50_Q8NLX2 Cluster: GTPases-Sulfate adenylate transferase s...    76   8e-13
UniRef50_Q1FK57 Cluster: Small GTP-binding protein domain:Sulfat...    76   8e-13
UniRef50_Q7K3V6 Cluster: Elongation factor Tu; n=7; Coelomata|Re...    75   1e-12
UniRef50_A1W6V4 Cluster: Sulfate adenylyltransferase, large subu...    75   2e-12
UniRef50_Q9UVK1 Cluster: SUP35 homolog; n=1; Pichia pastoris|Rep...    74   4e-12
UniRef50_Q0EDG4 Cluster: Mitochondrial EF-Tu2; n=1; Trichinella ...    73   5e-12
UniRef50_A4SYY3 Cluster: Sulfate adenylyltransferase, large subu...    73   7e-12
UniRef50_Q1ITG6 Cluster: Sulfate adenylyltransferase, large subu...    73   9e-12
UniRef50_Q4G4A5 Cluster: Elongation factor 1A; n=86; Eukaryota|R...    73   9e-12
UniRef50_A4VDD2 Cluster: Elongation factor 1-alpha; n=1; Tetrahy...    73   9e-12
UniRef50_Q4QDW8 Cluster: Elongation factor TU, putative; n=5; Tr...    72   2e-11
UniRef50_Q19072 Cluster: Elongation factor Tu homologue precurso...    72   2e-11
UniRef50_Q08RF5 Cluster: CysN/CysC bifunctional enzyme; n=2; Cys...    71   4e-11
UniRef50_Q45W23 Cluster: Tuf1; n=1; uncultured Pseudonocardia sp...    70   5e-11
UniRef50_Q25820 Cluster: Elongation factor Tu; n=99; cellular or...    69   9e-11
UniRef50_Q8WT68 Cluster: Elongation factor-1 alpha; n=3; Endopte...    69   1e-10
UniRef50_Q4U972 Cluster: Translation elongation factor 1-alpha, ...    69   1e-10
UniRef50_UPI0000EB403C Cluster: UPI0000EB403C related cluster; n...    67   4e-10
UniRef50_A7ANX2 Cluster: Elongation factor Tu GTP binding domain...    67   4e-10
UniRef50_Q74NG5 Cluster: NEQ270; n=1; Nanoarchaeum equitans|Rep:...    66   6e-10
UniRef50_A0JZN0 Cluster: Sulfate adenylyltransferase, large subu...    64   2e-09
UniRef50_P18905 Cluster: Elongation factor Tu; n=2; Coleochaetal...    64   2e-09
UniRef50_Q2LU53 Cluster: Selenocysteine-specific protein transla...    63   8e-09
UniRef50_UPI00006A2885 Cluster: UPI00006A2885 related cluster; n...    61   3e-08
UniRef50_Q9UVK0 Cluster: SUP35 homolog; n=1; Saccharomycodes lud...    60   4e-08
UniRef50_A7PFT2 Cluster: Chromosome chr11 scaffold_14, whole gen...    60   7e-08
UniRef50_Q8TYZ3 Cluster: GTPase-translation elongation factor; n...    58   2e-07
UniRef50_Q4JIN1 Cluster: Selenocysteine-specific translation elo...    58   3e-07
UniRef50_A1HSM1 Cluster: Selenocysteine-specific translation elo...    58   3e-07
UniRef50_Q8XIK3 Cluster: Selenocysteine-specific elongation fact...    56   9e-07
UniRef50_A6CK31 Cluster: Selenocysteine-specific translation elo...    56   1e-06
UniRef50_Q74GZ1 Cluster: Selenocysteine-specific translation elo...    55   2e-06
UniRef50_A0BK03 Cluster: Chromosome undetermined scaffold_111, w...    55   2e-06
UniRef50_Q46497 Cluster: Selenocysteine-specific elongation fact...    55   2e-06
UniRef50_A3SGF9 Cluster: Translation elongation factor, selenocy...    54   3e-06
UniRef50_Q1MPY9 Cluster: Selenocysteine-specific translation elo...    54   3e-06
UniRef50_A6BIM9 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_A4YIX9 Cluster: Protein synthesis factor, GTP-binding; ...    54   3e-06
UniRef50_Q5WBK2 Cluster: Translation elongation factor G; n=1; B...    54   5e-06
UniRef50_A5KED2 Cluster: Elongation factor, putative; n=1; Plasm...    54   5e-06
UniRef50_Q1AUJ9 Cluster: Selenocysteine-specific translation elo...    52   1e-05
UniRef50_A0Z3R3 Cluster: Selenocysteine-specific elongation fact...    52   1e-05
UniRef50_Q7VI67 Cluster: Selenocysteine-specific elongation fact...    52   1e-05
UniRef50_Q0ATV7 Cluster: Selenocysteine-specific translation elo...    52   2e-05
UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS (T...    51   2e-05
UniRef50_Q46455 Cluster: Selenocysteine-specific elongation fact...    51   2e-05
UniRef50_A3LLY2 Cluster: GTP-binding protein LepA; n=4; Bacteria...    51   3e-05
UniRef50_Q46306 Cluster: Tetracycline resistance protein tetP (T...    51   3e-05
UniRef50_Q3E0L1 Cluster: Translation elongation factor, selenocy...    50   4e-05
UniRef50_A6DB59 Cluster: Putative selenocysteine-specific elonga...    50   4e-05
UniRef50_Q7R7M3 Cluster: Elongation factor Tu family, putative; ...    50   4e-05
UniRef50_Q8TJT7 Cluster: Translation initiation factor 2 subunit...    50   4e-05
UniRef50_Q4S9H1 Cluster: Chromosome undetermined SCAF14696, whol...    50   6e-05
UniRef50_Q5GBH8 Cluster: TetT; n=2; Lactobacillales|Rep: TetT - ...    50   6e-05
UniRef50_Q18YZ1 Cluster: Selenocysteine-specific translation elo...    50   8e-05
UniRef50_A1FN34 Cluster: Selenocysteine-specific translation elo...    50   8e-05
UniRef50_Q931D5 Cluster: SelB selenocysteine-specific elongation...    49   1e-04
UniRef50_A0LHL0 Cluster: Selenocysteine-specific translation elo...    49   1e-04
UniRef50_A7PCT1 Cluster: Chromosome chr17 scaffold_12, whole gen...    49   1e-04
UniRef50_Q9C1V6 Cluster: Tranlsation elongation factor 1a; n=2; ...    49   1e-04
UniRef50_Q2B7L6 Cluster: Selenocysteine-specific translation elo...    49   1e-04
UniRef50_A7Q762 Cluster: Chromosome chr5 scaffold_58, whole geno...    49   1e-04
UniRef50_A5DTX8 Cluster: Putative uncharacterized protein; n=3; ...    49   1e-04
UniRef50_P43927 Cluster: Selenocysteine-specific elongation fact...    49   1e-04
UniRef50_Q47F25 Cluster: Translation elongation factor, selenocy...    48   2e-04
UniRef50_A7H0F4 Cluster: Selenocysteine-specific translation elo...    48   2e-04
UniRef50_A6P2V2 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_A0YGX4 Cluster: Translation elongation factor, selenocy...    48   2e-04
UniRef50_P34617 Cluster: Uncharacterized GTP-binding protein ZK1...    48   2e-04
UniRef50_Q1Z854 Cluster: Hypothetical selenocysteine-specific tr...    48   2e-04
UniRef50_Q1NKM4 Cluster: Translation elongation factor, selenocy...    48   3e-04
UniRef50_Q0BZB1 Cluster: Selenocysteine-specific translation elo...    48   3e-04
UniRef50_Q6F0Z6 Cluster: GTP-binding membrane protein, elongatio...    47   5e-04
UniRef50_A0KL71 Cluster: Selenocysteine-specific translation elo...    47   5e-04
UniRef50_Q6FMS9 Cluster: Candida glabrata strain CBS138 chromoso...    47   5e-04
UniRef50_Q67QI5 Cluster: Selenocysteine-specific elongation fact...    46   7e-04
UniRef50_A0DB90 Cluster: Chromosome undetermined scaffold_44, wh...    46   7e-04
UniRef50_P14081 Cluster: Selenocysteine-specific elongation fact...    46   7e-04
UniRef50_O36041 Cluster: Eukaryotic translation initiation facto...    46   7e-04
UniRef50_A0YH51 Cluster: Selenocysteine-specific elongation fact...    46   0.001
UniRef50_Q8TVI5 Cluster: Translation elongation factor, GTPase; ...    46   0.001
UniRef50_P46943 Cluster: GTP-binding protein GUF1; n=37; root|Re...    46   0.001
UniRef50_A6G2B2 Cluster: Translation elongation factor, selenocy...    46   0.001
UniRef50_A5Z9F8 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_A0X1J6 Cluster: Selenocysteine-specific translation elo...    46   0.001
UniRef50_A4RX89 Cluster: Predicted protein; n=2; Ostreococcus|Re...    46   0.001
UniRef50_A3FPW4 Cluster: Elongation factor-like protein; n=3; Cr...    46   0.001
UniRef50_Q1VQ31 Cluster: Tetracycline resistance protein; n=1; P...    45   0.002
UniRef50_Q7Q5R3 Cluster: ENSANGP00000020583; n=3; Diptera|Rep: E...    45   0.002
UniRef50_P0A3B4 Cluster: GTP-binding protein typA/bipA; n=97; Ba...    45   0.002
UniRef50_UPI0000D62D3D Cluster: UPI0000D62D3D related cluster; n...    45   0.002
UniRef50_Q73LA2 Cluster: Selenocysteine-specific translation elo...    45   0.002
UniRef50_P70882 Cluster: Tetracycline resistance protein tetQ (T...    45   0.002
UniRef50_Q30SC0 Cluster: Translation elongation factor, selenocy...    44   0.003
UniRef50_Q1ETS8 Cluster: Translation elongation factor, selenocy...    44   0.003
UniRef50_A7HHY2 Cluster: Selenocysteine-specific translation elo...    44   0.003
UniRef50_A4E707 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q54D77 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q4Q219 Cluster: Mitochondrial elongation factor G, puta...    44   0.003
UniRef50_O67141 Cluster: Elongation factor SelB; n=1; Aquifex ae...    44   0.004
UniRef50_Q1ZC67 Cluster: Selenocysteine synthase; n=1; Psychromo...    44   0.004
UniRef50_Q1JYY0 Cluster: Selenocysteine-specific translation elo...    44   0.004
UniRef50_Q8I592 Cluster: Elongation factor g, putative; n=1; Pla...    44   0.004
UniRef50_Q55002 Cluster: Oxytetracycline resistance protein; n=2...    44   0.004
UniRef50_Q8UFQ0 Cluster: Tetracycline resistance protein, tetM/t...    44   0.005
UniRef50_Q81NX9 Cluster: GTP-binding elongation factor protein, ...    44   0.005
UniRef50_A4FHF5 Cluster: Tetracycline resistance protein; n=1; S...    44   0.005
UniRef50_A0Q2C8 Cluster: Translation elongation factor G; n=1; C...    44   0.005
UniRef50_Q8ZZV4 Cluster: Translation initiation factor aIF-2 gam...    44   0.005
UniRef50_Q8N442 Cluster: GTP-binding protein GUF1 homolog; n=108...    44   0.005
UniRef50_A3Q882 Cluster: Selenocysteine-specific translation elo...    43   0.007
UniRef50_Q9LS91 Cluster: Elongation factor EF-2; n=1; Arabidopsi...    43   0.007
UniRef50_Q6CBI0 Cluster: Yarrowia lipolytica chromosome C of str...    43   0.007
UniRef50_A2R454 Cluster: Function: GTPBP1 of H. sapiens is struc...    43   0.007
UniRef50_Q98QW3 Cluster: GTP-binding protein lepA; n=52; cellula...    43   0.007
UniRef50_Q4T508 Cluster: Chromosome 1 SCAF9472, whole genome sho...    43   0.009
UniRef50_Q663U2 Cluster: Selenocysteine-specific elongation fact...    43   0.009
UniRef50_A7QN79 Cluster: Chromosome undetermined scaffold_131, w...    43   0.009
UniRef50_Q7Q3I6 Cluster: ENSANGP00000010178; n=1; Anopheles gamb...    43   0.009
UniRef50_Q4Y6S3 Cluster: Elongation factor g, putative; n=4; Pla...    43   0.009
UniRef50_A3LWR2 Cluster: Mitochondrial elongation factor G-like ...    43   0.009
UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog; ...    43   0.009
UniRef50_Q8C3X4-2 Cluster: Isoform 2 of Q8C3X4 ; n=3; Murinae|Re...    42   0.011
UniRef50_Q1IHM2 Cluster: Selenocysteine-specific translation elo...    42   0.011
UniRef50_Q6MAV2 Cluster: Probable peptide chain release factor 3...    42   0.015
UniRef50_Q0LF89 Cluster: Selenocysteine-specific translation elo...    42   0.015
UniRef50_A6C5F4 Cluster: Elongation factor G; n=1; Planctomyces ...    42   0.015
UniRef50_Q6ESY0 Cluster: Putative elongation factor 2; n=2; Oryz...    42   0.015
UniRef50_Q4UIT0 Cluster: Elongation factor 2, putative; n=2; The...    42   0.015
UniRef50_Q4Q2R0 Cluster: Selenocysteine-specific elongation fact...    42   0.015
UniRef50_A5HWL3 Cluster: Elongation factor 1-alpha; n=6; Gloeopo...    42   0.015
UniRef50_Q0HP29 Cluster: Selenocysteine-specific translation elo...    42   0.020
UniRef50_A7QHK9 Cluster: Chromosome chr5 scaffold_98, whole geno...    42   0.020
UniRef50_Q96RP9 Cluster: Elongation factor G 1, mitochondrial pr...    42   0.020
UniRef50_Q1ZR84 Cluster: Selenocysteinyl-tRNA-specific translati...    41   0.026
UniRef50_A6ET18 Cluster: GTP-binding elongation factor family pr...    41   0.026
UniRef50_A7PSI5 Cluster: Chromosome chr6 scaffold_28, whole geno...    41   0.026
UniRef50_Q24BY4 Cluster: Elongation factor Tu GTP binding domain...    41   0.026
UniRef50_Q08491 Cluster: Superkiller protein 7; n=2; Saccharomyc...    41   0.026
UniRef50_Q62AN3 Cluster: Selenocysteine-specific translation elo...    41   0.035
UniRef50_A5ZXF5 Cluster: Putative uncharacterized protein; n=2; ...    41   0.035
UniRef50_Q0E3S2 Cluster: Os02g0157700 protein; n=4; cellular org...    41   0.035
UniRef50_A2R994 Cluster: Contig An17c0030, complete genome; n=1;...    41   0.035
UniRef50_A5NXM0 Cluster: Selenocysteine-specific translation elo...    38   0.038
UniRef50_A5K6I6 Cluster: GTP-binding protein, putative; n=2; cel...    40   0.046
UniRef50_Q8F2N6 Cluster: Peptide chain release factor 3; n=8; Ba...    40   0.061
UniRef50_A7QSS1 Cluster: Chromosome chr4 scaffold_162, whole gen...    40   0.061
UniRef50_Q7Q1K8 Cluster: ENSANGP00000010217; n=2; Coelomata|Rep:...    40   0.061
UniRef50_Q9X1Y4 Cluster: Elongation factor G-like protein; n=5; ...    40   0.061
UniRef50_O94429 Cluster: Elongation factor G 2, mitochondrial pr...    40   0.061
UniRef50_A4X2G5 Cluster: Selenocysteine-specific translation elo...    40   0.080
UniRef50_A7R247 Cluster: Chromosome undetermined scaffold_399, w...    40   0.080
UniRef50_Q55BS5 Cluster: Putative uncharacterized protein; n=1; ...    40   0.080
UniRef50_Q4QHR6 Cluster: Translation initiation factor eif-2b ga...    40   0.080
UniRef50_Q17ME5 Cluster: Translation elongation factor; n=2; Cul...    40   0.080
UniRef50_A2EAD8 Cluster: Elongation factor Tu GTP binding domain...    40   0.080
UniRef50_Q6BJX4 Cluster: Debaryomyces hansenii chromosome F of s...    40   0.080
UniRef50_P39677 Cluster: Elongation factor G 2, mitochondrial pr...    40   0.080
UniRef50_A4A194 Cluster: Small GTP-binding protein domain; n=1; ...    39   0.11 
UniRef50_A2U1S4 Cluster: GTP-binding elongation factor family pr...    39   0.11 
UniRef50_A5AF37 Cluster: Putative uncharacterized protein; n=1; ...    39   0.11 
UniRef50_O62108 Cluster: Putative uncharacterized protein selb-1...    39   0.11 
UniRef50_O29514 Cluster: GTP-binding protein; n=8; Euryarchaeota...    39   0.11 
UniRef50_UPI00004996CE Cluster: 116 kda u5 small nuclear ribonuc...    39   0.14 
UniRef50_A6PUV8 Cluster: Small GTP-binding protein; n=1; Victiva...    39   0.14 
UniRef50_A1SQK9 Cluster: Small GTP-binding protein; n=2; Actinom...    39   0.14 
UniRef50_Q583L1 Cluster: Selenocysteine-tRNA-specific elongation...    39   0.14 
UniRef50_Q57918 Cluster: Selenocysteine-specific elongation fact...    39   0.14 
UniRef50_A7BBE2 Cluster: Putative uncharacterized protein; n=1; ...    38   0.19 
UniRef50_Q00ZZ1 Cluster: GTP-binding membrane protein LepA homol...    38   0.19 
UniRef50_Q67MT5 Cluster: Peptide chain release factor 3; n=13; B...    38   0.19 
UniRef50_Q92IQ1 Cluster: GTP-binding protein lepA; n=187; Bacter...    38   0.19 
UniRef50_Q09130 Cluster: Eukaryotic translation initiation facto...    38   0.19 
UniRef50_P41091 Cluster: Eukaryotic translation initiation facto...    38   0.19 
UniRef50_A4E9E3 Cluster: Putative uncharacterized protein; n=1; ...    38   0.25 
UniRef50_UPI00006A19F1 Cluster: GTP-binding protein 2.; n=1; Xen...    38   0.32 
UniRef50_Q0EZ74 Cluster: Translation initiation factor IF-2; n=1...    38   0.32 
UniRef50_Q5KQ62 Cluster: Translation elongation factor 2, putati...    38   0.32 
UniRef50_UPI0000519D80 Cluster: PREDICTED: similar to mitochondr...    37   0.43 
UniRef50_Q6LH28 Cluster: Hypothetical selenocysteine-specific tr...    37   0.43 
UniRef50_A1ZPR2 Cluster: Fibronectin type III domain protein; n=...    37   0.43 
UniRef50_Q00RU6 Cluster: Elongation factor Tu family protein; n=...    37   0.43 
UniRef50_Q55G92 Cluster: Putative uncharacterized protein; n=1; ...    37   0.43 
UniRef50_Q384D0 Cluster: Elongation factor G2-like protein; n=5;...    37   0.43 
UniRef50_A6RAK0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.43 
UniRef50_P72689 Cluster: Translation initiation factor IF-2; n=8...    37   0.43 
UniRef50_Q30WJ0 Cluster: Translation initiation factor IF-2; n=1...    37   0.43 
UniRef50_Q3SWP9 Cluster: Translation initiation factor IF-2; n=8...    33   0.53 
UniRef50_UPI000050FBE9 Cluster: COG3276: Selenocysteine-specific...    37   0.57 
UniRef50_A2XIM0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.57 
UniRef50_Q9VV61 Cluster: CG33158-PB; n=4; Sophophora|Rep: CG3315...    37   0.57 
UniRef50_Q95Y73 Cluster: Putative uncharacterized protein; n=2; ...    37   0.57 
UniRef50_Q8I335 Cluster: GTP-binding protein, putative; n=1; Pla...    37   0.57 
UniRef50_Q22A26 Cluster: Elongation factor Tu GTP binding domain...    37   0.57 
UniRef50_Q72ER1 Cluster: Translation initiation factor IF-2; n=3...    37   0.57 
UniRef50_O07170 Cluster: Elongation factor G-like protein; n=24;...    37   0.57 
UniRef50_Q1IY97 Cluster: Peptide chain release factor 3; n=1; De...    36   0.75 
UniRef50_A6DKQ3 Cluster: Translation initiation factor IF-2; n=1...    36   0.75 
UniRef50_Q20447 Cluster: Putative uncharacterized protein; n=2; ...    36   0.75 
UniRef50_Q5QTY8 Cluster: Translation initiation factor IF-2; n=1...    36   0.75 
UniRef50_Q7WHG2 Cluster: Translation initiation factor IF-2; n=2...    36   0.75 
UniRef50_Q4HK10 Cluster: Selenocysteine-specific translation elo...    36   0.99 
UniRef50_A7HB64 Cluster: Translation elongation factor G; n=2; A...    36   0.99 
UniRef50_A7QC01 Cluster: Chromosome chr10 scaffold_76, whole gen...    36   0.99 
UniRef50_Q9W2H0 Cluster: CG9841-PA; n=1; Drosophila melanogaster...    36   0.99 
UniRef50_Q7RJ38 Cluster: Elongation factor Tu family, putative; ...    36   0.99 
UniRef50_Q7QZ18 Cluster: GLP_464_49314_47878; n=2; Giardia intes...    36   0.99 
UniRef50_Q6MTQ0 Cluster: Translation initiation factor IF-2; n=2...    36   0.99 
UniRef50_UPI0000DA2C8C Cluster: PREDICTED: similar to myosin bin...    36   1.3  
UniRef50_UPI0000D56919 Cluster: PREDICTED: similar to CG31159-PA...    36   1.3  
UniRef50_Q7MWJ5 Cluster: GTP-binding protein TypA; n=31; Bacteri...    36   1.3  
UniRef50_Q1NNQ3 Cluster: Small GTP-binding protein domain; n=4; ...    36   1.3  
UniRef50_A5ZAJ3 Cluster: Putative uncharacterized protein; n=1; ...    36   1.3  
UniRef50_Q609C0 Cluster: Translation initiation factor IF-2; n=8...    36   1.3  
UniRef50_Q74CT3 Cluster: Translation initiation factor IF-2; n=2...    36   1.3  
UniRef50_Q5PAJ5 Cluster: Translation initiation factor IF-2; n=3...    36   1.3  
UniRef50_Q64MT7 Cluster: GTP-binding elongation factor family pr...    35   1.7  
UniRef50_Q5KNR0 Cluster: GTPase, putative; n=1; Filobasidiella n...    35   1.7  
UniRef50_Q5K8D2 Cluster: GTP-Binding protein lepA, putative; n=5...    35   1.7  
UniRef50_A1CA46 Cluster: Translation elongation factor G2, putat...    35   1.7  
UniRef50_Q6MMS6 Cluster: Translation initiation factor IF-2; n=1...    35   1.7  
UniRef50_Q8F983 Cluster: Elongation factor G; n=98; cellular org...    35   1.7  
UniRef50_Q1ZVV6 Cluster: GTP-binding regulator BipA/TypA; n=4; V...    35   2.3  
UniRef50_A6Q226 Cluster: Translation initiation factor IF-2; n=5...    35   2.3  
UniRef50_A6DBA3 Cluster: Translation initiation factor IF-2; n=1...    35   2.3  
UniRef50_A0JYS6 Cluster: GTP-binding protein TypA; n=101; Bacter...    35   2.3  
UniRef50_Q8I243 Cluster: Selenocysteine-specific elongation fact...    35   2.3  
UniRef50_Q4JA97 Cluster: GTP-binding protein 1; n=4; Sulfolobace...    35   2.3  
UniRef50_Q88T65 Cluster: GTP-binding protein lepA 2; n=2; Lactob...    35   2.3  
UniRef50_Q7VHF6 Cluster: Translation initiation factor IF-2; n=1...    35   2.3  
UniRef50_Q8R5Z1 Cluster: Translation initiation factor IF-2; n=3...    35   2.3  
UniRef50_Q2LWU6 Cluster: Bacterial protein translation Initiatio...    34   3.0  
UniRef50_Q4AGI8 Cluster: Elongation factor G, C-terminal:Protein...    34   3.0  
UniRef50_A6QBQ5 Cluster: Translation initiation factor IF-2; n=1...    34   3.0  
UniRef50_Q98RT0 Cluster: Eukaryotic translation initiation facto...    34   3.0  
UniRef50_Q4QHR7 Cluster: Eukaryotic translation initiation facto...    34   3.0  
UniRef50_A0E802 Cluster: Chromosome undetermined scaffold_82, wh...    34   3.0  
UniRef50_Q606M6 Cluster: Peptide chain release factor 3; n=3; Pr...    34   3.0  
UniRef50_Q9PGR3 Cluster: Translation initiation factor IF-2; n=2...    34   3.0  
UniRef50_Q4FVL5 Cluster: Translation initiation factor IF-2; n=1...    34   3.0  
UniRef50_Q3ZXU3 Cluster: Translation initiation factor IF-2; n=8...    34   3.0  
UniRef50_Q2RJM5 Cluster: Translation initiation factor IF-2; n=3...    34   4.0  
UniRef50_A6NTY0 Cluster: Putative uncharacterized protein; n=1; ...    34   4.0  
UniRef50_Q22AK9 Cluster: Translation elongation factor G; n=3; O...    34   4.0  
UniRef50_Q9WZN3 Cluster: Translation initiation factor IF-2; n=5...    34   4.0  
UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5...    34   4.0  
UniRef50_Q8EWU0 Cluster: Translation initiation factor IF-2; n=2...    34   4.0  
UniRef50_Q660H9 Cluster: Elongation factor G 2; n=3; Borrelia bu...    34   4.0  
UniRef50_P15112 Cluster: Elongation factor 2; n=2; Eukaryota|Rep...    34   4.0  
UniRef50_UPI0000D9AD7A Cluster: PREDICTED: similar to eukaryotic...    33   5.3  
UniRef50_Q9RXC2 Cluster: Elongation factor G; n=2; Deinococcus|R...    33   5.3  
UniRef50_Q7UN30 Cluster: Elongation factor G; n=2; Planctomyceta...    33   5.3  
UniRef50_Q73P52 Cluster: Translation elongation factor G, putati...    33   5.3  
UniRef50_A7P1C4 Cluster: Chromosome chr19 scaffold_4, whole geno...    33   5.3  
UniRef50_Q9VAV2 Cluster: CG12413-PA; n=7; Endopterygota|Rep: CG1...    33   5.3  
UniRef50_Q9N398 Cluster: Putative uncharacterized protein; n=1; ...    33   5.3  
UniRef50_Q4PDC2 Cluster: Putative uncharacterized protein; n=1; ...    33   5.3  
UniRef50_Q5FQM3 Cluster: Translation initiation factor IF-2; n=8...    33   5.3  
UniRef50_Q8FXT2 Cluster: Translation initiation factor IF-2; n=3...    33   5.3  
UniRef50_Q2S1N7 Cluster: Translation initiation factor IF-2; n=1...    33   7.0  
UniRef50_Q10878 Cluster: POSSIBLE FATTY-ACID-CoA LIGASE FADD10; ...    33   7.0  
UniRef50_A5KIG4 Cluster: Putative uncharacterized protein; n=1; ...    33   7.0  
UniRef50_A1ZR77 Cluster: Translation elongation factor G; n=2; B...    33   7.0  
UniRef50_A5K9R7 Cluster: Selenocysteine-specific elongation fact...    33   7.0  
UniRef50_Q872X0 Cluster: Putative uncharacterized protein B23B10...    33   7.0  
UniRef50_Q754P1 Cluster: AFR031Cp; n=1; Eremothecium gossypii|Re...    33   7.0  
UniRef50_A6R813 Cluster: Predicted protein; n=1; Ajellomyces cap...    33   7.0  
UniRef50_A1JVG8 Cluster: Elongation factor 1-alpha; n=2; Gibbere...    33   7.0  
UniRef50_Q5QXU1 Cluster: Peptide chain release factor 3; n=5; Ga...    33   7.0  
UniRef50_Q837X4 Cluster: Peptide chain release factor 3; n=47; F...    33   7.0  
UniRef50_Q6AJY4 Cluster: Translation initiation factor IF-2; n=3...    33   7.0  
UniRef50_P23081 Cluster: Elongation factor G; n=1; Geobacillus s...    33   7.0  
UniRef50_UPI00015BD5D6 Cluster: UPI00015BD5D6 related cluster; n...    33   9.2  
UniRef50_Q6ML87 Cluster: PrfC protein; n=1; Bdellovibrio bacteri...    33   9.2  
UniRef50_A6DY38 Cluster: Putative uncharacterized protein; n=1; ...    33   9.2  
UniRef50_A4E6U7 Cluster: Putative uncharacterized protein; n=1; ...    33   9.2  
UniRef50_A1AV99 Cluster: Translation initiation factor IF-2; n=3...    33   9.2  
UniRef50_A0NL43 Cluster: Translation initiation factor 2; n=2; O...    33   9.2  
UniRef50_Q98RS6 Cluster: U5 small nuclear ribonucleoprotein 116 ...    33   9.2  
UniRef50_A4S2B0 Cluster: Mitochondrial translation initiation fa...    33   9.2  
UniRef50_Q7R118 Cluster: GLP_12_49353_46915; n=1; Giardia lambli...    33   9.2  
UniRef50_Q0GFE8 Cluster: Eukaryotic translation initiation facto...    33   9.2  
UniRef50_A0BTU2 Cluster: Chromosome undetermined scaffold_128, w...    33   9.2  
UniRef50_Q6CDQ9 Cluster: Similar to DEHA0C03773g Debaryomyces ha...    33   9.2  
UniRef50_Q5KLM1 Cluster: GTP-binding protein 1 (G-protein 1), pu...    33   9.2  
UniRef50_Q5FLA9 Cluster: Peptide chain release factor 3; n=66; B...    33   9.2  
UniRef50_Q7VA20 Cluster: Translation initiation factor IF-2; n=2...    33   9.2  
UniRef50_P46199 Cluster: Translation initiation factor IF-2, mit...    33   9.2  
UniRef50_Q0AXN1 Cluster: Elongation factor G 1; n=1; Syntrophomo...    33   9.2  

>UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-like;
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           statin-like - Canis familiaris
          Length = 667

 Score =  279 bits (684), Expect = 5e-74
 Identities = 138/166 (83%), Positives = 143/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 288 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 347

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 348 ERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 407

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KE
Sbjct: 408 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKE 453



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPS 602
           S+YIKKIGYNPA V FVPISGWHGDNMLEPS
Sbjct: 455 SAYIKKIGYNPATVPFVPISGWHGDNMLEPS 485


>UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397;
           root|Rep: Elongation factor 1-alpha 2 - Homo sapiens
           (Human)
          Length = 463

 Score =  279 bits (684), Expect = 5e-74
 Identities = 138/166 (83%), Positives = 143/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKE 173



 Score =  121 bits (291), Expect = 2e-26
 Identities = 52/64 (81%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNPA V FVPISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD 
Sbjct: 175 SAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDT 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>UniRef50_P13905 Cluster: Elongation factor 1-alpha; n=2224;
           cellular organisms|Rep: Elongation factor 1-alpha -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 449

 Score =  248 bits (607), Expect = 1e-64
 Identities = 123/169 (72%), Positives = 135/169 (79%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  INIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLK
Sbjct: 5   KFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLK 64

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           AERER         +    +  C  IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FE
Sbjct: 65  AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFE 124

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           AGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KE
Sbjct: 125 AGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKE 173



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 25/39 (64%), Positives = 32/39 (82%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           SSY+KK+GYNP  + FVPISG+ GDNM+E ST + W+KG
Sbjct: 175 SSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKG 213


>UniRef50_Q5EMT9 Cluster: Elongation factor 1-alpha-like protein;
           n=6; Fungi/Metazoa group|Rep: Elongation factor
           1-alpha-like protein - Magnaporthe grisea (Rice blast
           fungus) (Pyricularia grisea)
          Length = 473

 Score =  245 bits (600), Expect = 7e-64
 Identities = 119/177 (67%), Positives = 143/177 (80%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+VVIGHVDSGKSTTTGHLIYK  GID+RTIEK+EKEA E+GKGSFKYAWVLDKLK
Sbjct: 6   KSHLNVVVIGHVDSGKSTTTGHLIYKLKGIDQRTIEKYEKEAAELGKGSFKYAWVLDKLK 65

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           AERER         +    +     IDAPGHRDFIKNMITGTSQADCA+L++ AGTGEFE
Sbjct: 66  AERERGITIDIALWKFETAKYQVTVIDAPGHRDFIKNMITGTSQADCAILVIGAGTGEFE 125

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRL 531
           AGISK+GQTREHALLAFTLGV+QLIV VNKMD+ +  +++ R++EI KE  +  +++
Sbjct: 126 AGISKDGQTREHALLAFTLGVRQLIVAVNKMDTAK--WAQSRYDEIVKETSNFLKKI 180



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 32/77 (41%), Positives = 49/77 (63%), Gaps = 13/77 (16%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKM--------PWFKGW-QVERKEGKAD- 659
           S+++KKIG+NP +V FVPISG++GD+M+  S  +        PW+KGW +   K+GK + 
Sbjct: 174 SNFLKKIGFNPDSVPFVPISGFNGDHMISESADIKGNISPNAPWYKGWTKTVNKDGKKEK 233

Query: 660 ---GKCLIEALDAILPP 701
              G  L +A+D + PP
Sbjct: 234 VIGGASLQDAIDDVTPP 250


>UniRef50_UPI0000EB0538 Cluster: UPI0000EB0538 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB0538 UniRef100
           entry - Canis familiaris
          Length = 357

 Score =  217 bits (529), Expect = 3e-55
 Identities = 119/166 (71%), Positives = 129/166 (77%), Gaps = 5/166 (3%)
 Frame = +1

Query: 10  INIVVIGHVDS--GKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           INI+VI H     GKSTTTGHLIYKCGGIDKRTIEKFE EA EMGKGSF+YAWVLDKLKA
Sbjct: 8   INIIVISHWMHRLGKSTTTGHLIYKCGGIDKRTIEKFE-EAAEMGKGSFRYAWVLDKLKA 66

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHI---DAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 354
           E E   H     + +   +   Y++   DA GH+  IKNMITGT QADCAVLIVAAG GE
Sbjct: 67  EHE---HGITVDISLWKFETSKYYVTITDATGHKH-IKNMITGTPQADCAVLIVAAGVGE 122

Query: 355 FEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFE 492
           FEAGISK GQTREHALLA TLGVKQL+VGVNK+DSTEPPYS  R E
Sbjct: 123 FEAGISKMGQTREHALLA-TLGVKQLVVGVNKIDSTEPPYSWKRVE 167


>UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porphyra
           purpurea|Rep: Elongation factor 1-alpha S - Porphyra
           purpurea
          Length = 515

 Score =  207 bits (506), Expect = 2e-52
 Identities = 105/167 (62%), Positives = 125/167 (74%), Gaps = 4/167 (2%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           IN+VVIGHVD+GKSTTTGHLIYK GGID RTI KFE +A+EMGK SFKYAWVLDKLKAER
Sbjct: 8   INLVVIGHVDAGKSTTTGHLIYKLGGIDARTIAKFEADAKEMGKSSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQAD A+L++      FEAGI
Sbjct: 68  ERGITIDIALWKFSTAKFEYTVIDAPGHRDFIKNMITGTSQADVALLVIDG--NNFEAGI 125

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEP----PYSEPRFEEI 498
           ++ G T+EHALLA+TLGVKQL VG+NKMD  +     P+++ R+ E+
Sbjct: 126 AEGGSTKEHALLAYTLGVKQLAVGINKMDDVKDKDGGPWAQGRYNEV 172



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 26/52 (50%), Positives = 29/52 (55%)
 Frame = +3

Query: 546 AVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPP 701
           +  FVPISGW GDNMLE ST MPW+             G  L E LDA+ PP
Sbjct: 215 SATFVPISGWTGDNMLEKSTNMPWY------------TGPTLFEVLDAMKPP 254


>UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellular
           organisms|Rep: Elongation factor 1-alpha - Sulfolobus
           solfataricus
          Length = 435

 Score =  186 bits (452), Expect = 6e-46
 Identities = 88/163 (53%), Positives = 119/163 (73%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N++VIGH+D GKST  G L+   G ID++T+++ E+ A+++GK S K+A++LD+LK ER
Sbjct: 7   LNLIVIGHIDHGKSTLVGRLLMDRGFIDEKTVKEAEEAAKKLGKESEKFAFLLDRLKEER 66

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER        +     +     IDAPGHRDF+KNMITG SQAD A+L+V+A  GE+EAG+
Sbjct: 67  ERGVTINLTFMRFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKGEYEAGM 126

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           S  GQTREH +LA T+G+ QLIV VNKMD TEPPY E R++EI
Sbjct: 127 SVEGQTREHIILAKTMGLDQLIVAVNKMDLTEPPYDEKRYKEI 169



 Score = 35.9 bits (79), Expect = 0.99
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVE 638
           S +++  G+N   V FVP+    GDN+   S  M W+ G  +E
Sbjct: 174 SKFMRSYGFNTNKVRFVPVVAPAGDNITHRSENMKWYNGPTLE 216


>UniRef50_P90922 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 610

 Score =  180 bits (439), Expect = 2e-44
 Identities = 91/166 (54%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ + ER
Sbjct: 189 INLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDETEEER 248

Query: 190 ERRYHNRY--CSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           ER         S E  + +++   +DAPGH+DFI NMITGTSQAD A+L+V A TGEFE 
Sbjct: 249 ERGVTMDIGRTSFETSHRRIVL--LDAPGHKDFISNMITGTSQADAAILVVNATTGEFET 306

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
           G    GQT+EHALL  +LGV QLIV VNK+D+ +  +S+ RF+EIK
Sbjct: 307 GFENGGQTKEHALLLRSLGVTQLIVAVNKLDTVD--WSQDRFDEIK 350


>UniRef50_Q9Y450 Cluster: HBS1-like protein; n=43; Euteleostomi|Rep:
           HBS1-like protein - Homo sapiens (Human)
          Length = 684

 Score =  175 bits (425), Expect = 1e-42
 Identities = 87/163 (53%), Positives = 110/163 (67%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+   ER
Sbjct: 261 LNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEER 320

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +      +   +DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
              GQTREH LL  +LGV QL V VNKMD     + + RF+EI
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEI 421



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           ++K+ G+  + V F+P SG  G+N++  S      K ++         G CL+E +D+  
Sbjct: 428 FLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFK 478

Query: 696 PP 701
           PP
Sbjct: 479 PP 480


>UniRef50_O93729 Cluster: Elongation factor 1-alpha; n=20;
           Archaea|Rep: Elongation factor 1-alpha - Pyrobaculum
           aerophilum
          Length = 444

 Score =  166 bits (404), Expect = 4e-40
 Identities = 77/166 (46%), Positives = 110/166 (66%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           IN+ V+GHVD+GKST  G L+Y+ G +D++ +++ E+ A+++GK  F +AW+LD+ K ER
Sbjct: 18  INLAVVGHVDNGKSTLVGRLLYETGYVDEKALKEIEEMAKKIGKEDFAFAWILDRFKEER 77

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER        +     ++    ID PGHRDF+KNMI G SQAD A+ +++A  GEFEA I
Sbjct: 78  ERGVTIEATHVGFETNKLFITIIDLPGHRDFVKNMIVGASQADAALFVISARPGEFEAAI 137

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
              GQ REH  L  TLGV+Q++V VNKMD     Y + R+E++K E
Sbjct: 138 GPQGQGREHLFLIRTLGVQQIVVAVNKMDVVN--YDQKRYEQVKAE 181



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           S  +K +GY+P+ + F+P+S   GDN+   S+  PW+ G
Sbjct: 183 SKLLKLLGYDPSKIHFIPVSAIKGDNIKTKSSNTPWYTG 221


>UniRef50_A2QW82 Cluster: Contig An11c0160, complete genome; n=8;
            Eurotiomycetidae|Rep: Contig An11c0160, complete genome -
            Aspergillus niger
          Length = 809

 Score =  163 bits (397), Expect = 3e-39
 Identities = 89/220 (40%), Positives = 131/220 (59%), Gaps = 2/220 (0%)
 Frame = +1

Query: 10   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
            +N  VIGHVD+GKST  G L+     +D+RT+EK+ KEA+++GKGSF  AWVLD+   ER
Sbjct: 402  MNFAVIGHVDAGKSTLMGRLLADLKAVDQRTLEKYRKEAEKIGKGSFALAWVLDQGSEER 461

Query: 190  ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
             R       + +      +   +DAPGHRDF+ NMI G SQAD AVL++ +  G FE+G+
Sbjct: 462  ARGVTIDIATNKFETESTVFTIVDAPGHRDFVPNMIAGASQADFAVLVIDSSIGNFESGL 521

Query: 370  SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPH--TSRRLATTQ 543
               GQT+EHALL  ++GV+++I+ VNKMDS +  + + RFEEI+++     T+       
Sbjct: 522  --KGQTKEHALLVRSMGVQRIIIAVNKMDSVQ--WDQGRFEEIEQQVSSFLTTAGFQAKN 577

Query: 544  LLSLSCPFLDGTETTCWSLQPKCLGSRDGRWSVRKAKLTE 663
            +  + C  + G   T  S  P  +    GR  + + + TE
Sbjct: 578  IAFVPCSGISGDNVTRRSEDPN-VSWYKGRTLIEELEATE 616


>UniRef50_Q8IIC9 Cluster: Translation elongation factor EF-1,
           subunit alpha, putative; n=11; Apicomplexa|Rep:
           Translation elongation factor EF-1, subunit alpha,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 555

 Score =  163 bits (395), Expect = 5e-39
 Identities = 80/169 (47%), Positives = 112/169 (66%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  +NI+ IGHVD+GKST  G+++Y  G +D RTIEK+E+EA+E  + S+  A+++D  +
Sbjct: 117 RPHLNIIFIGHVDAGKSTACGNILYILGYVDDRTIEKYEREAKEKSRESWFLAFIMDINE 176

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER++                    +DAPGH++FI NMI+G +QAD  VLI++A  GEFE
Sbjct: 177 EERQKGKTVEVGRAHFETKDRRFTILDAPGHKNFIPNMISGAAQADIGVLIISARKGEFE 236

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
            G  + GQTREH LLA TLG+ QLIV +NKMD     +SE R+EEI+K+
Sbjct: 237 TGFERGGQTREHTLLARTLGINQLIVAINKMDDPTCNWSESRYEEIQKK 285


>UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1;
           Pneumocystis carinii|Rep: Eukaryotic release factor 3 -
           Pneumocystis carinii
          Length = 629

 Score =  163 bits (395), Expect = 5e-39
 Identities = 78/169 (46%), Positives = 112/169 (66%), Gaps = 4/169 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G+++Y  G +DKRT+EK+EK+A+E G+ S+  +W LD  K
Sbjct: 200 KEHVNVVFIGHVDAGKSTLGGNILYMTGMVDKRTMEKYEKDAKEAGRESWYLSWALDSTK 259

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER +         Y   E R   +L    DAPGH+ ++ NMI GT+QA+ AVL+++A  
Sbjct: 260 EERSKGKTVELGRAYFETEKRRYTIL----DAPGHKSYVPNMIEGTAQAEVAVLVISARK 315

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEE 495
           GE+E G  K GQTREHA+L+ T GV +LIV +NKMD     +S+ R++E
Sbjct: 316 GEYETGFEKGGQTREHAMLSKTQGVSKLIVAINKMDDPTVEWSKERYDE 364


>UniRef50_P15170 Cluster: G1 to S phase transition protein 1
           homolog; n=77; Eukaryota|Rep: G1 to S phase transition
           protein 1 homolog - Homo sapiens (Human)
          Length = 499

 Score =  163 bits (395), Expect = 5e-39
 Identities = 81/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W LD  +
Sbjct: 72  KEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ 131

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER++         Y   E ++  +L    DAPGH+ F+ NMI G SQAD AVL+++A  
Sbjct: 132 EERDKGKTVEVGRAYFETEKKHFTIL----DAPGHKSFVPNMIGGASQADLAVLVISARK 187

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           GEFE G  K GQTREHA+LA T GVK LIV +NKMD     +S  R+EE K++
Sbjct: 188 GEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEK 240



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++KK+G+NP   + F+P SG  G N+ E S   PW+ G
Sbjct: 244 FLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIG 281


>UniRef50_A6RA16 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 957

 Score =  161 bits (392), Expect = 1e-38
 Identities = 81/165 (49%), Positives = 112/165 (67%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N VVIGHVD+GKST  G L+Y+   +D+RTI++++KEA  +GKGSF  AWVLD+   ER 
Sbjct: 425 NFVVIGHVDAGKSTLMGRLLYELKAVDQRTIDRYQKEADRIGKGSFALAWVLDQGSEERA 484

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R       +            +DAPGHRDF+ NMI G SQAD AVL++ A TG FE+G+ 
Sbjct: 485 RGVTIDIATNRFATENTNFTILDAPGHRDFVPNMIAGASQADFAVLVLDATTGNFESGL- 543

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             GQT+EHALL  ++GV++++V VNKMD+    +S  RF+EI+++
Sbjct: 544 -RGQTKEHALLVRSMGVQRIVVAVNKMDAA--GWSHDRFDEIQQQ 585



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
 Frame = +3

Query: 498 QEGRSSYIKKIGYNPAAVAFVPISGWHGDNMLEPS--TKMPWFKG 626
           Q+  +S++   G+    ++FVP SG  GDN+ + +  T   W+ G
Sbjct: 583 QQQTASFLTTAGFQAKNISFVPCSGLRGDNVAQRAHDTNASWYTG 627


>UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=2; Schizosaccharomyces pombe|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Schizosaccharomyces pombe (Fission yeast)
          Length = 662

 Score =  161 bits (392), Expect = 1e-38
 Identities = 83/182 (45%), Positives = 114/182 (62%), Gaps = 4/182 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +NIV IGHVD+GKST  G++++  G +DKRT+EK E+EA+E GK S+  +W LD   
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKESWYLSWALDSTS 295

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ERE+         Y   E R   +L    DAPGH+ ++ NMI G SQAD  VL+++A  
Sbjct: 296 EEREKGKTVEVGRAYFETEHRRFSLL----DAPGHKGYVTNMINGASQADIGVLVISARR 351

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRR 528
           GEFEAG  + GQTREHA+LA T G+  L+V +NKMD     +SE R++E   +     RR
Sbjct: 352 GEFEAGFERGGQTREHAVLARTQGINHLVVVINKMDEPSVQWSEERYKECVDKLSMFLRR 411

Query: 529 LA 534
           +A
Sbjct: 412 VA 413


>UniRef50_UPI0000D55B6A Cluster: PREDICTED: similar to CG1898-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1898-PA - Tribolium castaneum
          Length = 792

 Score =  161 bits (391), Expect = 2e-38
 Identities = 79/169 (46%), Positives = 112/169 (66%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  + +VVIGHVD+GKST  GHL+Y  G ++++T+ K+E+E++++GK SF YAWVLD+  
Sbjct: 366 KEHLYMVVIGHVDAGKSTLMGHLLYDLGQVNQKTMHKYEQESRKVGKQSFMYAWVLDETG 425

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER R         +          +DAPGH+DFI NMI+G  QAD A+L+V A  GEFE
Sbjct: 426 EERNRGITMDVGRSQFETKSKHVTLLDAPGHKDFIPNMISGAGQADVALLVVDATRGEFE 485

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
            G    GQTREHALL  +LGV QL V +NK+D+    +S+ RF++I ++
Sbjct: 486 TGFDFGGQTREHALLVRSLGVTQLAVAINKLDTVS--WSKERFDDISQK 532


>UniRef50_A2AX44 Cluster: Translation elongation factor 1 like;
           n=37; Eukaryota|Rep: Translation elongation factor 1
           like - Guillardia theta (Cryptomonas phi)
          Length = 472

 Score =  161 bits (391), Expect = 2e-38
 Identities = 86/177 (48%), Positives = 115/177 (64%), Gaps = 8/177 (4%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  ++IV+ GHVDSGKSTTTG L+++ GGI +R +EK ++EA  +GK SF +A+ +D+ K
Sbjct: 4   KEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLKEEAANLGKSSFAFAFYMDRQK 63

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ERER       + E    +     IDAPGHRDFIKNMI+G++QAD A+L+V A  G F 
Sbjct: 64  EERERGVTIACTTKEFFTDKWHYTIIDAPGHRDFIKNMISGSAQADVALLMVPA-DGNFT 122

Query: 361 AGISK--------NGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             I K         GQTR+HA +   LG+KQLIVG+NKMDS    Y E R+ EI+ E
Sbjct: 123 TAIQKGDAKAGEIQGQTRQHARILNLLGIKQLIVGINKMDSDTAGYKEERYNEIRDE 179



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/47 (48%), Positives = 29/47 (61%)
 Frame = +3

Query: 543 AAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEAL 683
           A+V  +PISGW GDN+L  ST M W+ G +V   +G  D K  IE L
Sbjct: 196 ASVPVIPISGWMGDNLLTKSTNMGWWSGVEVV-PDGSTD-KMKIETL 240


>UniRef50_O45622 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 532

 Score =  161 bits (390), Expect = 2e-38
 Identities = 85/199 (42%), Positives = 121/199 (60%), Gaps = 7/199 (3%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  IN+V +GHVD+GKST  G L++  G +DKRT+EK+E+EA+E G+ S+  +W +D   
Sbjct: 107 KEHINMVFVGHVDAGKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMDTND 166

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ERE+         Y   E R+  +L    DAPGH+ F+ NMI G +QAD AVL+++A  
Sbjct: 167 EEREKGKTVEVGRAYFETEKRHFTIL----DAPGHKSFVPNMIVGANQADLAVLVISARR 222

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRR 528
           GEFE G  + GQTREH++L  T GVK L++ VNKMD     + E RF+EI+ +     R+
Sbjct: 223 GEFETGFDRGGQTREHSMLVKTAGVKHLVILVNKMDDPTVKWEEERFKEIEGKLTPFLRK 282

Query: 529 LA---TTQLLSLSCPFLDG 576
           L     T +  + C  L G
Sbjct: 283 LGFNPKTDITYVPCSGLTG 301


>UniRef50_Q86NR4 Cluster: RE29053p; n=5; Diptera|Rep: RE29053p -
           Drosophila melanogaster (Fruit fly)
          Length = 670

 Score =  160 bits (389), Expect = 3e-38
 Identities = 79/166 (47%), Positives = 110/166 (66%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  I+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+  
Sbjct: 245 KSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDETG 304

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER R          +     +   +DAPGH+DFI NMI+G +QAD A+L+V A  GEFE
Sbjct: 305 EERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFE 364

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           +G    GQTREHA+L  +LGV QL V +NK+D+    +S+ RF EI
Sbjct: 365 SGFELGGQTREHAILVRSLGVNQLGVVINKLDTV--GWSQDRFTEI 408


>UniRef50_A6RVA8 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 756

 Score =  160 bits (389), Expect = 3e-38
 Identities = 80/169 (47%), Positives = 113/169 (66%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           ++  N VVIGHVD+GKST  G L+Y    +D+RT++++ KEA+ MGK SF  AWVLD+  
Sbjct: 345 KNAANFVVIGHVDAGKSTLMGRLLYDLKVVDQRTVDRYRKEAEAMGKSSFALAWVLDQGT 404

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER R         +    +     +DAPGHRDFI NMI G SQAD AVL++ A  G FE
Sbjct: 405 EERSRGVTIDIAMNKFETEKTTFTILDAPGHRDFIPNMIAGASQADFAVLVIDASVGSFE 464

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           +G+   GQT+EHALLA ++GV+++I+ VNK+D+    +S+ RF+EI ++
Sbjct: 465 SGL--KGQTKEHALLARSMGVQRIIIAVNKLDTV--GWSQERFDEISQQ 509



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKM--PWFKG 626
           S+++   G+    + F+P SG HGDN+   ST+    W+ G
Sbjct: 511 SAFLTAAGFQEQNIKFIPCSGLHGDNIARKSTEQAAAWYTG 551


>UniRef50_Q00WU5 Cluster: EF-1 alpha-like protein; n=1; Ostreococcus
           tauri|Rep: EF-1 alpha-like protein - Ostreococcus tauri
          Length = 444

 Score =  159 bits (387), Expect = 5e-38
 Identities = 86/177 (48%), Positives = 113/177 (63%), Gaps = 8/177 (4%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  ++IV+ GHVDSGKSTTTG L+++ GGI +R +EK + EA  +GK SF +A+ +D+ K
Sbjct: 12  KEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLKAEADALGKSSFAFAFYMDRQK 71

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ERER       + E    +     IDAPGHRDFIKNMI+G +QAD A+L+V A  G F 
Sbjct: 72  EERERGVTISCTTKEFFTEKWHYTIIDAPGHRDFIKNMISGAAQADVALLMVPA-DGNFT 130

Query: 361 AGISK--------NGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             I K         GQTR+HA L   LGVKQLI+G+NKMD     Y + R+EEI+ E
Sbjct: 131 VAIQKGNHKAGEVQGQTRQHARLLNLLGVKQLIIGINKMDCDMAGYKQERYEEIRNE 187



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 15/29 (51%), Positives = 20/29 (68%)
 Frame = +3

Query: 525 KIGYNPAAVAFVPISGWHGDNMLEPSTKM 611
           K  Y   +V  +PISGW+GDN+L+ S KM
Sbjct: 198 KKDYVEKSVPVLPISGWNGDNLLKKSEKM 226


>UniRef50_Q9NCN7 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Trichomonas vaginalis|Rep: Eukaryotic
           release factor 3 GTPase subunit - Trichomonas vaginalis
          Length = 587

 Score =  158 bits (384), Expect = 1e-37
 Identities = 77/178 (43%), Positives = 111/178 (62%), Gaps = 1/178 (0%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +   NIV IGHVD+GKST  GH++Y+ G +D+RTIE+++ E+ + G+GS+ ++WV+D  K
Sbjct: 160 KKHFNIVFIGHVDAGKSTLCGHVLYQAGCVDQRTIEQYQAESAKEGRGSWYFSWVMDLSK 219

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER +              Q     +DAPGHR ++  MI G  QAD AVL+++A  GEFE
Sbjct: 220 EERSKGKTEEVGVAHFETAQNKYTILDAPGHRSYVPQMIGGAVQADVAVLVISARNGEFE 279

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI-KKEDPHTSRRL 531
           AG    GQT EH L+A T GV+++I+ VNKMD     +S+ RF++I  K  P   R +
Sbjct: 280 AGFENGGQTSEHLLIARTAGVREIIIVVNKMDDPTVKWSKERFDQIVTKFTPFIEREI 337


>UniRef50_P32769 Cluster: Elongation factor 1 alpha-like protein;
           n=2; Saccharomyces cerevisiae|Rep: Elongation factor 1
           alpha-like protein - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 611

 Score =  158 bits (384), Expect = 1e-37
 Identities = 74/166 (44%), Positives = 108/166 (65%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           ++ VV+GHVD+GKST  G L+Y    +++  + K ++E++ MGK SFK+AW++D+   ER
Sbjct: 168 LSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEER 227

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER      C+      +     +DAPGHRDF+ N I G SQAD A+L V   T  FE+G 
Sbjct: 228 ERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGF 287

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             +GQT+EH LLA +LG+  LI+ +NKMD+ +  +S+ RFEEIK +
Sbjct: 288 DLDGQTKEHMLLASSLGIHNLIIAMNKMDNVD--WSQQRFEEIKSK 331


>UniRef50_Q5UHI3 Cluster: EF-1 alpha-like protein; n=6;
           Eukaryota|Rep: EF-1 alpha-like protein - Bigelowiella
           natans (Pedinomonas minutissima) (Chlorarachnion
           sp.(strain CCMP 621))
          Length = 513

 Score =  158 bits (383), Expect = 1e-37
 Identities = 84/173 (48%), Positives = 110/173 (63%), Gaps = 8/173 (4%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           + +V++GHVD+GKSTTTGHL+++ G +D+R       +A+EM K SF +A+ +DK K ER
Sbjct: 22  LGVVIVGHVDAGKSTTTGHLLFELGTMDERAKADLIAKAKEMKKESFAFAFFMDKQKEER 81

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER       + E          IDAPGH+DFIKNMI+G SQAD A+L+V A  G FEA I
Sbjct: 82  ERGVTISCTTKEFHTTNFHYTVIDAPGHKDFIKNMISGASQADVALLMVPAKKGGFEAAI 141

Query: 370 SK--------NGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
            K         GQTR HA L   LG++Q+IVGVNKMD     Y + R++EIKK
Sbjct: 142 QKGEGGDAANKGQTRHHAELTKLLGIQQIIVGVNKMDEKSVKYDQARYKEIKK 194



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = +3

Query: 540 PAAVAFVPISGWHGDNMLEPSTKMPWF--KGWQVERKEG-KADGKCLIEALDAILPP 701
           P  +  +PISGW GDN++ PSTKMPWF  KGW      G K  G+ L +ALD  + P
Sbjct: 224 PNLIPVIPISGWCGDNLIVPSTKMPWFNKKGWTATTPSGVKTKGETLFQALDQFVEP 280


>UniRef50_Q7YZN7 Cluster: Hsp70 subfamily B suppressor 1; n=3;
           Dictyostelium discoideum|Rep: Hsp70 subfamily B
           suppressor 1 - Dictyostelium discoideum (Slime mold)
          Length = 317

 Score =  157 bits (382), Expect = 2e-37
 Identities = 80/151 (52%), Positives = 103/151 (68%)
 Frame = +1

Query: 46  KSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERRYHNRYCSLE 225
           KSTT GH+++K G +DKRT+ KFE E+  MGK SF +AWVLD+ + ERER      C   
Sbjct: 1   KSTTMGHILFKLGYVDKRTMSKFENESNRMGKSSFHFAWVLDEQEEERERGVTMDVCVRY 60

Query: 226 VRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 405
                     +DAPGHRDFI NMI+GT+QAD A+L++ A   EFEAG S  GQT+EHALL
Sbjct: 61  FETEHRRITLLDAPGHRDFIPNMISGTTQADVAILLINA--SEFEAGFSAEGQTKEHALL 118

Query: 406 AFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           A +LG+ +LIV VNKMDS E  + + R++ I
Sbjct: 119 AKSLGIMELIVAVNKMDSIE--WDQSRYDYI 147


>UniRef50_Q4P6P7 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 965

 Score =  157 bits (382), Expect = 2e-37
 Identities = 79/164 (48%), Positives = 108/164 (65%)
 Frame = +1

Query: 7    EINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 186
            E+++VV+GHVD+GKST  G ++ + G + +R     E+ +Q++GKGSF YAW LD  + E
Sbjct: 529  ELSLVVVGHVDAGKSTLMGRMLLELGSLSQREYSTNERASQKIGKGSFAYAWALDSSEEE 588

Query: 187  RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
            RER                    +DAPGHRDFI NMI+G +QAD A+L+V +  G FEAG
Sbjct: 589  RERGVTIDIAQDHFSTQHRTFTLLDAPGHRDFIPNMISGAAQADSALLVVDSIQGAFEAG 648

Query: 367  ISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
               NGQTREHALL  +LGV+QL+V VNK+D+    YS+ R++EI
Sbjct: 649  FGPNGQTREHALLVRSLGVQQLVVVVNKLDAV--GYSQERYDEI 690


>UniRef50_A3LY56 Cluster: Predicted protein; n=2; Pichia|Rep:
           Predicted protein - Pichia stipitis (Yeast)
          Length = 581

 Score =  157 bits (382), Expect = 2e-37
 Identities = 75/165 (45%), Positives = 107/165 (64%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           + VVIGHVD+GKST  G +++  G +D RT+ +  KEA+  GKGSF  AW++D+   ER 
Sbjct: 149 SFVVIGHVDAGKSTLMGRILFDYGIVDARTVNRLVKEAENAGKGSFALAWIMDQTAEERS 208

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
                  C+ +          IDAPGH+DF+  MI G SQAD A+L+V + TGEFEAG +
Sbjct: 209 HGVTVDICATDFETPTTRFTAIDAPGHKDFVPQMIGGVSQADLALLVVDSITGEFEAGFA 268

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
            +GQT+EH +LA  LG++++ V VNK+D  +  ++E RFE IK +
Sbjct: 269 MDGQTKEHTILAKNLGIERICVAVNKLDKED--WNEERFESIKTQ 311


>UniRef50_A5X901 Cluster: Elongation factor 1-alpha; n=2;
           Chilodonella uncinata|Rep: Elongation factor 1-alpha -
           Chilodonella uncinata
          Length = 403

 Score =  156 bits (379), Expect = 4e-37
 Identities = 77/161 (47%), Positives = 107/161 (66%), Gaps = 5/161 (3%)
 Frame = +1

Query: 40  SGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERRYHNRYCS 219
           SGKST   HL Y CGG+D+RT   ++++ + MG     + W++D+ + +R+R    R   
Sbjct: 1   SGKSTIVAHLAYLCGGLDRRTRMDYDEQRKLMGDKPLSFGWLMDRYRTDRDRY---REIG 57

Query: 220 LEVRN*QVLCYH-----IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 384
           +++   Q+   +     +DAPGHRDF+K++ITG  QAD  +L+V A  GEFEAGISK+GQ
Sbjct: 58  IDIHKTQIYTENRNYMLVDAPGHRDFVKSLITGVCQADFCLLVVVAAAGEFEAGISKDGQ 117

Query: 385 TREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           TRE ALLA+TLGVKQ IV V+KMD     YS+ RF EI+ E
Sbjct: 118 TREQALLAYTLGVKQFIVVVSKMDHKSVNYSQIRFAEIQTE 158



 Score = 36.3 bits (80), Expect = 0.75
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +3

Query: 525 KIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           K+G     + FV IS W GDN+ + S  M W++G
Sbjct: 165 KMGVKADQIPFVAISAWFGDNIKDRSGNMAWYQG 198


>UniRef50_Q96TP0 Cluster: Elongation factor 1 alpha; n=5;
           Fungi/Metazoa group|Rep: Elongation factor 1 alpha -
           Gibberella intermedia (Bulb rot disease fungus)
           (Fusariumproliferatum)
          Length = 108

 Score =  156 bits (378), Expect = 6e-37
 Identities = 75/100 (75%), Positives = 81/100 (81%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVDSGKSTTTGHLIY+CGGIDKRTIEKFEKEA E+GKGSFKYAWVLDKLKAER
Sbjct: 9   LNVVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAER 68

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTS 309
           ER         +    +     IDAPGHRDFIKNMITGTS
Sbjct: 69  ERGITIDIALWKFETPRYYVTVIDAPGHRDFIKNMITGTS 108


>UniRef50_Q6BVD7 Cluster: Similar to sp|P32769 Saccharomyces
           cerevisiae YKR084c HBS1; n=5; Saccharomycetales|Rep:
           Similar to sp|P32769 Saccharomyces cerevisiae YKR084c
           HBS1 - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 600

 Score =  155 bits (377), Expect = 8e-37
 Identities = 75/163 (46%), Positives = 107/163 (65%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           + VVIGHVD+GKST  G L++  G ID +T+    ++++++GKGSF  AW++D+   ER 
Sbjct: 168 SFVVIGHVDAGKSTLMGRLLFDLGVIDAKTVNNLVRQSEKIGKGSFALAWIMDQTSEERS 227

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R      C+            IDAPGH+DF+  MI+G SQAD A+L++ + TGEFE+G +
Sbjct: 228 RGVTVDICATNFETETSRFTAIDAPGHKDFVPQMISGVSQADFALLVIDSITGEFESGFT 287

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
            +GQT+EH +LA  LG+ +L V VNKMD     +SE RFE+IK
Sbjct: 288 MDGQTKEHTILAKNLGIARLCVVVNKMDKEN--WSERRFEDIK 328


>UniRef50_Q9NCN8 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Giardia intestinalis|Rep: Eukaryotic
           release factor 3 GTPase subunit - Giardia lamblia
           (Giardia intestinalis)
          Length = 465

 Score =  155 bits (376), Expect = 1e-36
 Identities = 76/169 (44%), Positives = 113/169 (66%), Gaps = 3/169 (1%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  +NIV IGHVD+GKST +GHL+   G +DKR +EK E++A+ + + S+KYA+ +D  +
Sbjct: 14  RKNLNIVFIGHVDAGKSTISGHLVSDLGKLDKRQLEKLEQQAKALNRESWKYAFAMDTSE 73

Query: 181 AERERRYHNRYCSLE---VRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
            ERE+      C+ E     N + +   IDAPGH+ F+ NMI+G +QAD A+L+++A  G
Sbjct: 74  EEREKG-KTVECARESFLTPNGRRITI-IDAPGHKGFVHNMISGAAQADTAILVISARKG 131

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           EFE+G  + GQT EHALLA+  G+KQ++  +NKMD     Y + R++ I
Sbjct: 132 EFESGFERGGQTSEHALLAYVNGIKQIVCLINKMDDITVEYCKKRYDSI 180



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGW 629
           Y++ +GY    + F+PISG+ G+N++      P    W
Sbjct: 187 YLENVGYASKNIFFLPISGFTGENLISTKELNPKLSEW 224


>UniRef50_O74774 Cluster: Elongation factor 1 alpha related protein;
           n=1; Schizosaccharomyces pombe|Rep: Elongation factor 1
           alpha related protein - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 592

 Score =  154 bits (373), Expect = 2e-36
 Identities = 77/164 (46%), Positives = 103/164 (62%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +++VV GHVDSGKST  G ++++ G I+ R+++K   EA   GKGSF YAW+LD  + ER
Sbjct: 178 VHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTEEER 237

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R       S    + + +    DAPGHRDFI  MI G S AD AVL+V +    FE G 
Sbjct: 238 ARGVTMDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFERGF 297

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
            +NGQTREHA L   LG+ +++V VNK+D     +SE RF+EIK
Sbjct: 298 LENGQTREHAYLLRALGISEIVVSVNKLDLMS--WSEDRFQEIK 339


>UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 654

 Score =  153 bits (372), Expect = 3e-36
 Identities = 75/164 (45%), Positives = 108/164 (65%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N VV+GHVD GKST  G L+Y    +D+R+++K  KEA+ +GK SF  AW++D+   ER 
Sbjct: 245 NFVVVGHVDHGKSTLMGRLLYDLKVVDQRSLDKLRKEAETIGKSSFALAWIMDETSEERS 304

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R       +      +     +DAPGH+DFI NMI+G+SQAD  VL++ A T  FEAG+ 
Sbjct: 305 RGVTVDIATNYFETEKTRFTILDAPGHKDFIPNMISGSSQADFPVLVIDASTNSFEAGL- 363

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
             GQT+EH L+A ++G++ +IV VNKMD+    +S+PRF++I K
Sbjct: 364 -KGQTKEHILIARSMGMQHIIVAVNKMDTVS--WSKPRFDDISK 404


>UniRef50_Q759Q2 Cluster: ADR221Cp; n=3; Saccharomycetales|Rep:
           ADR221Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 614

 Score =  152 bits (369), Expect = 7e-36
 Identities = 73/166 (43%), Positives = 107/166 (64%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           ++ VV+GHVD+GKST  G L+Y  G +D + I + ++E++  GKGSF  AWV+D+   ER
Sbjct: 178 MSFVVLGHVDAGKSTLMGRLLYDVGAVDTKLIRQLKRESELAGKGSFHLAWVMDQTNEER 237

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R      C+ E    +     IDAPGHRDF+ N +TG + AD A++ +   T  FE+G 
Sbjct: 238 ARGVTVDICTSEFETAKSTFTVIDAPGHRDFVPNAVTGVNLADVAIVTIDCATDAFESGF 297

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           + +GQTREH +LA +LGVK +I+ +NKMD+ E  + E RF+ I+ E
Sbjct: 298 NLDGQTREHIILARSLGVKHIILAMNKMDTVE--WHEGRFKAIRLE 341


>UniRef50_UPI0000499ED8 Cluster: guanine nucleotide regulatory
           protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep:
           guanine nucleotide regulatory protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 488

 Score =  152 bits (368), Expect = 1e-35
 Identities = 77/196 (39%), Positives = 118/196 (60%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +   NI+ IGHVD+GKSTT+G+++++ G I++R I+KFEKEA+E  + S+  A+++D+++
Sbjct: 59  KESANIIFIGHVDAGKSTTSGNILFQSGNIEQRIIDKFEKEAKENQRESWWLAYIMDQIE 118

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            E+ +              +     +DAPGHR F+ NMI+  +QAD AVLIV+A  GEFE
Sbjct: 119 EEKSKGITIDVGRALFETEKRRYTILDAPGHRSFVPNMISAAAQADIAVLIVSARKGEFE 178

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATT 540
            G  K GQTREH+ L  T GVK +I+ VNKMD     + + R++EI  +     R+   +
Sbjct: 179 TGFDKGGQTREHSQLCRTAGVKTVIIAVNKMDEKTVGWEKSRYDEIVNKVKPFLRQCGFS 238

Query: 541 QLLSLSCPFLDGTETT 588
            + S+      G   T
Sbjct: 239 DIYSIPISGFSGLNLT 254


>UniRef50_Q9HGI4 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=2; Zygosaccharomyces rouxii|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Zygosaccharomyces rouxii (Candida mogii)
          Length = 662

 Score =  152 bits (368), Expect = 1e-35
 Identities = 74/172 (43%), Positives = 110/172 (63%), Gaps = 4/172 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  ++I+ +GHVD+GKST  G+++Y  G +DKRT+EK+E+EA++ GK  +  +WV+D  +
Sbjct: 235 KDHMSIIFMGHVDAGKSTMGGNILYMTGSVDKRTVEKYEREAKDAGKQGWYLSWVMDTNR 294

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER+          Y   E R   +L    DAPGH+ ++  MI G SQAD  +L+++A  
Sbjct: 295 EERDDGKTIEVGRAYFETEKRRYTIL----DAPGHKMYVSEMIGGASQADVGILVISARK 350

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
           GE+E G  K GQTREHALLA T GV +LIV +NKMD     +S+ R+++  K
Sbjct: 351 GEYETGFEKGGQTREHALLAKTQGVNKLIVTINKMDDPTVNWSKERYDQCVK 402


>UniRef50_A4ZCD1 Cluster: GTP-binding protein; n=9;
           Magnoliophyta|Rep: GTP-binding protein - Triticum
           aestivum (Wheat)
          Length = 533

 Score =  151 bits (367), Expect = 1e-35
 Identities = 74/167 (44%), Positives = 108/167 (64%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           RH IN+V IGHVD+GKST  G +++  G +D RTI+K+EKEA++  + S+  A+++D  +
Sbjct: 91  RH-INLVFIGHVDAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDTNE 149

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER +                    +DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE
Sbjct: 150 EERLKGKTVEVGRAHFETENTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFE 209

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
            G  + GQTREH LLA TLGV +L+V +NKMD     +S+ R++EI+
Sbjct: 210 TGYERGGQTREHVLLAKTLGVAKLVVVINKMDEPTVQWSKERYDEIE 256


>UniRef50_A7RM15 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 473

 Score =  151 bits (367), Expect = 1e-35
 Identities = 82/182 (45%), Positives = 110/182 (60%), Gaps = 13/182 (7%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFE-------------KEAQEMGKGSF 150
           +N+V+IGHVD+GKST  GHL++  G + K+ + K+               E+++ GK SF
Sbjct: 39  LNLVIIGHVDAGKSTLMGHLLFLLGDVSKKAMHKYPFFFLIIIFNLKACTESKKAGKASF 98

Query: 151 KYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVL 330
            YAWVLD+   ERER           +    +   +DAPGH+DFI NMITG +QAD A+L
Sbjct: 99  AYAWVLDETGEERERGITMDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAIL 158

Query: 331 IVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKED 510
           +V A TGEFEAG    GQTREHA+L  +LGV QLIV +NK+D     +SE R+  I  + 
Sbjct: 159 VVDAITGEFEAGFESGGQTREHAILVRSLGVTQLIVAINKLDMMS--WSEERYLHIVSKL 216

Query: 511 PH 516
            H
Sbjct: 217 KH 218



 Score = 39.9 bits (89), Expect = 0.061
 Identities = 18/62 (29%), Positives = 36/62 (58%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           ++K++G+  + V +VP+SG  G+N+++P T+    K +Q         G+CL++ +D   
Sbjct: 219 FLKQVGFKDSDVVYVPVSGLSGENLVKPCTEEKLKKWYQ---------GQCLVDRIDEFK 269

Query: 696 PP 701
            P
Sbjct: 270 SP 271


>UniRef50_O13354 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=31; cellular organisms|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Candida albicans (Yeast)
          Length = 715

 Score =  151 bits (365), Expect = 2e-35
 Identities = 73/169 (43%), Positives = 109/169 (64%), Gaps = 4/169 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  ++I+ +GHVD+GKST  G+++Y  G +DKRT+EK+E+EA++ G+  +  +WV+D  K
Sbjct: 290 KDHVSIIFMGHVDAGKSTMGGNILYLTGSVDKRTVEKYEREAKDAGRQGWYLSWVMDTNK 349

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER           Y   + R   +L    DAPGH+ ++  MI G SQAD  +L+++A  
Sbjct: 350 EERNDGKTIEVGKAYFETDKRRYTIL----DAPGHKMYVSEMIGGASQADVGILVISARK 405

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEE 495
           GE+E G  K GQTREHALLA T GV ++IV VNKMD +   +S+ R++E
Sbjct: 406 GEYETGFEKGGQTREHALLAKTQGVNKIIVVVNKMDDSTVGWSKERYQE 454


>UniRef50_P05453 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=50; Ascomycota|Rep: Eukaryotic
           peptide chain release factor GTP-binding subunit -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 685

 Score =  149 bits (361), Expect = 7e-35
 Identities = 73/169 (43%), Positives = 108/169 (63%), Gaps = 4/169 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  ++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++ G+  +  +WV+D  K
Sbjct: 258 KDHVSLIFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNK 317

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER           Y   E R   +L    DAPGH+ ++  MI G SQAD  VL+++A  
Sbjct: 318 EERNDGKTIEVGKAYFETEKRRYTIL----DAPGHKMYVSEMIGGASQADVGVLVISARK 373

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEE 495
           GE+E G  + GQTREHALLA T GV +++V VNKMD     +S+ R+++
Sbjct: 374 GEYETGFERGGQTREHALLAKTQGVNKMVVVVNKMDDPTVNWSKERYDQ 422



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 3/42 (7%)
 Frame = +3

Query: 510 SSYIKKIGYN-PAAVAFVPISGWHGDNMLE--PSTKMPWFKG 626
           S++++ IGYN    V F+P+SG+ G N+ +     + PW+ G
Sbjct: 428 SNFLRAIGYNIKTDVVFMPVSGYSGANLKDHVDPKECPWYTG 469


>UniRef50_Q5KLM5 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 914

 Score =  149 bits (360), Expect = 9e-35
 Identities = 74/166 (44%), Positives = 107/166 (64%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  ++++V+GHVD+GKST  G ++Y  G + ++     E+ ++++GKGSF +AW LD L 
Sbjct: 481 KKNVSLIVVGHVDAGKSTLMGRVLYDIGELSEKEKIANERGSKKLGKGSFAFAWGLDALG 540

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER+R       +            +DAPGHRDFI  MI+G +QAD A+L++    GEFE
Sbjct: 541 DERDRGVTIDIATTHFVTPHRNFTLLDAPGHRDFIPAMISGAAQADVALLVIDGSPGEFE 600

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           AG  + GQTREHA L  +LGVK++IVGVNKMD     +S+ R+EEI
Sbjct: 601 AGFERGGQTREHAWLVRSLGVKEIIVGVNKMDLVS--WSQDRYEEI 644


>UniRef50_Q5KFJ4 Cluster: Translation release factor, putative; n=3;
           Eukaryota|Rep: Translation release factor, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 757

 Score =  149 bits (360), Expect = 9e-35
 Identities = 74/170 (43%), Positives = 108/170 (63%), Gaps = 4/170 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +NI+  GHVD+GKST  G L+Y  G +DKRT+EK+E+EA+  G+ ++  +W LD  K
Sbjct: 313 KSHLNIIFTGHVDAGKSTMGGQLLYLTGAVDKRTMEKYEQEAKAAGRETWYLSWALDSGK 372

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER +         Y   E R   +L    DAPGH+ ++ +MI+G +QAD A+L+++A  
Sbjct: 373 EERAKGKTVEVGRAYFESEKRRYTIL----DAPGHKTYVPSMISGAAQADVALLVLSARK 428

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           GEFE G  + GQTREHA+L    G+ +LIV VNKMD T   + + R++EI
Sbjct: 429 GEFETGFEREGQTREHAMLIKNNGINKLIVVVNKMDDTTVQWDKGRYDEI 478


>UniRef50_Q23TC1 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 600

 Score =  148 bits (359), Expect = 1e-34
 Identities = 77/168 (45%), Positives = 108/168 (64%), Gaps = 2/168 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+V++GHVDSGKST  GHL +    ID++   K EKE++ +GK SFK+AWV D+ +AER
Sbjct: 179 MNLVIVGHVDSGKSTLVGHLCHLKKVIDQKLAHKNEKESKNIGKESFKFAWVNDEFEAER 238

Query: 190 ER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           +R       Y  ++ +N  +    +DAPGH+DF+ NMI G +QAD A+L++      FE 
Sbjct: 239 QRGITIDIGYKVIQTKNKNIT--FLDAPGHKDFVPNMIQGVTQADYALLVIEGSLQAFER 296

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           G    GQT+EHA L   LGV++LIV +NKMD+    +   RFE IK E
Sbjct: 297 GFEFGGQTKEHAFLVKQLGVQRLIVLINKMDTVN--WDRNRFEYIKLE 342



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 23/62 (37%), Positives = 36/62 (58%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           ++  IGY+   + FVPIS ++ +N++E S K+P   GW         +GKCL+E LD + 
Sbjct: 346 FLTSIGYSEDNLIFVPISAFYAENIVEKS-KLP-EAGWY--------EGKCLMELLDTLP 395

Query: 696 PP 701
            P
Sbjct: 396 VP 397


>UniRef50_A4R2K6 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 630

 Score =  148 bits (359), Expect = 1e-34
 Identities = 75/162 (46%), Positives = 101/162 (62%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           + VV+GHVD+GKST  G L+     +D RTI K++KEA+ MGKGSF  AWVLD    ER 
Sbjct: 281 SFVVVGHVDAGKSTMMGRLLLDMNVVDDRTISKYKKEAEAMGKGSFALAWVLDSTSDERA 340

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
                            +   +DAPGH+DF+ NMI G SQAD A+L++ A  G +E G+ 
Sbjct: 341 HGVTIDIAKSRFETESTIFTILDAPGHQDFVPNMIAGASQADFAILVIDATVGAYERGL- 399

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
             GQT+EHA L  ++GV ++IV VNK+D+T   +S+ RF EI
Sbjct: 400 -KGQTKEHAQLIRSIGVSRIIVAVNKLDATN--WSQDRFNEI 438



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 15/44 (34%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
 Frame = +3

Query: 501 EGRSSYIKKIGYNPAAVAFVPISGWHGDNMLEPST--KMPWFKG 626
           +G S ++  +G+    ++F+P+SG +GDNM++ ST     W+ G
Sbjct: 440 DGMSGFMSALGFQMKNISFIPLSGLNGDNMVKRSTAEAASWYTG 483


>UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1,
           subunit alpha; n=1; Halorubrum lacusprofundi ATCC
           49239|Rep: Translation elongation factor EF-1, subunit
           alpha - Halorubrum lacusprofundi ATCC 49239
          Length = 540

 Score =  146 bits (354), Expect = 5e-34
 Identities = 75/165 (45%), Positives = 105/165 (63%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+ +IGHVD GKST  G L+++ G + +  IE+  +EA+E GKG F++A+V+D L  ERE
Sbjct: 127 NLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREEAEEKGKGGFEFAYVMDNLAEERE 186

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R         E          +D PGHRDF+KNMITG SQAD AVL+VAA     + G++
Sbjct: 187 RGVTIDIAHQEFDTDNYYFTIVDCPGHRDFVKNMITGASQADNAVLVVAA-----DDGVA 241

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
              QTREH  LA TLG+ ++I+GVNKMD  +  Y E  ++++ +E
Sbjct: 242 P--QTREHVFLARTLGINEIIIGVNKMDLVD--YKESSYDQVVEE 282



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +3

Query: 555 FVPISGWHGDNMLEPSTKMPWFKG 626
           FVPIS + GDN+ E S   PW+ G
Sbjct: 299 FVPISAFEGDNISEESENTPWYDG 322


>UniRef50_Q4E4V1 Cluster: Elongation factor 1-alpha (EF-1-alpha),
           putative; n=3; Trypanosoma|Rep: Elongation factor
           1-alpha (EF-1-alpha), putative - Trypanosoma cruzi
          Length = 664

 Score =  145 bits (352), Expect = 8e-34
 Identities = 77/173 (44%), Positives = 109/173 (63%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           + +   V+ GHVD+GKSTT GHL+   G + +  IEK EK A+++  GSFKYAWVLD+ +
Sbjct: 245 KRDCTFVIAGHVDAGKSTTLGHLLLLLGKVSQSEIEKNEKNARQLNSGSFKYAWVLDQSE 304

Query: 181 AERERRY---HNRYC-SLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER R        YC   E R   +L    DAPGH+D++ NMI+  +QAD A+L+V A T
Sbjct: 305 EERRRGVTIDAGSYCFETEHRRINIL----DAPGHKDYVLNMISSATQADAALLVVTAAT 360

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
            EFE G++    T+EH  +  TL V +LIV VNKMD+ +  YS+ R++ + +E
Sbjct: 361 SEFEVGLAHG--TKEHLFILKTLSVGRLIVAVNKMDTVD--YSKERYDYVVRE 409


>UniRef50_Q2U0M0 Cluster: Translation elongation factor EF-1
           alpha/Tu; n=1; Aspergillus oryzae|Rep: Translation
           elongation factor EF-1 alpha/Tu - Aspergillus oryzae
          Length = 534

 Score =  145 bits (352), Expect = 8e-34
 Identities = 85/187 (45%), Positives = 111/187 (59%), Gaps = 21/187 (11%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKF-------------------EKEAQE 132
           I  V +GH+D GKSTT   LIY+ G +    I ++                       QE
Sbjct: 100 ITAVFLGHLDHGKSTTADQLIYQYGRVSGNPIAEYGSMLSLSSDLLCAGARPHDNHSPQE 159

Query: 133 MGKGSFKYAWVLDKLKAERER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGT 306
            G  S+KY WV++KL+AER+R        C+ E     V    IDAPGHRD+IKN ITG 
Sbjct: 160 AGP-SYKYGWVIEKLRAERKRGITIDISLCTFETPKFVVTV--IDAPGHRDYIKNTITGA 216

Query: 307 SQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPR 486
           SQADCA+L+ +A  GEFEAG+ + GQ+R+H +LA+TLGV+QLIV VNKMD+  P Y++  
Sbjct: 217 SQADCAILVTSATNGEFEAGVDQGGQSRQHLVLAYTLGVRQLIVAVNKMDT--PRYTDDC 274

Query: 487 FEEIKKE 507
             EI KE
Sbjct: 275 LNEIVKE 281



 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 40/65 (61%), Positives = 50/65 (76%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S +IKKIGYNP AVAFVPISG +GDN++E S  MPWFKGW  E K G   GK L++A+DA
Sbjct: 283 SDFIKKIGYNPKAVAFVPISGLYGDNLVEESQNMPWFKGWTSETKYGVLKGKTLLDAIDA 342

Query: 690 ILPPA 704
           ++ P+
Sbjct: 343 LVTPS 347


>UniRef50_Q2GS47 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 840

 Score =  145 bits (351), Expect = 1e-33
 Identities = 75/165 (45%), Positives = 104/165 (63%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           + VV+GHVD+GKST  G L+     +D+RTI+K +KEA+  GKGSF  AWVLD+   ER 
Sbjct: 435 SFVVVGHVDAGKSTMMGRLLLDLKVVDQRTIDKLQKEAKTEGKGSFGLAWVLDQRPEERS 494

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R       +            +DAPGH ++I NMI G SQAD A+L++ A    FE+G+ 
Sbjct: 495 RGITMDIATRRFETEHTAFTILDAPGHAEYIYNMIAGASQADFAILVIDASIDAFESGL- 553

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             GQTREH+LL  ++GV ++IV VNK+D+    +S+ RF EIK +
Sbjct: 554 -KGQTREHSLLIRSMGVSRIIVAVNKLDTV--AWSQERFSEIKDQ 595


>UniRef50_Q6JIY6 Cluster: Translation elongation factor 1 alpha;
           n=3; Microsporidia|Rep: Translation elongation factor 1
           alpha - Antonospora locustae (Nosema locustae)
          Length = 478

 Score =  144 bits (349), Expect = 2e-33
 Identities = 75/174 (43%), Positives = 105/174 (60%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+ +IGHVDSGKSTT G+L Y+ G  D+R + K + EA   GKG+F YA+  D   AER
Sbjct: 8   LNVCIIGHVDSGKSTTMGNLAYQLGVFDQRQLTKLKAEADSHGKGTFAYAYFFDNTAAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           +R         E +  +     ID PGH+DFIKN +TG +QAD AV +V A   +F A  
Sbjct: 68  KRGITIDITLKEFKLKKFNANIIDCPGHKDFIKNTVTGAAQADVAVALVPA--SDFAAAT 125

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRL 531
           S     ++H +++  +G+K+LI+ VNKMD   P   + +FE IKKE    S+RL
Sbjct: 126 SPKATLKDHIMISGVMGIKRLIICVNKMDEFPPEKQKEKFEWIKKEMLFISQRL 179



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +3

Query: 558 VPISGWHGDNMLEPSTKMPWFKGWQ 632
           +PISG  G N+ +   K  WF+GWQ
Sbjct: 188 IPISGLKGINIADHGEKFEWFEGWQ 212


>UniRef50_Q4QGW5 Cluster: Eukaryotic release factor 3, putative;
           n=8; Trypanosomatidae|Rep: Eukaryotic release factor 3,
           putative - Leishmania major
          Length = 763

 Score =  143 bits (346), Expect = 4e-33
 Identities = 78/170 (45%), Positives = 107/170 (62%), Gaps = 4/170 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R   NIV  GHVD+GKST +GHL+ + G +D+R +EK  +EA+   +  ++YA+V+D  +
Sbjct: 324 RPHFNIVFCGHVDAGKSTISGHLLMEKGLVDQREMEKLRREAEINHREGWEYAYVMDVSE 383

Query: 181 AERE----RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER     R     Y   E R   VL    DAPGH+ F+ +MI G +QAD  VL++++ T
Sbjct: 384 EERSKGITRETGAAYFETEKRRVTVL----DAPGHKAFVPSMIGGATQADICVLVISSRT 439

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           GEFE G  K GQTREHA+L  T GVKQ+I  +NKMD  E  +S+ R+ EI
Sbjct: 440 GEFETGFEKGGQTREHAMLVRTCGVKQMICVINKMD--EMKWSKERYSEI 487


>UniRef50_Q9NCN6 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=1; Sterkiella histriomuscorum|Rep: Eukaryotic
           release factor 3 GTPase subunit - Oxytricha trifallax
           (Sterkiella histriomuscorum)
          Length = 937

 Score =  139 bits (337), Expect = 5e-32
 Identities = 66/166 (39%), Positives = 105/166 (63%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R   ++V IGHVD+GKST +G+L+Y  G +D+RTI+K+++EA+E  + S+  A+V+D  +
Sbjct: 417 RQPASLVFIGHVDAGKSTISGNLMYLMGAVDQRTIQKYKEEAKEKNRESWWLAYVMDVSE 476

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            E+ +          +   +      DAPGH++++ NMI G + AD   L+++A  GEFE
Sbjct: 477 EEKAKGKTVEVGRANIETPKKRWTIFDAPGHKNYVPNMIMGAALADFGALVISAKKGEFE 536

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           +G    GQTREH  LA +LG+ +++V VNKMD     +S+ R+ EI
Sbjct: 537 SGFEMEGQTREHIQLAKSLGISKIVVAVNKMDEPSVKWSKDRYTEI 582



 Score = 36.7 bits (81), Expect = 0.57
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 3/44 (6%)
 Frame = +3

Query: 504 GRSSYIKKIGYNPAA-VAFVPISGWHGDNMLEPSTK--MPWFKG 626
           G   +++  GY+P   + FVPISG +GDN+ +P  K    W++G
Sbjct: 585 GLKPFMQGCGYDPEKDIVFVPISGLNGDNLKDPLNKAVCNWYQG 628


>UniRef50_Q2ABX8 Cluster: Elongation factor 1-alpha; n=1; Megacopta
           punctatissima|Rep: Elongation factor 1-alpha - Megacopta
           punctatissima
          Length = 187

 Score =  139 bits (337), Expect = 5e-32
 Identities = 60/65 (92%), Positives = 63/65 (96%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           SSYIKKIGYNPA+VAFVPISGWHGDNMLEPS KMPWFKGW +ERKEGKADGKCLIEALDA
Sbjct: 42  SSYIKKIGYNPASVAFVPISGWHGDNMLEPSDKMPWFKGWAIERKEGKADGKCLIEALDA 101

Query: 690 ILPPA 704
           ILPP+
Sbjct: 102 ILPPS 106


>UniRef50_Q6CFF3 Cluster: Similar to tr|Q9WTY5 Mus musculus ERFS;
           n=1; Yarrowia lipolytica|Rep: Similar to tr|Q9WTY5 Mus
           musculus ERFS - Yarrowia lipolytica (Candida lipolytica)
          Length = 518

 Score =  138 bits (335), Expect = 9e-32
 Identities = 68/166 (40%), Positives = 98/166 (59%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N V +GHVD+GKST  G L++  G +    +EK  K A E+GK SF YAW++D+   ER
Sbjct: 77  LNAVAVGHVDAGKSTLLGRLLHDTGVVSSHQVEKLAKSASEIGKKSFSYAWLMDQTDEER 136

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           E          E        + +DAPGH +F+ NMI G SQAD A++++ +    FE G 
Sbjct: 137 ENGVTVDISVREFSYESREYFILDAPGHYNFVPNMIAGASQADVAIVVLDSLADAFERGF 196

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             +GQT+EHALL   +GV  +I+ VNKMD  +  + + RF+EI  +
Sbjct: 197 FADGQTKEHALLCRAMGVNHVIIAVNKMDQLK--FDQTRFDEISDQ 240


>UniRef50_Q9NCN5 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Euplotes|Rep: Eukaryotic release factor 3
           GTPase subunit - Euplotes aediculatus
          Length = 805

 Score =  138 bits (333), Expect = 2e-31
 Identities = 69/166 (41%), Positives = 105/166 (63%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R   ++V IGHVD+GKST  G+L++  G +D+RT EKF++EA+E  + S+  A+V+D   
Sbjct: 307 RQPSSLVFIGHVDAGKSTICGNLMFMTGMVDERTTEKFKQEAKEKNRDSWWLAYVMDIND 366

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            E+ +          +          DAPGH++++ +MI G + AD A L+++A  GEFE
Sbjct: 367 DEKSKGKTVEVGRATMETPTKRYTIFDAPGHKNYVPDMIMGAAMADVAALVISARKGEFE 426

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           AG  ++GQTREHA LA +LGV +L+V VNKMD     ++E R+ +I
Sbjct: 427 AGFERDGQTREHAQLARSLGVSKLVVVVNKMDEETVQWNEARYNDI 472


>UniRef50_Q8SRN3 Cluster: TRANSLATION ELONGATION FACTOR 1-ALPHA;
           n=1; Encephalitozoon cuniculi|Rep: TRANSLATION
           ELONGATION FACTOR 1-ALPHA - Encephalitozoon cuniculi
          Length = 424

 Score =  137 bits (331), Expect = 3e-31
 Identities = 75/179 (41%), Positives = 106/179 (59%), Gaps = 2/179 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIV +GHVD+GKST  G ++ + G +D RT+EK+ + ++E  + S+  +W LD    ER
Sbjct: 14  INIVFVGHVDAGKSTICGQILVQMGLVDPRTLEKYRQMSREQNRESWYLSWCLDTNPEER 73

Query: 190 ERRYHNRY--CSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           ER         S E+ + +V    +DAPGH  F+  MI G ++AD  +L+V+A   EFEA
Sbjct: 74  ERGKTTEVGTASFELPHRRVNI--LDAPGHNQFVFEMINGANRADVGILVVSARINEFEA 131

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATT 540
           G  K GQTREH  L     V++LIV VNKMD     + + RF+EIK +     RR+  T
Sbjct: 132 GFEKGGQTREHIFLLKAGSVQRLIVLVNKMDDPSVEWRKERFDEIKTKVGAFVRRMFPT 190


>UniRef50_Q7YZN9 Cluster: Eukaryotic release factor 3; n=2;
           Dictyostelium discoideum|Rep: Eukaryotic release factor
           3 - Dictyostelium discoideum (Slime mold)
          Length = 557

 Score =  135 bits (326), Expect = 1e-30
 Identities = 67/166 (40%), Positives = 104/166 (62%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  +NIV +GHVD+GKST +G ++   G +D  T+ K+E+EA+E  +  + YA+++D  +
Sbjct: 115 REHLNIVFLGHVDAGKSTLSGSIMVLTGQVDPHTLAKYEREAKENHREGWIYAYIMDTNE 174

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER +              +     +DAPGHR ++ NMI G +QAD  +L++++  GEFE
Sbjct: 175 EERTKGKTVEVGRAHFETTKKRYTILDAPGHRLYVPNMIIGAAQADVGILVISSKKGEFE 234

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           AG+ + GQT EHA LA  +G+K L+V VNKMD     +S+ R++EI
Sbjct: 235 AGV-EGGQTIEHARLAKMIGIKYLVVFVNKMDEPTVKWSKARYDEI 279


>UniRef50_A0E926 Cluster: Chromosome undetermined scaffold_84, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_84,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 756

 Score =  134 bits (325), Expect = 2e-30
 Identities = 70/168 (41%), Positives = 107/168 (63%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  +N+V IGHVD+GKST  G L+ + G + +  I+K+E+EA +  + S+  A+V+D+ +
Sbjct: 326 RQPVNLVFIGHVDAGKSTLCGRLLLELGEVSEADIKKYEQEAVQNNRDSWWLAYVMDQNE 385

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            E+++         +    Q      DAPGH++++ NMI G  QAD A LIV+A TGEFE
Sbjct: 386 EEKQKGKTVECGKAQFVTKQKRFILADAPGHKNYVPNMIMGACQADLAGLIVSAKTGEFE 445

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
           +G  K GQT+EHALLA +LGV  +I+ V KMD+ +  +++ RF  I +
Sbjct: 446 SGFEKGGQTQEHALLAKSLGVDHIIIIVTKMDTID--WNQDRFNLISQ 491


>UniRef50_A4RWT6 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 481

 Score =  134 bits (323), Expect = 3e-30
 Identities = 73/169 (43%), Positives = 102/169 (60%), Gaps = 8/169 (4%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 186
           ++++V++GHVD+GKST +G L+Y    +D R + K  ++++  GK SF +AWV+D    E
Sbjct: 44  DVHVVILGHVDAGKSTLSGRLMYALKAVDDRAMHKNVRDSKASGKSSFAWAWVMDCRPEE 103

Query: 187 RER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 354
           RER        + C L+     V+   +DAPGH+DF+ N I+G SQAD  VL++    G 
Sbjct: 104 RERGVTIDVSMKRCVLDGHRQLVV---LDAPGHKDFVPNAISGASQADAGVLVIDGAMGG 160

Query: 355 FEAGIS----KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRF 489
           FE G +      GQTREHA LA  LG+  LIV +NKMD  E  Y E RF
Sbjct: 161 FENGFAATPGHTGQTREHARLARALGLHSLIVVINKMDCVE--YGEERF 207


>UniRef50_A5JHE1 Cluster: Translation elongation factor EF-1 alpha
           subunit; n=2; Euryarchaeota|Rep: Translation elongation
           factor EF-1 alpha subunit - Methanohalophilus
           portucalensis
          Length = 354

 Score =  134 bits (323), Expect = 3e-30
 Identities = 70/147 (47%), Positives = 92/147 (62%)
 Frame = +1

Query: 67  LIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVL 246
           L+Y  G I +  I+KF +EA+E GK SF +AWV+D LK ERER              +  
Sbjct: 5   LLYXTGAIPQHIIDKFREEAKEKGKESFAFAWVMDSLKEERERGITIDIAHKRFDTDKYY 64

Query: 247 CYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 426
              +D PGHRDF+KNMITG SQAD AVL+VAA  G          QT+EH  L+ TLG+ 
Sbjct: 65  FTIVDCPGHRDFVKNMITGASQADAAVLVVAATDGVM-------AQTKEHVFLSRTLGIN 117

Query: 427 QLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           QLI+ VNKMD+T+  YSE ++ ++KK+
Sbjct: 118 QLIIAVNKMDATD--YSEDKYNQVKKD 142



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           S  +  +G+  A V F+P S + GDN+ + S+  PW+ G
Sbjct: 144 SELLGMVGFKAADVPFIPTSAFEGDNISKNSSNTPWYNG 182


>UniRef50_UPI00006CC36B Cluster: Elongation factor Tu C-terminal
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 441

 Score =  132 bits (320), Expect = 6e-30
 Identities = 62/169 (36%), Positives = 101/169 (59%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  I + VIG++ SGKST  GHL  + G ++ + +++ ++  +E G+    Y++++D  K
Sbjct: 9   KERITLAVIGNIGSGKSTMCGHLAIQLGQVNDQKLKEVKQACEEEGQDGINYSYIMDTKK 68

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER+R+             +     ID PG   + KNM+TG   AD AVL+++A   EFE
Sbjct: 69  VERQRKQSIDTSIFHFETDKFQITIIDTPGDTQYTKNMMTGICLADAAVLMISAAADEFE 128

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
            G  K+GQT++  L ++ LG+KQ+IV +NKMD ++  + + RF EIKKE
Sbjct: 129 KGFGKDGQTKDFILHSYALGIKQMIVCINKMDDSKYSFCQKRFNEIKKE 177



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +3

Query: 522 KKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGW 629
           +KI +N   + F+PIS + GDN+LE S  MPW+  +
Sbjct: 183 EKINFNLQNIKFIPISAFLGDNLLEKSPNMPWYNSF 218


>UniRef50_Q8SS29 Cluster: TRANSLATION ELONGATION FACTOR 1 ALPHA;
           n=2; Apansporoblastina|Rep: TRANSLATION ELONGATION
           FACTOR 1 ALPHA - Encephalitozoon cuniculi
          Length = 505

 Score =  132 bits (319), Expect = 8e-30
 Identities = 71/166 (42%), Positives = 98/166 (59%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N   IGHVDSGKSTT G L Y+ G +DKR +EK+EKEA    K +F  A++ DK  AER
Sbjct: 47  LNACFIGHVDSGKSTTVGMLSYQLGAVDKREMEKYEKEAALNNKETFYLAYLTDKTDAER 106

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           +R        + +   +     +D PGH+DF+KNM+TG SQAD AV+IV A    FE+ +
Sbjct: 107 KRGITITTTLVNLPTEKFNINILDCPGHKDFVKNMVTGASQADVAVVIVPA--SGFESCV 164

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
              G  + H +++  LG ++LIV VNKMD         +F E+  E
Sbjct: 165 GVGGMLKTHIMISGILGCEKLIVCVNKMDEIPENKRMEKFNEVSAE 210



 Score = 37.1 bits (82), Expect = 0.43
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +3

Query: 558 VPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPAAH 710
           +PIS + G N+ +   K  WFKGW  + KEG +    L EAL+    P  H
Sbjct: 227 IPISAFKGINLTKKGEKFEWFKGW--KEKEGSSVIYTLEEALNYQDVPERH 275


>UniRef50_UPI000150A7E9 Cluster: Elongation factor Tu C-terminal
           domain containing protein; n=2; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 646

 Score =  131 bits (316), Expect = 2e-29
 Identities = 70/166 (42%), Positives = 102/166 (61%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  +NIV IGHVD+GKST +G ++  CG +D+  I KFE EA+E  + S+  A+++D  +
Sbjct: 219 RDSVNIVFIGHVDAGKSTLSGRILKNCGEVDETEIRKFELEAKEKNRESWVLAYIMDINE 278

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER +           +        +DAPGH++++ NMI G  QAD A LI++A  GEFE
Sbjct: 279 EERSKGITVECGKAHFQLANKRFVLLDAPGHKNYVPNMIAGACQADVAALIISARQGEFE 338

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           AG  + GQT+EHA LA  LGV+ +I  V+KMD  E  + + R++ I
Sbjct: 339 AGF-EGGQTQEHAHLAKALGVQHMICVVSKMD--EVNWDKKRYDHI 381


>UniRef50_Q9LM39 Cluster: T10O22.4; n=7; Magnoliophyta|Rep: T10O22.4
           - Arabidopsis thaliana (Mouse-ear cress)
          Length = 615

 Score =  131 bits (316), Expect = 2e-29
 Identities = 76/187 (40%), Positives = 113/187 (60%), Gaps = 18/187 (9%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           RH +N+V IGHVD+GKST  G +++  G +D R I+K+EKEA++  + S+  A+++D  +
Sbjct: 120 RH-LNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTNE 178

Query: 181 AERERRYHNRYC------SLEVRN*QVLCYH----------IDAPGHRDFIKNMITGTSQ 312
            ER +  H  +        +  +  +V   H          +DAPGH+ ++ NMI+G SQ
Sbjct: 179 EERLKVLHVFWSMFVLLLKMHGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQ 238

Query: 313 ADCAVLIVAAGT--GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPR 486
           AD  VL+    T  GEFE G  + GQTREH  LA TLGV +LIV VNKMD     +S+ R
Sbjct: 239 ADIGVLVSQLITRKGEFETGYERGGQTREHVQLAKTLGVSKLIVVVNKMDDPTVNWSKER 298

Query: 487 FEEIKKE 507
           ++EI+++
Sbjct: 299 YDEIEQK 305


>UniRef50_Q4FW53 Cluster: Hsp70 subfamily B suppressor 1; n=3;
           Leishmania|Rep: Hsp70 subfamily B suppressor 1 -
           Leishmania major strain Friedlin
          Length = 647

 Score =  131 bits (316), Expect = 2e-29
 Identities = 70/170 (41%), Positives = 104/170 (61%), Gaps = 3/170 (1%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 186
           +   V+ GHVD+GKSTT GHL+   G +  + +E+ EK  +   K SFKYAW+LD+ + E
Sbjct: 227 DCTFVIAGHVDAGKSTTLGHLLLLLGRVSIQDVERNEKADRTHHKDSFKYAWLLDQCEEE 286

Query: 187 RERRY---HNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 357
           R R        +C  E  + +V  + +DAPGH+DF+ NMI+  +QAD A+L+V A   EF
Sbjct: 287 RRRGVTIDSGSFC-FETEHRRV--HILDAPGHKDFVLNMISSATQADAALLVVTATNSEF 343

Query: 358 EAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           E G+     T+ H L+  TLGV  ++V VNKMD+    YS+ R++ + +E
Sbjct: 344 ETGLHHG--TKSHLLVLKTLGVGSIVVAVNKMDAV--AYSQERYDYVVRE 389


>UniRef50_Q7R087 Cluster: GLP_56_7099_8961; n=2; Giardia
           intestinalis|Rep: GLP_56_7099_8961 - Giardia lamblia
           ATCC 50803
          Length = 620

 Score =  123 bits (297), Expect = 4e-27
 Identities = 71/176 (40%), Positives = 99/176 (56%), Gaps = 10/176 (5%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R+ IN++V+GHVD+GKST  GHL    G +  R   + +  A    K +F YA++LD   
Sbjct: 141 RNTINVLVVGHVDAGKSTIFGHLAVLSGSVSMRERTRTQALADTYNKSTFSYAFLLDTND 200

Query: 181 AERERRYHNRYCSLEVR--------N*QV--LCYHIDAPGHRDFIKNMITGTSQADCAVL 330
            ER+R      C+  +         N  V    +  D PGHRDF+ ++I   SQ D AVL
Sbjct: 201 EERQRGVTMDVCNHTLTLAFPELGDNYSVPHTVFLQDCPGHRDFVPSLIRAVSQPDAAVL 260

Query: 331 IVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           ++ A   EFE G+S +GQTREH  L    GVK ++V VNK+D T+  ++E RF EI
Sbjct: 261 VLDASPKEFEKGLSDDGQTREHLQLLMIFGVKHIMVAVNKLDRTD--WNEGRFVEI 314


>UniRef50_A2FN77 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Elongation factor Tu C-terminal domain containing
           protein - Trichomonas vaginalis G3
          Length = 607

 Score =  118 bits (284), Expect = 1e-25
 Identities = 64/169 (37%), Positives = 98/169 (57%), Gaps = 3/169 (1%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V++GHVD+GKST  GH++     ++K+ ++K  ++++  G G    AW++ + +
Sbjct: 188 KKHVNLVIVGHVDAGKSTLIGHVLLLSNFVEKQRMDKIMEDSKATGHGQDYLAWIMAEDE 247

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHI---DAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           +ER    H     + + N +     I   DAPGHRDF+ NMI G SQAD A+L+V     
Sbjct: 248 SERS---HGVTIDVALNNFETEDRKITVLDAPGHRDFVPNMIAGASQADSAILVVDVSNP 304

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
             E      GQ  EH LL  +LGVK LIV +NKMDS E  Y +  +E++
Sbjct: 305 NIE-----RGQAGEHILLCRSLGVKHLIVAINKMDSLE--YMQSAYEDV 346



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           + ++K+I ++  AV F+P        +L P  KMPW+KG
Sbjct: 351 TEHLKRISWS--AVHFIPTVATDKSVLLNPKEKMPWYKG 387


>UniRef50_Q96TK8 Cluster: Translation elongation factor 1 alpha;
           n=1; Phellopilus nigrolimitatus|Rep: Translation
           elongation factor 1 alpha - Phellopilus nigrolimitatus
          Length = 134

 Score =  117 bits (282), Expect = 3e-25
 Identities = 62/99 (62%), Positives = 71/99 (71%), Gaps = 2/99 (2%)
 Frame = +1

Query: 316 DCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPR--F 489
           DCA+LI+A GTGEFEAGISK+GQTREHALLAFTLGV+QLIV VNKMD+T      PR   
Sbjct: 1   DCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTTN---GGPRAVS 57

Query: 490 EEIKKEDPHTSRRLATTQLLSLSCPFLDGTETTCWSLQP 606
             + K+ P +SRRL TT+ L  S  F  GT TTCW   P
Sbjct: 58  ARLSKKHPTSSRRLVTTRRLLPSFRFRAGTVTTCWKSLP 96



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 18/31 (58%), Positives = 22/31 (70%)
 Frame = +3

Query: 609 MPWFKGWQVERKEGKADGKCLIEALDAILPP 701
           MPW+KGW  E K G   GK L++A+DAI PP
Sbjct: 98  MPWYKGWTKETKAGVVKGKTLLDAIDAIEPP 128


>UniRef50_A4XJZ8 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Caldicellulosiruptor saccharolyticus DSM
           8903|Rep: Sulfate adenylyltransferase, large subunit -
           Caldicellulosiruptor saccharolyticus (strain ATCC 43494
           / DSM 8903)
          Length = 564

 Score =  111 bits (267), Expect = 2e-23
 Identities = 62/169 (36%), Positives = 103/169 (60%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  + IVV+GHVD GKST  G L+Y    + +  IE+ ++ ++E G+  F+YA++LD L+
Sbjct: 4   RELLKIVVVGHVDHGKSTIIGRLLYDTKSVPEAAIERVKRISKEKGR-PFEYAYLLDALE 62

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            E+++        ++    +     IDAPGH++F+KNM++G + A+ A+L++ A  G  E
Sbjct: 63  EEQKQGITIDTTQIKFSTPKRDYLIIDAPGHKEFLKNMVSGAANAEAALLVIDAAEGVQE 122

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
                  Q++ HA +   LG++++ V VNKMD  E  +SE +F+EIK E
Sbjct: 123 -------QSKRHAYILSLLGIQKVYVIVNKMDMIE--FSEKKFKEIKYE 162



 Score = 39.5 bits (88), Expect = 0.080
 Identities = 15/39 (38%), Positives = 26/39 (66%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           S+++ K+   P    ++P+SG+ G+N+   S KMPW+KG
Sbjct: 164 STFLSKLNVYPQK--YIPVSGFLGENIARKSDKMPWYKG 200


>UniRef50_Q97MT1 Cluster: GTPase, sulfate adenylate transferase
           subunit 1; n=2; Clostridium|Rep: GTPase, sulfate
           adenylate transferase subunit 1 - Clostridium
           acetobutylicum
          Length = 522

 Score =  110 bits (265), Expect = 3e-23
 Identities = 63/166 (37%), Positives = 95/166 (57%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  +N+V +GHVD GKST  G L+Y    +    IEK +K + E GK  F+YA++LD  +
Sbjct: 4   RENLNVVFVGHVDHGKSTLIGRLLYDTNSLPDGAIEKVKKISAEEGK-KFEYAFLLDAFE 62

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            E+ +        ++    +     IDAPGH++F+KNMI+G + A+ A+L+V A  G  E
Sbjct: 63  EEQRQGITIDITMIQFFTKKRDYVIIDAPGHKEFLKNMISGAASAEAAILVVDAKEGIQE 122

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
                  Q++ H  +   LG+K++ V VNKMD  +  YSE R+ EI
Sbjct: 123 -------QSKRHGYILSLLGIKKVYVAVNKMDLVD--YSEERYNEI 159



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 16/39 (41%), Positives = 26/39 (66%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           +S++  +   P A  ++PIS + GDN+ + S KMPW+KG
Sbjct: 164 NSFLANLNIYPEA--YIPISAFLGDNVAKKSEKMPWYKG 200


>UniRef50_Q259E7 Cluster: H0801D08.2 protein; n=5; Oryza sativa|Rep:
           H0801D08.2 protein - Oryza sativa (Rice)
          Length = 654

 Score =  110 bits (265), Expect = 3e-23
 Identities = 60/129 (46%), Positives = 82/129 (63%), Gaps = 4/129 (3%)
 Frame = +1

Query: 133 MGKGSFKYAWVLDKLKAERERRYHNRY--CSLEVRN*QVLCYHIDAPGHRDFIKNMITGT 306
           +GKGSF YAW +D+   ERER           + +N  V+   +D+PGH+DF+ NMI+G 
Sbjct: 276 IGKGSFAYAWAMDESADERERGITMTVGVAYFDTKNYHVVL--LDSPGHKDFVPNMISGA 333

Query: 307 SQADCAVLIVAAGTGEFEAGISKN--GQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE 480
           +Q+D A+L++ A  G FEAG+  N  GQT+EH+ L  + GV  LIV VNKMDS E  YS+
Sbjct: 334 TQSDAAILVIDASIGSFEAGMGINGIGQTKEHSQLVRSFGVDNLIVVVNKMDSVE--YSK 391

Query: 481 PRFEEIKKE 507
            RF  IK +
Sbjct: 392 ERFNFIKSQ 400



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 513 SYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAI 692
           ++++  GY  +AVA+VPIS    +N++  ++       W         DG CL++A+D +
Sbjct: 403 AFLRSCGYKDSAVAWVPISAMENENLMTTASDTR-LSSWY--------DGNCLLKAIDTL 453

Query: 693 LPPA 704
            PP+
Sbjct: 454 PPPS 457


>UniRef50_Q89UE2 Cluster: NodQ bifunctional enzyme; n=12;
           Rhizobiales|Rep: NodQ bifunctional enzyme -
           Bradyrhizobium japonicum
          Length = 638

 Score =  110 bits (264), Expect = 4e-23
 Identities = 72/197 (36%), Positives = 105/197 (53%), Gaps = 2/197 (1%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R ++ IV++GHVD GKST  G L+++ G +    +E  +  +   G   F+++++LD L+
Sbjct: 18  RPQVRIVIVGHVDHGKSTLVGRLLHETGSLPDGKLEMLKAVSARRGM-PFEWSFLLDALQ 76

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER++        +  R        IDAPGH +F++NMITG SQAD AVLI+ A  G   
Sbjct: 77  TERDQGITIDTTQIRFRTNSRDIVLIDAPGHAEFLRNMITGASQADGAVLIIDALEG--- 133

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE-DPHTSRRLAT 537
                  QTR H  L   LGVKQ+ + VNKMD  +  +S  RF+ I  E   H +    T
Sbjct: 134 ----VRDQTRRHGYLLHLLGVKQVAIVVNKMDRVD--FSADRFQAISDEISAHLNGLGVT 187

Query: 538 -TQLLSLSCPFLDGTET 585
            T ++ +S    DG  T
Sbjct: 188 PTAVIPISARDGDGVAT 204



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 20/66 (30%), Positives = 33/66 (50%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+++  +G  P AV  +PIS   GD +   + ++ W+KG  V     + +    +EAL  
Sbjct: 178 SAHLNGLGVTPTAV--IPISARDGDGVATRTDRIGWYKGPTVVEALDQLEPARPLEALAL 235

Query: 690 ILPPAA 707
            LP  A
Sbjct: 236 RLPVQA 241


>UniRef50_Q95UT7 Cluster: Elongation factor 1 alpha short form; n=1;
           Monosiga brevicollis|Rep: Elongation factor 1 alpha
           short form - Monosiga brevicollis
          Length = 208

 Score =  109 bits (261), Expect = 9e-23
 Identities = 53/104 (50%), Positives = 71/104 (68%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  ++IV+ GHVD+GKSTTTG LI++ GGI +R ++K + EA+ +GKGSF +A+ +D+ K
Sbjct: 5   KQHVSIVICGHVDAGKSTTTGRLIFELGGIPEREMQKLKDEAERLGKGSFAFAFYMDRQK 64

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQ 312
            ERER       + E          IDAPGHRDFIKNMITG SQ
Sbjct: 65  EERERGVTIACTTKEFFTATKHYTVIDAPGHRDFIKNMITGASQ 108


>UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkaliphilus metalliredigens QYMF|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkaliphilus metalliredigens QYMF
          Length = 615

 Score =  107 bits (256), Expect = 4e-22
 Identities = 60/166 (36%), Positives = 101/166 (60%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +NIV++GHVD GKST  G L+   G + +  +E+ ++  ++  K  F+YA++LD LK E+
Sbjct: 21  MNIVIVGHVDHGKSTIIGRLLADTGSLPEGKLEQVKETCRKNAK-PFEYAFLLDALKDEQ 79

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            +        +  +  +     IDAPGH +F+KNM+TG ++A+ A+L++ A     + G+
Sbjct: 80  SQGITIDSARVFFKTQERKYIIIDAPGHIEFLKNMVTGAARAEVALLVIDA-----KEGV 134

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
            +N  ++ H  L   LG+KQ++V +NKMD  +  YS+ R+EEI  E
Sbjct: 135 KEN--SKRHGYLLSMLGIKQVVVLINKMDLVD--YSKERYEEILAE 176



 Score = 39.9 bits (89), Expect = 0.061
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +3

Query: 546 AVAFVPISGWHGDNMLEPSTKMPWFKGWQVERK 644
           A +F+PISG+ G+N+   S KMPW+ G  V  K
Sbjct: 188 AESFIPISGFKGENVASGSDKMPWYSGMTVLEK 220


>UniRef50_Q5CWA0 Cluster: HBS1 eRFS. GTpase; n=2;
           Cryptosporidium|Rep: HBS1 eRFS. GTpase - Cryptosporidium
           parvum Iowa II
          Length = 530

 Score =  106 bits (255), Expect = 5e-22
 Identities = 58/146 (39%), Positives = 85/146 (58%)
 Frame = +1

Query: 19  VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERR 198
           VV+GHVDSGKST  GHL    G I +  + K++KE++ +GKGSF YAW+ D    ERER 
Sbjct: 85  VVLGHVDSGKSTLMGHLFVSLGLISEGVMRKYKKESEIIGKGSFAYAWIFDDCDDERERG 144

Query: 199 YHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN 378
                 +  +   + L   +DAPGH +FI N  + +  +D  +++V   +G F++G  K 
Sbjct: 145 ITINISAKSMMIEKKLVTILDAPGHSEFIPNSFSISMFSD-NIIVVIDSSG-FDSGFQK- 201

Query: 379 GQTREHALLAFTLGVKQLIVGVNKMD 456
           GQT EH + +    V  +I  VNK+D
Sbjct: 202 GQTIEHIIYSLLADVSNIIFAVNKLD 227


>UniRef50_Q74CF6 Cluster: Elongation factor Tu GTP binding domain
           protein; n=1; Geobacter sulfurreducens|Rep: Elongation
           factor Tu GTP binding domain protein - Geobacter
           sulfurreducens
          Length = 516

 Score =  105 bits (251), Expect = 1e-21
 Identities = 59/166 (35%), Positives = 92/166 (55%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           + IV++GHVD GKST  G L Y  G I +   ++     +  G+  F++A+++D L+ ER
Sbjct: 7   LKIVIVGHVDHGKSTLIGRLFYDTGSIPEARRQEIAATCKAQGR-PFEFAYLMDALEEER 65

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            +       S      +     IDAPGH+ F+KNMITG + AD A+L+V    G  E   
Sbjct: 66  VQNITIDTASSFFSTSRRRYVIIDAPGHKQFLKNMITGAASADAAILLVDGTEGVRE--- 122

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
               QT+ HA +   LG++Q++V VNK+D  +  Y   RF+E++ +
Sbjct: 123 ----QTKRHAHVLSLLGIRQVVVAVNKLDMID--YDRQRFQEVEND 162


>UniRef50_UPI0000E47BF2 Cluster: PREDICTED: similar to elongation
           factor 1 alpha; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to elongation factor 1 alpha -
           Strongylocentrotus purpuratus
          Length = 570

 Score =  102 bits (245), Expect = 8e-21
 Identities = 50/66 (75%), Positives = 58/66 (87%)
 Frame = +1

Query: 310 QADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRF 489
           +ADCAVL+VAAG GEFEAGISK+GQTREHALL +TLGVKQLIV VNKMDS +  Y+E RF
Sbjct: 333 KADCAVLVVAAGIGEFEAGISKDGQTREHALLCYTLGVKQLIVAVNKMDSAQ--YNEARF 390

Query: 490 EEIKKE 507
           +EI +E
Sbjct: 391 KEIVRE 396



 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 42/65 (64%), Positives = 50/65 (76%), Gaps = 1/65 (1%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLE-PSTKMPWFKGWQVERKEGKADGKCLIEALD 686
           S YIKK+GYNP AV F+PISGW GDNM+E  +T MPWFKGW +ERK+  A G  L+ ALD
Sbjct: 398 SGYIKKVGYNPKAVPFIPISGWVGDNMMEAATTTMPWFKGWSIERKDNNASGVTLLNALD 457

Query: 687 AILPP 701
           AI+ P
Sbjct: 458 AIMLP 462


>UniRef50_UPI0000499770 Cluster: elongation factor-1alpha; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: elongation
           factor-1alpha - Entamoeba histolytica HM-1:IMSS
          Length = 544

 Score =  102 bits (245), Expect = 8e-21
 Identities = 59/164 (35%), Positives = 93/164 (56%), Gaps = 1/164 (0%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           + ++  GHVDSGKSTT GH++ + GG+    IEK +KE  E GK SF+YAWV+D    ER
Sbjct: 133 LTVIFCGHVDSGKSTTVGHILQELGGVTHSQIEKNKKECGEKGKKSFEYAWVMDTDDEER 192

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R       ++E +        +DAPGH DF+   I   ++AD AV++V       +   
Sbjct: 193 NRGITISVGAVEFQYNHKNIRILDAPGHTDFLMKTIDAMNEADVAVVVVDVDKHNLKC-- 250

Query: 370 SKNGQTRE-HALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           +  G   +  + LA++  V ++IV +NKMDS +  +SE +++ +
Sbjct: 251 TYEGTFLDIVSTLAYST-VSKIIVAINKMDSVK--WSESKYKSV 291


>UniRef50_Q24TA2 Cluster: Adenylylsulfate kinase/sulfate
           adenylyltransferase subunit 1; n=5; Bacteria|Rep:
           Adenylylsulfate kinase/sulfate adenylyltransferase
           subunit 1 - Desulfitobacterium hafniense (strain Y51)
          Length = 614

 Score =  102 bits (244), Expect = 1e-20
 Identities = 59/169 (34%), Positives = 100/169 (59%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R ++NIV++GHVD GKST  G L+   G + +  +E  ++  ++  +  F+YA++LD LK
Sbjct: 20  REQMNIVIVGHVDHGKSTVIGRLLADTGSLPEGKLEAVQEYCRKNAR-PFEYAFLLDALK 78

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            E+ +           +  +     IDAPGH +F+KNM+TG S+A+ A+L++ A     +
Sbjct: 79  DEQAQGITIDTARSFFKTGKRDYIIIDAPGHIEFLKNMVTGASRAEAALLVIDA-----K 133

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
            GI +N  ++ H  +A  LG++Q++V VNKMD  +  +    FE I++E
Sbjct: 134 EGIREN--SKRHGHIAAMLGIRQVVVLVNKMDLVD--FDRQTFETIRRE 178


>UniRef50_UPI0000DD78A4 Cluster: PREDICTED: similar to statin-like;
           n=1; Homo sapiens|Rep: PREDICTED: similar to statin-like
           - Homo sapiens
          Length = 254

 Score =  101 bits (242), Expect = 2e-20
 Identities = 50/68 (73%), Positives = 54/68 (79%)
 Frame = +1

Query: 304 TSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEP 483
           + Q DCAVLIVA+G GE EAGISKN Q  EH LLA+TLG+KQLIV VNKMD TEPPYS  
Sbjct: 44  SGQEDCAVLIVASGVGECEAGISKNKQICEHTLLAYTLGMKQLIVTVNKMDITEPPYSST 103

Query: 484 RFEEIKKE 507
            FEEI KE
Sbjct: 104 CFEEISKE 111



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 23/32 (71%), Positives = 26/32 (81%)
 Frame = +3

Query: 513 SYIKKIGYNPAAVAFVPISGWHGDNMLEPSTK 608
           +YIKKI YN   + FVPISGWHGDNMLEP +K
Sbjct: 114 AYIKKISYNSQTLPFVPISGWHGDNMLEPGSK 145


>UniRef50_A0BL72 Cluster: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 609

 Score =  100 bits (240), Expect = 3e-20
 Identities = 57/165 (34%), Positives = 94/165 (56%), Gaps = 2/165 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           +IV++GHVD+GKST TG L+     +D + + K +K+A+ +GK S   A+  D  K E+E
Sbjct: 176 SIVILGHVDTGKSTLTGRLLQVFKALDDKELRKNQKDAKNLGKESSALAYATDMTKEEKE 235

Query: 193 R--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
           +       Y ++ +   Q     +D+PGH+DF   +I G +QAD A+L+V      FE  
Sbjct: 236 KGVTMDMAYKTVVIGGRQYNL--LDSPGHQDFAPYLIAGAAQADYAILVVDTTKNAFENS 293

Query: 367 ISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
           I K+G  RE   L   + +K+++V +NKMD  +  + + +F+  K
Sbjct: 294 I-KSGMLREKLQLISAMLIKEIVVALNKMDQID--WDQKQFDVAK 335


>UniRef50_A4LX06 Cluster: Sulfate adenylyltransferase; n=1;
           Geobacter bemidjiensis Bem|Rep: Sulfate
           adenylyltransferase - Geobacter bemidjiensis Bem
          Length = 408

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 61/158 (38%), Positives = 84/158 (53%)
 Frame = +1

Query: 16  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERER 195
           I + GHVD GKST  G L+Y  G +     ++  + + E G+G  ++A+VLD  + ER R
Sbjct: 11  IAITGHVDHGKSTLIGRLLYDTGTLQSGRYQEMLQSSLETGRGD-EFAFVLDAFEEERRR 69

Query: 196 RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 375
                   +   +       ID PGHR+FI+NM+TG S A  AVLIV A  G  E     
Sbjct: 70  GITIDTSQIYFNSKLRPYLIIDTPGHREFIRNMVTGASYAKAAVLIVDAVEGVME----- 124

Query: 376 NGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRF 489
             QTR HA L   +G++++ V VNKMD+    YS   F
Sbjct: 125 --QTRRHAWLLSIVGIQEICVAVNKMDAV--AYSSDAF 158



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 17/38 (44%), Positives = 23/38 (60%)
 Frame = +3

Query: 513 SYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           S   + G +PAA+  VPIS   GDN+ + S  MPW+ G
Sbjct: 167 SLFTEFGLSPAAI--VPISARVGDNVAKLSGSMPWYTG 202


>UniRef50_Q6WZ47 Cluster: Elongation factor-1 alpha; n=3;
           Coelomata|Rep: Elongation factor-1 alpha - Anduzedoras
           oxyrhynchus
          Length = 257

 Score = 98.3 bits (234), Expect = 2e-19
 Identities = 41/52 (78%), Positives = 46/52 (88%)
 Frame = +3

Query: 549 VAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPA 704
           VAFVPISGWHGDNMLEPS+ M WFKGW++ERKEG A G  L+EALDAILPP+
Sbjct: 1   VAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEGNASGTTLLEALDAILPPS 52


>UniRef50_Q19AS6 Cluster: Translation elongation factor 1 alpha;
           n=7; Fungi/Metazoa group|Rep: Translation elongation
           factor 1 alpha - Fusarium sp. CBS 100485
          Length = 61

 Score = 97.5 bits (232), Expect = 3e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +1

Query: 58  TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERER 195
           TGHLIY+CGGIDKRTIEKFEKEA E+GKGSFKYAWVLDKLKAERER
Sbjct: 1   TGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERER 46


>UniRef50_Q0G239 Cluster: Binfunctional sulfate adenylyltransferase
           subunit 1/adenylylsulfate kinase protein; n=2;
           Aurantimonadaceae|Rep: Binfunctional sulfate
           adenylyltransferase subunit 1/adenylylsulfate kinase
           protein - Fulvimarina pelagi HTCC2506
          Length = 578

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 58/172 (33%), Positives = 92/172 (53%), Gaps = 6/172 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 183
           +  +  G VD GKST  G L+Y+   +    +E  EK++++ G   G   +A ++D L A
Sbjct: 59  LRFITCGSVDDGKSTLIGRLLYETNAVFDDQMEALEKDSKKFGTTGGDLDFALLVDGLSA 118

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY S E R   +     D PGH  + +NM TG SQA+ AV++V A  G
Sbjct: 119 EREQGITIDVAYRYFSSENRAFIIA----DTPGHEQYTRNMATGASQAELAVILVDARKG 174

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
                     QTR H+ +   +G+K +++ +NKMD  +  ++E RF+ IK++
Sbjct: 175 ILP-------QTRRHSFITSLVGIKSVVIAINKMDLVD--FAEERFDAIKRD 217



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 16/46 (34%), Positives = 29/46 (63%)
 Frame = +3

Query: 549 VAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALD 686
           V++VP+S  +GDN+++ S   PW++G  + ++   AD +   EA D
Sbjct: 230 VSYVPLSAKNGDNIVKRSPNTPWYQGETLLQRLETADPE-TFEAAD 274


>UniRef50_Q8AAP9 Cluster: Sulfate adenylyltransferase subunit 1;
           n=17; Bacteria|Rep: Sulfate adenylyltransferase subunit
           1 - Bacteroides thetaiotaomicron
          Length = 485

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 65/195 (33%), Positives = 97/195 (49%), Gaps = 6/195 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGS--FKYAWVLDKLKA 183
           + ++  G VD GKST  G L++    + +  ++  E++++ +G       YA +LD LKA
Sbjct: 20  LRLLTAGSVDDGKSTLIGRLLFDSKKLYEDQLDALERDSKRVGNAGEHIDYALLLDGLKA 79

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY S   R   +     D PGH  + +NMITG S A+ A+++V A TG
Sbjct: 80  EREQGITIDVAYRYFSTNGRKFIIA----DTPGHEQYTRNMITGGSTANLAIILVDARTG 135

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRL 531
                     QTR H  L   LG+K +++ VNKMD  +  +SE RF+EI  E       L
Sbjct: 136 VIT-------QTRRHTFLVSLLGIKHVVLAVNKMDLVD--FSEERFDEIVSEYKKFVEPL 186

Query: 532 ATTQLLSLSCPFLDG 576
               +  +    LDG
Sbjct: 187 GIPDVNCIPLSALDG 201


>UniRef50_Q46516 Cluster: ORFC 179; n=1; Desulfurococcus
           mobilis|Rep: ORFC 179 - Desulfurococcus mobilis
          Length = 179

 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 69/147 (46%), Positives = 78/147 (53%)
 Frame = -1

Query: 455 SILFTPTMSCLTPRVKASKACSRV*PFLEIPASNSPVPAATMSTAQSA*EVPVIMFLMKS 276
           SILF  T++   P V AS ACSRV P   IPASNSP  A T   A SA   PVIMFL KS
Sbjct: 3   SILFIATINWFIPMVLASIACSRVWPSALIPASNSPFLALTTRIAASAWLAPVIMFLTKS 62

Query: 275 LCPGASMW*HSTC*FRTSREQYRL*YRRSRSAFSLSNTQAYLKDPLPISWASFSNFSMVR 96
           L PGASM                +   RSRS+F LS++ A LK  LPI   S S    V 
Sbjct: 63  LWPGASMMVKKYFFVSNFMYDSDIVTPRSRSSFILSSSHANLKLSLPIFLDSSSIIFTVF 122

Query: 95  LSIPPHL*IK*PVVVDLPESTCPMTTM 15
            S  P      PV+V LP STCP+ T+
Sbjct: 123 SSKYPRRYSMCPVIVLLPWSTCPIITI 149


>UniRef50_Q5FSE8 Cluster: Sulfate adenylyltransferase subunit 1 /
           adenylylsulfate kinase; n=1; Gluconobacter oxydans|Rep:
           Sulfate adenylyltransferase subunit 1 / adenylylsulfate
           kinase - Gluconobacter oxydans (Gluconobacter
           suboxydans)
          Length = 626

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 52/147 (35%), Positives = 84/147 (57%)
 Frame = +1

Query: 16  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERER 195
           IV++GHVD GKST  G L+Y    +    + +  + +++ G  + +++++LD L+ ER++
Sbjct: 21  IVIVGHVDHGKSTLIGRLLYDTDSLQDGKLAQIVESSRKRGL-AVEWSFLLDSLQIERDQ 79

Query: 196 RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 375
                   +  R        +DAPGHR F++NMITG + A+ AVL+V A  G  E     
Sbjct: 80  GVTVDSTRIPFRLGSREFVIVDAPGHRQFLRNMITGAADAEAAVLVVDAKEGAQE----- 134

Query: 376 NGQTREHALLAFTLGVKQLIVGVNKMD 456
             QTR HA+L   +G++ +IV +NK D
Sbjct: 135 --QTRRHAMLLRLIGIRHVIVLLNKSD 159


>UniRef50_P56893 Cluster: Sulfate adenylyltransferase subunit 1;
           n=7; Rhizobiaceae|Rep: Sulfate adenylyltransferase
           subunit 1 - Rhizobium meliloti (Sinorhizobium meliloti)
          Length = 498

 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 62/195 (31%), Positives = 98/195 (50%), Gaps = 6/195 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA--QEMGKGSFKYAWVLDKLKA 183
           + ++  G VD GKST  G L++    + +      ++++  ++   G   +A +LD L+A
Sbjct: 33  LRLITCGSVDDGKSTLIGRLLWDTKAVKEDQAASLQRDSSGKQNDLGLPDFALLLDGLQA 92

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY + + R+  V     D PGH  + +NM TG S AD AVL+V A  G
Sbjct: 93  EREQGITIDVAYRYFATDKRSFIVA----DTPGHEQYTRNMATGASTADLAVLLVDARVG 148

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRL 531
             E       QTR HA +A  +G++Q ++ VNK+D T   Y   RF++I  E    +  L
Sbjct: 149 LLE-------QTRRHATIATLMGIRQFVLAVNKIDLTN--YDRARFDQISHEFRELALSL 199

Query: 532 ATTQLLSLSCPFLDG 576
              Q+ ++    L G
Sbjct: 200 GVRQVTAIPVSALKG 214


>UniRef50_Q7UMW2 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=24; Bacteria|Rep:
           Bifunctional enzyme cysN/cysC [Includes: Sulfate
           adenylyltransferase subunit 1 (EC 2.7.7.4) (Sulfate
           adenylate transferase) (SAT) (ATP- sulfurylase large
           subunit); Adenylyl-sulfate kinase (EC 2.7.1.25) (APS
           kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)] - Rhodopirellula baltica
          Length = 647

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 62/195 (31%), Positives = 91/195 (46%), Gaps = 6/195 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 183
           +  +  G VD GKST  G L+Y    + +  + K + ++   G   G F  +  +D LK 
Sbjct: 25  LRFITCGSVDDGKSTLIGRLLYDSKLVYEDELAKVQSDSVRQGSVAGGFDPSLFMDGLKE 84

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY S   R   +     D PGH  + +NM TG S AD A++++ A  G
Sbjct: 85  EREQGITIDVAYRYFSTAKRKFIIA----DTPGHEQYTRNMATGASSADLAIILIDARHG 140

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRL 531
                     QTR H+ +   LG++ ++V VNKMD     YSE RF EI  +    + RL
Sbjct: 141 VLT-------QTRRHSFIVSLLGIRHVVVAVNKMDIDGVDYSEDRFNEICDDYRSFATRL 193

Query: 532 ATTQLLSLSCPFLDG 576
               L  +    L+G
Sbjct: 194 DLPDLHFIPISALNG 208



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +3

Query: 555 FVPISGWHGDNMLEPSTKMPWFKG 626
           F+PIS  +GDN+++ S  MPW+ G
Sbjct: 200 FIPISALNGDNLVDRSENMPWYTG 223


>UniRef50_Q0YG57 Cluster: Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit; n=2; Geobacter|Rep:
           Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit - Geobacter sp.
           FRC-32
          Length = 619

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 57/177 (32%), Positives = 88/177 (49%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           + +V +GHVD GKST  G +      +    +EK     ++ GK +F+YA++ D    E+
Sbjct: 36  LQVVFVGHVDHGKSTLLGRIYADTDSLPVGQLEKVRAICEQQGK-TFEYAFLFDAFLEEQ 94

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           E+                    IDAPGH++F+KNMI+G ++A+ AVLI+ A  G  E   
Sbjct: 95  EQGITIDTARTFFNWGNRHYIIIDAPGHKEFLKNMISGAARAEAAVLIIDAAEGVAE--- 151

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATT 540
               Q++ H  +   LG++Q+ V VNKMD     + +  FE I  E     + L  T
Sbjct: 152 ----QSKRHGYMLSLLGIRQIAVVVNKMDLVN--HDQKVFEAIVTEYSAFLKELGVT 202



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 18/48 (37%), Positives = 28/48 (58%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGK 653
           S+++K++G  P    FVP S  +GDN++  S  MPW+ G  V    G+
Sbjct: 193 SAFLKELGVTPRQ--FVPASARNGDNVVTGSDAMPWYDGPTVLESLGR 238


>UniRef50_Q7M9D1 Cluster: GTPASE, SULFATE ADENYLATE TRANSFERASE
           SUBUNIT 1; n=1; Wolinella succinogenes|Rep: GTPASE,
           SULFATE ADENYLATE TRANSFERASE SUBUNIT 1 - Wolinella
           succinogenes
          Length = 459

 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 49/150 (32%), Positives = 87/150 (58%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +NIV+ GHVD GKST  G L+   G + +  +E   +   +  +  F+Y+ +LD L+ E+
Sbjct: 8   MNIVITGHVDHGKSTLVGRLLADTGSLPQGKLESVRESCAKNAR-PFEYSMLLDALEDEQ 66

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ++        +  ++       IDAPGH +F++NM++G S+A  AVL++ A       G+
Sbjct: 67  KQGITIDSARIFFKSQAREYVIIDAPGHIEFLRNMLSGASRAVAAVLVIDA-----IEGV 121

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDS 459
           ++N  ++ H LL   LG+ Q++V +NK+D+
Sbjct: 122 AEN--SKRHGLLLSLLGISQVVVVINKLDA 149



 Score = 37.5 bits (83), Expect = 0.32
 Identities = 16/41 (39%), Positives = 26/41 (63%)
 Frame = +3

Query: 513 SYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQV 635
           +Y+K +G  P A  FVPIS   G N+++ + +M W++G  V
Sbjct: 166 AYLKTLGITPKA--FVPISAREGKNLIQKAPEMAWYQGESV 204


>UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial
           precursor; n=1895; cellular organisms|Rep: Elongation
           factor Tu, mitochondrial precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 437

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 58/154 (37%), Positives = 81/154 (52%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +NI  IGHVD GK+T T  +         +T+      A + G     YA  +DK   ER
Sbjct: 49  VNIGTIGHVDHGKTTLTAAIT--------KTL------AAKGGANFLDYA-AIDKAPEER 93

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        +E    +    H+D PGH D+IKNMITG +Q D A+++VAA  G+     
Sbjct: 94  ARGITISTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMP--- 150

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
               QTREH LLA  +GV+ ++V VNK+D+ + P
Sbjct: 151 ----QTREHLLLARQVGVQHIVVFVNKVDTIDDP 180


>UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4;
           Fungi/Metazoa group|Rep: Elongation factor 1 alpha -
           Brugia pahangi (Filarial nematode worm)
          Length = 123

 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 39/44 (88%), Positives = 40/44 (90%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK 141
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE +   K
Sbjct: 30  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKERKRWAK 73


>UniRef50_Q5BEE6 Cluster: Elongation factor Tu; n=1; Emericella
           nidulans|Rep: Elongation factor Tu - Emericella nidulans
           (Aspergillus nidulans)
          Length = 461

 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 57/154 (37%), Positives = 77/154 (50%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +NI  IGHVD GK+T T         I K    K        G   F     +DK   ER
Sbjct: 53  VNIGTIGHVDHGKTTLT-------AAITKHQASK--------GLAQFLEYGAIDKAPEER 97

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           +R        +E         H+D PGH D+IKNMITG +  D A+++VAA  G+     
Sbjct: 98  KRGITISTAHIEFSTDNRHYAHVDCPGHADYIKNMITGAANMDGAIVVVAASDGQMP--- 154

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
               QTREH LLA  +GV++++V VNK+D+ + P
Sbjct: 155 ----QTREHLLLARQVGVQKIVVFVNKVDAVDDP 184


>UniRef50_Q0A978 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkalilimnicola ehrlichei MLHE-1|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkalilimnicola ehrlichei (strain MLHE-1)
          Length = 558

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 62/198 (31%), Positives = 93/198 (46%), Gaps = 6/198 (3%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDK 174
           R  + ++  G VD GKST  G L+Y  G I    +   E+ +   G    S   A ++D 
Sbjct: 17  RDLLRLLTCGSVDDGKSTLIGRLLYDAGAIPDDQLAAVERASARYGTTGDSPDLALLVDG 76

Query: 175 LKAERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAA 342
           L+AERE+        RY + E R   +     D PGH  + +NM TG S AD A+L+V A
Sbjct: 77  LEAEREQGITIDVAYRYFATERRKFIIA----DTPGHEQYTRNMATGASTADVAILLVDA 132

Query: 343 GTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTS 522
             G          QTR H+ +   LG++ +++ VNKMD     + E  F  I+++    +
Sbjct: 133 AKGLLP-------QTRRHSAICALLGIRSVVLAVNKMDRV--AWDEATFRTIERDYRVLA 183

Query: 523 RRLATTQLLSLSCPFLDG 576
            RL   Q+  +    L G
Sbjct: 184 TRLGLEQVACIPVAALHG 201


>UniRef50_Q8IFW1 Cluster: Elongation factor-1 alpha; n=1; Exoneura
           angophorae|Rep: Elongation factor-1 alpha - Exoneura
           angophorae
          Length = 139

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 50/104 (48%), Positives = 64/104 (61%)
 Frame = +1

Query: 196 RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 375
           RYH+RY  +EVR+ ++L         RD+ +   +     +      + G       +  
Sbjct: 16  RYHDRYRVVEVRDGEIL---------RDYHRRARSSRFHQEHDHRDESGGLRR----VDS 62

Query: 376 NGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           +G+ REHALLAFTLGVKQLIVGVNKMD T+PPYSE RFEEIKKE
Sbjct: 63  SGRHREHALLAFTLGVKQLIVGVNKMDMTDPPYSETRFEEIKKE 106



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPS 602
           SSYIKKIGYN A+VAFVPISGWHGDNMLE S
Sbjct: 108 SSYIKKIGYNTASVAFVPISGWHGDNMLESS 138



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +3

Query: 270 TQRFHQEHDHRNLSG*LRCAHRSCRYR 350
           + RFHQEHDHR+ SG LR    S R+R
Sbjct: 41  SSRFHQEHDHRDESGGLRRVDSSGRHR 67


>UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9;
           Aconoidasida|Rep: Elongation factor tu, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 505

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 53/152 (34%), Positives = 81/152 (53%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +NI  IGHVD GK+T T  +   C  +++   + +E+               +DK   E+
Sbjct: 122 MNIGTIGHVDHGKTTLTAAITKVCSDLNRGVFKSYEE---------------IDKTPEEQ 166

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           +R        +E    +    HID PGH D+IKNMITGTSQ D ++L+V+A  G      
Sbjct: 167 KRGITINATHVEYETEKRHYSHIDCPGHLDYIKNMITGTSQMDGSILVVSAYDGLMP--- 223

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
               QT+EH LL+  +G++++IV +NK+D  E
Sbjct: 224 ----QTKEHVLLSRQIGIEKMIVYLNKIDMCE 251


>UniRef50_Q22GX7 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 432

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 56/168 (33%), Positives = 91/168 (54%), Gaps = 2/168 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INI+V+G  +SG+STT GH +YK      + ++ F   +Q   +    +   L  L+ E 
Sbjct: 8   INIIVLGSTNSGRSTTVGHFLYKLSKECPQLLQYFNTTSQITEEKDIDFTIPLKNLQFEL 67

Query: 190 ER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           ER      ++   E+ N       +D  GH++F+KN+I+G S+A   VLIVAA   E + 
Sbjct: 68  ERNSEQEEKHICFEMNNHNYEI--VDIIGHKNFVKNIISGQSKAH-VVLIVAALQQERDE 124

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
              +  Q ++  +LA +LGVKQ+IV +NK++     +SE  F  +K +
Sbjct: 125 YDFQFEQIKQQLILAQSLGVKQIIVALNKIEIVN--FSENEFTLMKNQ 170



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 14/38 (36%), Positives = 28/38 (73%)
 Frame = +3

Query: 513 SYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           +Y+ +I +NP ++ ++P+SG  GDN++E S  + W++G
Sbjct: 173 NYLHEIKFNPESIFYIPVSGVKGDNLVEKSENILWYEG 210


>UniRef50_Q9PD78 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=138; root|Rep: Bifunctional
           enzyme cysN/cysC [Includes: Sulfate adenylyltransferase
           subunit 1 (EC 2.7.7.4) (Sulfate adenylate transferase)
           (SAT) (ATP- sulfurylase large subunit); Adenylyl-sulfate
           kinase (EC 2.7.1.25) (APS kinase) (ATP
           adenosine-5'-phosphosulfate 3'-phosphotransferase)] -
           Xylella fastidiosa
          Length = 623

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 63/195 (32%), Positives = 92/195 (47%), Gaps = 6/195 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG-KGS-FKYAWVLDKLKA 183
           +  +  G VD GKST  GHL+Y    + +  +     ++Q  G +G    YA +LD L A
Sbjct: 17  LRFITCGSVDDGKSTLIGHLLYDSQCLAEDQLADLMVDSQRYGTQGEHIDYALLLDGLAA 76

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY   E R   V     D PGH  + +NM TG S AD AV++V A  G
Sbjct: 77  EREQGITIDVAYRYFDTEKRKFIVA----DCPGHAQYTRNMATGASTADAAVVLVDARKG 132

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRL 531
                     QTR H+ +   LG++ +++ VNKMD     Y +  FE I  +    + +L
Sbjct: 133 LLT-------QTRRHSYIVALLGIRHVVLAVNKMDLV--GYDQETFEAIASDYLALAAKL 183

Query: 532 ATTQLLSLSCPFLDG 576
              Q+  +    L+G
Sbjct: 184 GINQVQCIPLSALEG 198



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +3

Query: 525 KIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           K+G N   V  +P+S   GDN+ + S +MPW+ G
Sbjct: 182 KLGINQ--VQCIPLSALEGDNLSKRSARMPWYVG 213


>UniRef50_UPI0000F308E4 Cluster: UPI0000F308E4 related cluster; n=3;
           Laurasiatheria|Rep: UPI0000F308E4 UniRef100 entry - Bos
           Taurus
          Length = 428

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 63/169 (37%), Positives = 82/169 (48%)
 Frame = +1

Query: 19  VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERR 198
           ++ GHVD GKS TTGH IYKC GIDK   EK      E GKGSF+     D L+AE +  
Sbjct: 11  IINGHVDLGKSPTTGHRIYKCDGIDKTATEK-RTRLPETGKGSFESISGSDTLRAESKCG 69

Query: 199 YHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN 378
                   + +  +      DA  HRD         +Q    +    AG   FE  I + 
Sbjct: 70  ITTGISLRQFKTSRGYVTITDASRHRD-------SHTQDGRRI----AG---FETQIRRA 115

Query: 379 GQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSR 525
           G+ RE AL   TLGVKQL V   K+DS +PP S+ +  + K+   H  +
Sbjct: 116 GRPRERALHTHTLGVKQLSVSATKVDS-QPPCSQKKTRKSKEVSTHVKK 163



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 26/64 (40%), Positives = 34/64 (53%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+++KK G+NP      P SGW+GD+MLE  T      G     ++  A G  L EAL  
Sbjct: 158 STHVKKTGFNPDTACVSP-SGWNGDDMLESRTNCGSGDG-NPTSEDRNAGGATLPEALVC 215

Query: 690 ILPP 701
           I PP
Sbjct: 216 IPPP 219


>UniRef50_A6GJE6 Cluster: Sulfate adenylyltransferase, large
           subunit; n=6; Bacteria|Rep: Sulfate adenylyltransferase,
           large subunit - Plesiocystis pacifica SIR-1
          Length = 653

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 55/156 (35%), Positives = 80/156 (51%), Gaps = 4/156 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  +  V IG VD GKST  G L+Y+ GG+ +  +        E G+ S  +A + D L 
Sbjct: 49  RSLLRFVTIGSVDDGKSTLIGRLLYETGGVFEDQLAAVTSTDGE-GEASINFANLTDGLV 107

Query: 181 AERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
           AERE+        RY + + R   +     D PGH  + +NM TG S AD A++++ A  
Sbjct: 108 AEREQGITIDVAYRYFATKKRKFIIA----DTPGHVQYTRNMATGASTADAAIILIDARL 163

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
           G  +       Q+R HA +A  +G+  L+V VNKMD
Sbjct: 164 GVLQ-------QSRRHATIANLIGIPHLLVAVNKMD 192



 Score = 39.9 bits (89), Expect = 0.061
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = +3

Query: 513 SYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAI 692
           ++  K+G++   V F P+S   GDN+++ ST+ PWF   +    +GK  GK L+E L+ +
Sbjct: 210 AFTAKLGFDK--VEFFPVSALEGDNVVQASTRTPWFA--ESGGADGKG-GKPLLEHLETM 264

Query: 693 LPP 701
             P
Sbjct: 265 PVP 267


>UniRef50_Q2S507 Cluster: Sulfate adenylyltransferase, large subunit
           subfamily, putative; n=5; cellular organisms|Rep:
           Sulfate adenylyltransferase, large subunit subfamily,
           putative - Salinibacter ruber (strain DSM 13855)
          Length = 639

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 60/170 (35%), Positives = 81/170 (47%), Gaps = 4/170 (2%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +     G VD GKST  G L+Y    I +  +E+ E+  Q   +   + A + D L+AER
Sbjct: 14  LRFTTAGSVDDGKSTLIGRLMYDTQEIFEEKMEEIERNTQRDDE-ELELALLTDGLRAER 72

Query: 190 ERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 357
           E+        RY S   R   +     D PGH  + +NM+TG S A+ AV ++ A  G  
Sbjct: 73  EQGITIDVAYRYFSTPERKFIIA----DTPGHEQYTRNMVTGASTAELAVELIDARNGVL 128

Query: 358 EAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           E       QTR H  +   L +  +IV VNKMD     YSE RF EI  E
Sbjct: 129 E-------QTRRHGFITSLLQIPHVIVAVNKMDLV--GYSEARFREIVAE 169



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 13/26 (50%), Positives = 18/26 (69%)
 Frame = +3

Query: 549 VAFVPISGWHGDNMLEPSTKMPWFKG 626
           + FVPIS   GDN++  S  MPW++G
Sbjct: 182 ITFVPISALKGDNVVHHSGNMPWYEG 207


>UniRef50_Q9RGE9 Cluster: Sulfate adenylyltransferase subunit CysN;
           n=7; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit CysN - Campylobacter jejuni
          Length = 472

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 51/165 (30%), Positives = 80/165 (48%), Gaps = 2/165 (1%)
 Frame = +1

Query: 19  VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVLDKLKAERE 192
           +  G VD GKST  G L+Y    +    +   EK++++MG    K  +A ++D L +ERE
Sbjct: 21  ITCGSVDDGKSTLIGRLLYDTKALFSDQLSTLEKDSKKMGNAGDKLDFALLVDGLASERE 80

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           +            + +      D PGH  + +NM TG S AD A++++ A  G  +    
Sbjct: 81  QGITIDVAYRFFTSNKRKFIIADTPGHEQYTRNMATGASTADIAIILIDARKGVLK---- 136

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
              QT+ H+ +   LG+K  I+ +NKMD     Y E  F  I K+
Sbjct: 137 ---QTKRHSYIVSLLGIKNFIIAINKMDLVS--YEEKIFNNICKD 176


>UniRef50_Q9L9U8 Cluster: Putative ATP sulfurylase large subunit;
           n=2; Proteobacteria|Rep: Putative ATP sulfurylase large
           subunit - Chromatium vinosum (Allochromatium vinosum)
          Length = 434

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 61/193 (31%), Positives = 87/193 (45%), Gaps = 4/193 (2%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +  +  G VD GKST  G L+Y    I   T+      +Q  G      + + D L+AER
Sbjct: 15  LRFLTCGSVDDGKSTLIGRLLYDTKAILADTLHAIAATSQRRGLSELDLSLLTDGLQAER 74

Query: 190 ER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 357
           E+        RY S   R   +     DAPGH  + +NM+T  S A  A+++V A  G  
Sbjct: 75  EQGITIDVAYRYFSTGTRKYII----ADAPGHEQYTRNMVTAASTAHLAIILVDARRG-- 128

Query: 358 EAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLAT 537
                   QTR H+ LA  +G+  L+V VNKMD  +  Y +  FE I+ E    + RL  
Sbjct: 129 -----VQTQTRRHSYLAHLVGLPHLVVAVNKMDLVD--YDQAVFERIRAEYLDFAARLGI 181

Query: 538 TQLLSLSCPFLDG 576
             +  +    L G
Sbjct: 182 EDVRFIPLSALHG 194



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +3

Query: 549 VAFVPISGWHGDNMLEPSTKMPWFKG 626
           V F+P+S  HGDN++E   ++ W+ G
Sbjct: 184 VRFIPLSALHGDNVVERGERLDWYDG 209


>UniRef50_A0EFI6 Cluster: Elongation factor Tu; n=3; Paramecium
           tetraurelia|Rep: Elongation factor Tu - Paramecium
           tetraurelia
          Length = 471

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 56/154 (36%), Positives = 79/154 (51%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGH+D GK+T T         I K   ++   E QE GK        +DK   E+
Sbjct: 32  LNVGTIGHIDHGKTTLTS-------AITKVLAKQQLAEFQEYGK--------IDKAPEEK 76

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R       ++E +       H+D PGH D++KNMITG ++ D A+L+VAA  G      
Sbjct: 77  ARGITINSATVEYQTKTRHYGHVDCPGHIDYVKNMITGAAKMDAAILVVAATDGCM---- 132

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
               QTREH LL   +GV+ +IV VNK+D  + P
Sbjct: 133 ---AQTREHVLLCRQVGVETIIVFVNKIDLAKDP 163


>UniRef50_A2WJZ4 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 806

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 34/63 (53%), Positives = 47/63 (74%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 186
           ++N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   E
Sbjct: 428 QLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSEE 487

Query: 187 RER 195
           RER
Sbjct: 488 RER 490



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/41 (60%), Positives = 30/41 (73%)
 Frame = +1

Query: 379 GQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
           GQT+EHA L  + GV+QLIV VNKMD+    YS+ RFE IK
Sbjct: 502 GQTKEHAQLIRSFGVEQLIVAVNKMDAI--GYSKERFEFIK 540


>UniRef50_Q83JX8 Cluster: Sulfate adenylyltransferase subunit 1;
           n=26; Bacteria|Rep: Sulfate adenylyltransferase subunit
           1 - Shigella flexneri
          Length = 475

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 55/172 (31%), Positives = 86/172 (50%), Gaps = 6/172 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY--AWVLDKLKA 183
           +  +  G VD GKST  G L++    I +  +     +++  G    K   A ++D L+A
Sbjct: 28  LRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQA 87

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY S E R   +     D PGH  + +NM TG S  + A+L++ A  G
Sbjct: 88  EREQGITIDVAYRYFSTEKRKFIIA----DTPGHEQYTRNMATGASTCELAILLIDARKG 143

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             +       QTR H+ ++  LG+K L+V +NKMD  +  YSE  F  I+++
Sbjct: 144 VLD-------QTRRHSFISTLLGIKHLVVAINKMDLVD--YSEETFTRIRED 186



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 2/42 (4%)
 Frame = +3

Query: 507 RSSYIKKIGYNPAA--VAFVPISGWHGDNMLEPSTKMPWFKG 626
           R  Y+   G  P    + FVP+S   GDN+   S  MPW+ G
Sbjct: 184 REDYLTFAGQLPGNLDIRFVPLSALEGDNVASQSESMPWYSG 225


>UniRef50_Q10600 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=24; Bacteria|Rep:
           Bifunctional enzyme cysN/cysC [Includes: Sulfate
           adenylyltransferase subunit 1 (EC 2.7.7.4) (Sulfate
           adenylate transferase) (SAT) (ATP- sulfurylase large
           subunit); Adenylyl-sulfate kinase (EC 2.7.1.25) (APS
           kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)] - Mycobacterium tuberculosis
          Length = 614

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 56/189 (29%), Positives = 87/189 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           + +   G VD GKST  G L+Y    + +      E+ +++ G      A V D L+AER
Sbjct: 5   LRLATAGSVDDGKSTLIGRLLYDSKAVMEDQWASVEQTSKDRGHDYTDLALVTDGLRAER 64

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           E+              +      D PGH  + +NM+TG S A   +++V A  G  E   
Sbjct: 65  EQGITIDVAYRYFATPKRKFIIADTPGHIQYTRNMVTGASTAQLVIVLVDARHGLLE--- 121

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQLL 549
               Q+R HA LA  LG++ L++ VNKMD     + + +F+ I+ E    + RL    + 
Sbjct: 122 ----QSRRHAFLASLLGIRHLVLAVNKMDLL--GWDQEKFDAIRDEFHAFAARLDVQDVT 175

Query: 550 SLSCPFLDG 576
           S+    L G
Sbjct: 176 SIPISALHG 184



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +3

Query: 549 VAFVPISGWHGDNMLEPSTKMPWFKG 626
           V  +PIS  HGDN++  S + PW++G
Sbjct: 174 VTSIPISALHGDNVVTKSDQTPWYEG 199


>UniRef50_UPI000050FE96 Cluster: COG2895: GTPases - Sulfate
           adenylate transferase subunit 1; n=1; Brevibacterium
           linens BL2|Rep: COG2895: GTPases - Sulfate adenylate
           transferase subunit 1 - Brevibacterium linens BL2
          Length = 448

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 53/172 (30%), Positives = 88/172 (51%), Gaps = 6/172 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG--KGSFKYAWVLDKLKA 183
           +     G VD GKST  G L++    I    +E   + ++E G   G F +A + D L+A
Sbjct: 17  LRFATAGSVDDGKSTLVGRLLHDAKAILADQLEAVTRTSEERGFVGGEFDFALLTDGLRA 76

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY + + R+  +L    D PGH  + +NM+TG + AD  V+++ A TG
Sbjct: 77  EREQGITIDVAYRYFATDKRS-FILA---DCPGHVQYTRNMVTGATTADAVVVLIDARTG 132

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             E       QTR H  +   LG++ +I+ +NK+D  +  Y +  + +++ E
Sbjct: 133 ATE-------QTRRHLTVVHRLGIRHVILAINKIDLLD--YDQAAYAKVEAE 175


>UniRef50_Q82L80 Cluster: Putative sulfate adenylyltransferase large
           subunit; n=1; Streptomyces avermitilis|Rep: Putative
           sulfate adenylyltransferase large subunit - Streptomyces
           avermitilis
          Length = 487

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 57/189 (30%), Positives = 87/189 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +     G VD GKST  G L++    +    +E  E+ ++  G+ +   A + D L+AER
Sbjct: 22  LRFATAGSVDDGKSTLVGRLLHDSKSVLTDQLEAVEQVSRSRGQDAPDLALLTDGLRAER 81

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           E+              +      D PGH  + +NM+TG S AD AV++V A  G  E   
Sbjct: 82  EQGITIDVAYRYFATARRRFILADTPGHVQYTRNMVTGASTADLAVVLVDARNGVIE--- 138

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQLL 549
               QTR HA +A  L V  +++ VNKMD  E  Y E  F  I ++    +  L   ++ 
Sbjct: 139 ----QTRRHAAVAALLRVPHVVLAVNKMDLVE--YKESVFAAIAEKFTAYASELGVPEIT 192

Query: 550 SLSCPFLDG 576
           ++    L G
Sbjct: 193 AIPISALAG 201


>UniRef50_A3HVR6 Cluster: Sulfate adenylyltransferase subunit 1;
           n=8; Bacteroidetes|Rep: Sulfate adenylyltransferase
           subunit 1 - Algoriphagus sp. PR1
          Length = 418

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 50/169 (29%), Positives = 79/169 (46%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  I I   G VD GKST  G L+Y    +    IE  E+ +++ G     ++   D L 
Sbjct: 5   RKLIKIATAGSVDDGKSTLIGRLLYDTKSLTTDKIEAIERSSKQRGYDYLDFSLATDGLV 64

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           AERE+        +     +      D PGH ++ +NM+TG S +  A++++ A  G  E
Sbjct: 65  AEREQGITIDVAHIYFNTDKTNFIVADTPGHVEYTRNMVTGASTSQVAIILIDARKGVIE 124

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
                  QT  H  +A  L +  ++V +NKMD  +  Y E  + +IK +
Sbjct: 125 -------QTYRHFFIANLLRISHVVVAINKMDLVD--YEEDVYLKIKAD 164



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 11/36 (30%), Positives = 22/36 (61%)
 Frame = +3

Query: 519 IKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++K  ++   + F+P+S   G+N+   S +MPW+ G
Sbjct: 169 VEKSDFSEDQITFIPVSALKGENIARQSEEMPWYVG 204


>UniRef50_Q39DS0 Cluster: Sulfate adenylyltransferase, large
           subunit; n=29; Burkholderiaceae|Rep: Sulfate
           adenylyltransferase, large subunit - Burkholderia sp.
           (strain 383) (Burkholderia cepacia (strain ATCC 17760/
           NCIB 9086 / R18194))
          Length = 438

 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 53/191 (27%), Positives = 87/191 (45%), Gaps = 2/191 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGS-FKYAWVLDKLKAE 186
           +  +  G VD GKST  G L+Y    +    +    +   +   G     A + D L+AE
Sbjct: 13  LRFITAGSVDDGKSTLIGRLLYDSKAVLSDQLSALSRAKNKRTVGDELDLALLTDGLEAE 72

Query: 187 RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
           RE+              +      D PGH  + +NM+TG S A  A++++ A     E G
Sbjct: 73  REQGITIDVAYRYFATAKRKFIIADTPGHEQYTRNMVTGASTAHAAIILIDATRVTIENG 132

Query: 367 ISK-NGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQ 543
           ++    QT+ H+ +   L ++ +IV +NKMD  +  YSE RF EI+      +++L  T 
Sbjct: 133 VADLLPQTKRHSAIVKLLALQHVIVAINKMDLVD--YSEARFNEIRDAYVTLAKQLGLTD 190

Query: 544 LLSLSCPFLDG 576
           +  +    L G
Sbjct: 191 VRFVPVSALKG 201



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 3/45 (6%)
 Frame = +3

Query: 501 EGRSSYI---KKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           E R +Y+   K++G     V FVP+S   GDN++  S +MPW+ G
Sbjct: 174 EIRDAYVTLAKQLGLTD--VRFVPVSALKGDNIVGASERMPWYAG 216


>UniRef50_Q8ZMF5 Cluster: Sulfate adenylyltransferase subunit 1;
           n=38; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit 1 - Salmonella typhimurium
          Length = 479

 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 55/172 (31%), Positives = 85/172 (49%), Gaps = 6/172 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY--AWVLDKLKA 183
           +  +  G VD GKST  G L++    I +  +     +++  G    K   A ++D L+A
Sbjct: 28  LRFLTCGSVDDGKSTLIGRLLHDTLQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQA 87

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY S E R   +     D PGH  + +NM TG S  D A+L++ A  G
Sbjct: 88  EREQGITIDVAYRYFSTERRKFIIA----DTPGHEQYTRNMATGASTCDLAILLIDARKG 143

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             +       QTR H+ ++  LG+K L+V +NKMD  +  Y E  F  I+++
Sbjct: 144 VLD-------QTRRHSFISTLLGIKHLVVAINKMDLVD--YREETFARIRED 186


>UniRef50_Q0SH95 Cluster: CysN/CysC bifunctional enzyme; n=14;
           Actinomycetales|Rep: CysN/CysC bifunctional enzyme -
           Rhodococcus sp. (strain RHA1)
          Length = 627

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 65/186 (34%), Positives = 91/186 (48%), Gaps = 4/186 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  + +   G VD GKST  G L++  G +    +E     A     G    A + D L+
Sbjct: 8   RQLLRLATAGSVDDGKSTLIGRLLHDTGSLPTDHLE-----AVTNADGEADLAALSDGLR 62

Query: 181 AERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
           AERE+        R+ S   R+  VL    D PGH  + +NM TG S A  AVL+V A  
Sbjct: 63  AEREQGITIDVAYRFFSTPTRS-FVLA---DTPGHERYTRNMFTGASNAHVAVLLVDA-- 116

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRR 528
               AG+ +  QTR HA +A  LGV  L+  VNK+D  +  + E RF+E++ E    ++R
Sbjct: 117 ---RAGVLR--QTRRHARIADLLGVPHLVAVVNKIDLVD--FDETRFKEVESELGLLAQR 169

Query: 529 LATTQL 546
           L    L
Sbjct: 170 LGGRDL 175


>UniRef50_Q8ZBP2 Cluster: Sulfate adenylyltransferase subunit 1;
           n=20; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit 1 - Yersinia pestis
          Length = 478

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 57/182 (31%), Positives = 88/182 (48%), Gaps = 6/182 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY--AWVLDKLKA 183
           +  +  G VD GKST  G L++    I +  +     +++ +G    K   A ++D L+A
Sbjct: 31  LRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSTLHTDSKRIGTQGEKLDLALLVDGLQA 90

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY S E R   +     D PGH  + +NM TG S  D A+L++ A  G
Sbjct: 91  EREQGITIDVAYRYFSTEKRKFIIA----DTPGHEQYTRNMATGASTCDLAILLIDARKG 146

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRL 531
             +       QTR H+ +A  LG++ L+V VNKMD     + E  F + K +    + +L
Sbjct: 147 VLD-------QTRRHSFIATLLGIRHLVVAVNKMDLV--GFQESVFTQFKDDYLSFAEQL 197

Query: 532 AT 537
            T
Sbjct: 198 PT 199



 Score = 35.9 bits (79), Expect = 0.99
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = +3

Query: 549 VAFVPISGWHGDNMLEPSTKMPWFKG 626
           + FVP+S   GDN+  PS KM W+ G
Sbjct: 203 IKFVPLSALDGDNVASPSEKMDWYSG 228


>UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial
           precursor; n=73; cellular organisms|Rep: Elongation
           factor Tu, mitochondrial precursor - Homo sapiens
           (Human)
          Length = 452

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 54/152 (35%), Positives = 71/152 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGHVD GK+T T  +                K   E G   FK    +D    ER
Sbjct: 58  VNVGTIGHVDHGKTTLTAAIT---------------KILAEGGGAKFKKYEEIDNAPEER 102

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        +E         H D PGH D++KNMITGT+  D  +L+VAA  G      
Sbjct: 103 ARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP--- 159

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
               QTREH LLA  +GV+ ++V VNK D+ +
Sbjct: 160 ----QTREHLLLARQIGVEHVVVYVNKADAVQ 187


>UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular
           organisms|Rep: Elongation factor Tu - Treponema pallidum
          Length = 395

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 53/154 (34%), Positives = 77/154 (50%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGHVD GK+T +  +   C              A++ G    KY  + D    E+
Sbjct: 13  MNVGTIGHVDHGKTTLSAAITSYC--------------AKKFGDKQLKYDEI-DNAPEEK 57

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        LE ++ +    HID PGH D++KNMITG +Q D  +L+V+A  G      
Sbjct: 58  ARGITINTRHLEYQSDRRHYAHIDCPGHADYVKNMITGAAQMDGGILVVSAPDGVMP--- 114

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
               QT+EH LLA  +GV  +IV +NK+D  + P
Sbjct: 115 ----QTKEHLLLARQVGVPSIIVFLNKVDLVDDP 144


>UniRef50_A6GM01 Cluster: Bifunctional sulfate adenylyltransferase
           subunit 1/adenylylsulfate kinase protein; n=1;
           Limnobacter sp. MED105|Rep: Bifunctional sulfate
           adenylyltransferase subunit 1/adenylylsulfate kinase
           protein - Limnobacter sp. MED105
          Length = 575

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 50/155 (32%), Positives = 76/155 (49%), Gaps = 6/155 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 183
           +  +  G VD GKST  G ++++   + +  +     E++  G    +  YA ++D L A
Sbjct: 20  LRFITCGSVDDGKSTLIGRMLWESQQLFEDQVAALRNESKRYGTQGDNIDYALLVDGLSA 79

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY   + R   V     D PGH  + +NM+TG S A  AVL++ A  G
Sbjct: 80  EREQGITIDVAYRYFQTDARKFIVA----DTPGHEQYTRNMVTGASTAHLAVLLIDARKG 135

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
                     QTR HA L   +G++ L++ VNKMD
Sbjct: 136 VLT-------QTRRHAFLTQLVGIRHLVLAVNKMD 163


>UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu),
           mitochondrial protein 2; n=5; Chromadorea|Rep: Tu
           elongation factor (Ef-tu), mitochondrial protein 2 -
           Caenorhabditis elegans
          Length = 439

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 55/154 (35%), Positives = 76/154 (49%), Gaps = 2/154 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHL--IYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           +N+  IGH+D GK+T T  +  +    G  K    KF++               +DK K 
Sbjct: 46  VNVGTIGHIDHGKTTLTSAITRVQAKKGFAKHI--KFDE---------------IDKGKE 88

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           E++R        +   +      H D PGH DFIKNMI GTSQ D AVL++AA  G  E 
Sbjct: 89  EKKRGITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME- 147

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
                 QT+EH +LA  +GVK + + +NK D  E
Sbjct: 148 ------QTKEHLILAKQVGVKNMAIFINKADLVE 175


>UniRef50_UPI00006CBD5B Cluster: Elongation factor Tu, mitochondrial
           precursor, putative; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu, mitochondrial
           precursor, putative - Tetrahymena thermophila SB210
          Length = 375

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 51/154 (33%), Positives = 74/154 (48%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGH+D GK+T T  +   C   DK+  E    ++             +DK   E+
Sbjct: 34  LNVGTIGHIDHGKTTLTAAITKICA--DKKLAEFMAYDS-------------IDKAPEEK 78

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R       ++E         H+D PGH D++KNMITG ++ D  +L+ +A  G      
Sbjct: 79  ARGITINTATVEYETETRHYGHVDCPGHIDYVKNMITGAAKMDAGILVCSATDGVMP--- 135

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
               QTREH LL   +GVK +IV VNK D  + P
Sbjct: 136 ----QTREHILLCRQVGVKTIIVFVNKCDMAKDP 165


>UniRef50_Q8NLX2 Cluster: GTPases-Sulfate adenylate transferase
           subunit 1; n=5; Actinomycetales|Rep: GTPases-Sulfate
           adenylate transferase subunit 1 - Corynebacterium
           glutamicum (Brevibacterium flavum)
          Length = 433

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 55/173 (31%), Positives = 85/173 (49%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           R  + +   G VD GKST  G L++    +    +   E+ + + G      + ++D L+
Sbjct: 16  RETLRLCTAGSVDDGKSTFVGRLLHDTKSVLADQLASVERTSADRGFEGLDLSLLVDGLR 75

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
           AERE+        RY + + R   +L    D PGH  + +N +TG S +   VL+V A  
Sbjct: 76  AEREQGITIDVAYRYFATDKRT-FILA---DTPGHVQYTRNTVTGVSTSQVVVLLVDARH 131

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           G  E       QTR H  ++  LGV+ +I+ VNK+D  +  YSE  F  I+KE
Sbjct: 132 GVVE-------QTRRHLSVSALLGVRTVILAVNKIDLVD--YSEEVFRNIEKE 175



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 14/23 (60%), Positives = 16/23 (69%)
 Frame = +3

Query: 558 VPISGWHGDNMLEPSTKMPWFKG 626
           VPIS   GDN+ EPST M W+ G
Sbjct: 191 VPISALKGDNVAEPSTHMDWYTG 213


>UniRef50_Q1FK57 Cluster: Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit; n=3;
           Clostridiales|Rep: Small GTP-binding protein
           domain:Sulfate adenylyltransferase, large subunit -
           Clostridium phytofermentans ISDg
          Length = 563

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 52/169 (30%), Positives = 80/169 (47%), Gaps = 4/169 (2%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIY--KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           +  +  G VD GKST  GH++Y  K    D+      + +    G G   Y+ +LD L+A
Sbjct: 5   LKFITCGSVDDGKSTLIGHILYDSKLLYTDQENALMLDSKVGSRG-GEIDYSLLLDGLEA 63

Query: 184 ERER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 357
           ERE+       Y     +N   +    D PGH ++ +NM  G S A   ++++ A  G  
Sbjct: 64  EREQGITIDVAYRYFTTKNRSFIV--ADTPGHEEYTRNMAVGASFAQLTIILIDAKQGVL 121

Query: 358 EAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
                   QT+ H+ +   +G+   +  VNKMD  +  YSE RF EIK+
Sbjct: 122 L-------QTKRHSRICSFMGIHHFVFAVNKMDLVD--YSEERFLEIKR 161


>UniRef50_Q7K3V6 Cluster: Elongation factor Tu; n=7; Coelomata|Rep:
           Elongation factor Tu - Drosophila melanogaster (Fruit
           fly)
          Length = 456

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 51/148 (34%), Positives = 73/148 (49%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N+  IGHVD GK+T T              I + + +    G   +     +D+   E+ 
Sbjct: 59  NVGTIGHVDHGKTTLTA------------AITRIQSQK---GLAEYLSYDQIDRAPEEKA 103

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R      C +     +    H D PGH D+IKNMI+G SQ D A+L+VAA  G+      
Sbjct: 104 RGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP---- 159

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD 456
              QTREH LLA  +G++++IV +NK D
Sbjct: 160 ---QTREHLLLAKQVGIQRIIVFINKAD 184


>UniRef50_A1W6V4 Cluster: Sulfate adenylyltransferase, large
           subunit; n=9; Burkholderiales|Rep: Sulfate
           adenylyltransferase, large subunit - Acidovorax sp.
           (strain JS42)
          Length = 462

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 54/159 (33%), Positives = 79/159 (49%), Gaps = 5/159 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +  +  G VD GKST  G L+     +D R + +      + G G    A + D L AER
Sbjct: 28  LRFITCGSVDDGKSTLIGRLL-----VDSRAVLQDHLAGVQRG-GETDLALLTDGLSAER 81

Query: 190 ERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 357
           E+        RY + E R   +     DAPGH  + +NM+T  SQAD AV++V A   ++
Sbjct: 82  EQGITIDVAYRYFATEARKFIIG----DAPGHEQYTRNMVTAASQADAAVVLVDATKLDW 137

Query: 358 E-AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
           +   ++   QTR H+LL   L V  L+  VNK+D+   P
Sbjct: 138 QNPQLTLLPQTRRHSLLVHLLRVHSLVFAVNKLDAVADP 176


>UniRef50_Q9UVK1 Cluster: SUP35 homolog; n=1; Pichia pastoris|Rep:
           SUP35 homolog - Pichia pastoris (Yeast)
          Length = 315

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 31/63 (49%), Positives = 47/63 (74%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  I+I+ +GHVD+GKST  G+L+Y  G +DKRTI+K+EKEA++ G+  +  +WV+D  K
Sbjct: 238 KDHISILFMGHVDAGKSTMGGNLLYLTGSVDKRTIDKYEKEAKDAGRQGWYLSWVMDTNK 297

Query: 181 AER 189
            ER
Sbjct: 298 EER 300


>UniRef50_Q0EDG4 Cluster: Mitochondrial EF-Tu2; n=1; Trichinella
           britovi|Rep: Mitochondrial EF-Tu2 - Trichinella britovi
          Length = 428

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 51/155 (32%), Positives = 74/155 (47%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +   NI  IGH+D GK+T T  L      + K T  KF    +            +DK  
Sbjct: 26  KENFNIGTIGHIDHGKTTLTAALTKV---LSKTTNTKFVPFDE------------IDKAP 70

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            E++R        +     +    H D PGH+DFIKNMI G +Q D A+L+V A  G   
Sbjct: 71  EEQQRGITISIAHVGYETKKRKYSHTDCPGHKDFIKNMICGATQMDAAILVVDAAEGTMP 130

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
                  QTREH +LA  +GV++++V +NK +  +
Sbjct: 131 -------QTREHVMLAKQVGVQRIVVFINKAEMVD 158


>UniRef50_A4SYY3 Cluster: Sulfate adenylyltransferase, large
           subunit; n=13; Proteobacteria|Rep: Sulfate
           adenylyltransferase, large subunit - Polynucleobacter
           sp. QLW-P1DMWA-1
          Length = 447

 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 51/157 (32%), Positives = 74/157 (47%), Gaps = 8/157 (5%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGS---FKYAWVLDKLK 180
           +  +  G VD GKST  G L+Y    I    +E   K        S      A + D L+
Sbjct: 10  VRFITAGSVDDGKSTLIGRLLYDTKSILVDQLESLSKTKHARVTSSDAGVDLALLTDGLE 69

Query: 181 AERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
           AERE+        RY S   R   V     DAPGH  + +N++TG SQ+D AV++V A  
Sbjct: 70  AEREQGITIDVAYRYFSTPKRKFIVA----DAPGHEQYTRNLVTGASQSDVAVILVDATR 125

Query: 349 GEFE-AGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
            +      +   QT+ HA +   LG++ ++  +NKMD
Sbjct: 126 VDLSTTPATLLAQTKRHAAIVHLLGLRHVVFAINKMD 162


>UniRef50_Q1ITG6 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Acidobacteria bacterium Ellin345|Rep:
           Sulfate adenylyltransferase, large subunit -
           Acidobacteria bacterium (strain Ellin345)
          Length = 543

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 54/193 (27%), Positives = 85/193 (44%), Gaps = 4/193 (2%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           + I   G VD GKST  G L+Y    + +  +    +    +G     +A + D L+AER
Sbjct: 29  LRISTAGSVDDGKSTLIGRLLYDSRNVYEDHVRSVTRHDVSLGTSVVDFAQLTDGLRAER 88

Query: 190 ER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 357
           E+        RY S   R   +     D PGH  + +NM TG S +D A++++ A  G  
Sbjct: 89  EQGITIDVAYRYFSTAKRKFII----ADTPGHEQYTRNMATGASTSDLAIVLIDARKGVL 144

Query: 358 EAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLAT 537
                   Q+R H  +A  LG+ +++  +NKMD  +  +S   F     E       L  
Sbjct: 145 V-------QSRRHLYIAALLGIPRVVATINKMDLVD--FSPEVFAAHSLELKRLGDGLGI 195

Query: 538 TQLLSLSCPFLDG 576
             L+++    LDG
Sbjct: 196 PSLVTIPISALDG 208



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +3

Query: 531 GYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           G    ++  +PIS   GDN++E S + PW+ G
Sbjct: 192 GLGIPSLVTIPISALDGDNVVETSARTPWYDG 223


>UniRef50_Q4G4A5 Cluster: Elongation factor 1A; n=86; Eukaryota|Rep:
           Elongation factor 1A - Echinostelium minutum
          Length = 237

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 35/60 (58%), Positives = 40/60 (66%)
 Frame = +3

Query: 522 KKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPP 701
           KKIGYNP  +AFVPISGWHGDNMLE ST +PW+K            G  L+EALDA+  P
Sbjct: 1   KKIGYNPEKIAFVPISGWHGDNMLEKSTNLPWYK------------GPTLLEALDAVQEP 48


>UniRef50_A4VDD2 Cluster: Elongation factor 1-alpha; n=1;
           Tetrahymena thermophila SB210|Rep: Elongation factor
           1-alpha - Tetrahymena thermophila SB210
          Length = 356

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 30/65 (46%), Positives = 48/65 (73%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +++ V G VDSGKSTT GHL++K G +++R I++ +  A++ GK SF +A+V+D+ K
Sbjct: 4   KQHLSVAVFGDVDSGKSTTCGHLVFKLGEVNQRKIDELKALAEKEGKSSFGFAYVMDRTK 63

Query: 181 AERER 195
           AER R
Sbjct: 64  AERSR 68



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 27/64 (42%), Positives = 39/64 (60%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S Y++KIG+N   V+F+PISG+ G N+ E S  MPW+K            G  ++EALD+
Sbjct: 95  SLYLQKIGFNLKNVSFIPISGYIGHNLTEKSESMPWYK------------GNTVLEALDS 142

Query: 690 ILPP 701
           + PP
Sbjct: 143 VTPP 146


>UniRef50_Q4QDW8 Cluster: Elongation factor TU, putative; n=5;
           Trypanosomatidae|Rep: Elongation factor TU, putative -
           Leishmania major
          Length = 466

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 50/150 (33%), Positives = 74/150 (49%)
 Frame = +1

Query: 16  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERER 195
           I  IGHVD GK+T T  +          T+     +AQ +        + +DK   E+ R
Sbjct: 26  IGTIGHVDHGKTTLTSAIT---------TVLAKRGQAQALDY------FAIDKSPEEKSR 70

Query: 196 RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 375
           +       +E  + +    HID PGH DF+KNMITG +Q D  +++VAA  G        
Sbjct: 71  KITINATHVEYESEKRHYGHIDCPGHMDFVKNMITGAAQMDGGIIVVAATDGVMP----- 125

Query: 376 NGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
             QTREH L+   +G+  L+  +NK+D T+
Sbjct: 126 --QTREHLLICSQIGLPALVGFINKVDMTD 153


>UniRef50_Q19072 Cluster: Elongation factor Tu homologue precursor
           (Tu elongation factor (Ef- tu), mitochondrial protein
           1); n=7; Nematoda|Rep: Elongation factor Tu homologue
           precursor (Tu elongation factor (Ef- tu), mitochondrial
           protein 1) - Caenorhabditis elegans
          Length = 496

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 59/164 (35%), Positives = 81/164 (49%), Gaps = 5/164 (3%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ L+   
Sbjct: 51  LNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFHLEYET 110

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           A+R       Y             HID PGH D+IKNMITG +Q + A+L+VAA  G   
Sbjct: 111 AKRH------YA------------HIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP 152

Query: 361 AGISKNGQTREHALLAFTLGV--KQLIVGVNKMDSTEPPYSEPR 486
                  QTREH LLA  +GV    ++V +NK+D  E P +E R
Sbjct: 153 -------QTREHLLLARQVGVPLDNIVVFMNKVD--EVPDAETR 187


>UniRef50_Q08RF5 Cluster: CysN/CysC bifunctional enzyme; n=2;
           Cystobacterineae|Rep: CysN/CysC bifunctional enzyme -
           Stigmatella aurantiaca DW4/3-1
          Length = 574

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 67/209 (32%), Positives = 91/209 (43%), Gaps = 30/209 (14%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE------AQEMGKGS-------- 147
           + +VV+G VD GKST  G L+Y+C G+ +  I    +       A E   G+        
Sbjct: 24  LRLVVVGSVDDGKSTLIGRLLYECDGLFEDQISAVRRATAKRAAAAEATNGAVGTLTQGL 83

Query: 148 ------------FKYAWVLDKLKAERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRD 279
                         ++   D L+AERE+        RY S   R   V     D PGH  
Sbjct: 84  QNAAAGPIPGEDIDFSLFTDGLRAEREQGITIDVAYRYFSTPRRKVIVA----DTPGHIQ 139

Query: 280 FIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDS 459
           + +NM TG S AD AV++  A  G          QTR HA +A  LG+  L V VNKMD 
Sbjct: 140 YTRNMATGASTADAAVILADARLGVLP-------QTRRHAYIASLLGIPYLAVAVNKMDM 192

Query: 460 TEPPYSEPRFEEIKKEDPHTSRRLATTQL 546
            +  +    FE I +E    +R L  TQ+
Sbjct: 193 VD--FDRAVFERIGRELADFARPLGFTQI 219


>UniRef50_Q45W23 Cluster: Tuf1; n=1; uncultured Pseudonocardia
           sp.|Rep: Tuf1 - uncultured Pseudonocardia sp
          Length = 230

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 34/71 (47%), Positives = 45/71 (63%)
 Frame = +1

Query: 253 HIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 432
           H+D PGH D++KNMITG +Q D A+L+VAA  G          QTREH LLA  +GV  +
Sbjct: 17  HVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMP-------QTREHVLLARQVGVPYI 69

Query: 433 IVGVNKMDSTE 465
           +V +NK D  +
Sbjct: 70  VVALNKADMVD 80


>UniRef50_Q25820 Cluster: Elongation factor Tu; n=99; cellular
           organisms|Rep: Elongation factor Tu - Plasmodium
           falciparum
          Length = 410

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 50/152 (32%), Positives = 71/152 (46%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  IN+  IGHVD GK+T T  + Y                 Q + K  + Y+ + D   
Sbjct: 10  KQHINLGTIGHVDHGKTTLTTAISYLLN-------------LQGLSK-KYNYSDI-DSAP 54

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            E+ R        +E       C HID PGH D+IKNMI G +Q D A+L+++   G   
Sbjct: 55  EEKIRGITINTTHIEYETLTKHCAHIDCPGHSDYIKNMIIGATQMDIAILVISIIDGIMP 114

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
                  QT EH LL   +G+K +I+ +NK D
Sbjct: 115 -------QTYEHLLLIKQIGIKNIIIFLNKED 139


>UniRef50_Q8WT68 Cluster: Elongation factor-1 alpha; n=3;
           Endopterygota|Rep: Elongation factor-1 alpha -
           Xiphocentron sp. UMSP000029372-Costa Rica
          Length = 366

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 45/126 (35%), Positives = 64/126 (50%)
 Frame = +3

Query: 129 GNG*RILQICLGIGQTKG*A*AXXXXXXXXXXXXXXASTMLPH*CSWTQRFHQEHDHRNL 308
           G+G  ++Q+ +G GQ +G A A                    H  +  Q  HQEHDH ++
Sbjct: 2   GDGQXVVQVRVGAGQAEGGARARHHHRHRAVEVRDGQVLRDHHRRARPQGLHQEHDHGHV 61

Query: 309 SG*LRCAHRSCRYR*IRSWYL*ERSNP*ACLARFHPRCQTAHRRSKQNGFH*TTIQ*AQI 488
           +G LR A R  R+R +R  +L ER +  A LA  H R Q A RR +Q+G     +Q A +
Sbjct: 62  AGGLRRADRGRRHRRVRGGHLQERPDARARLAGLHARRQAARRRRQQDGLDGAALQRAAL 121

Query: 489 *GNQEG 506
            G+QEG
Sbjct: 122 RGDQEG 127



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/63 (49%), Positives = 40/63 (63%)
 Frame = +2

Query: 509 ILIHQEDWLQPSCCRFRAHFWMARRQHVGAFNQNALVQGMAGGA*GRQS*RKMPH*SSRC 688
           +++HQED LQP     RAH  +ARRQH GA  Q+A+VQG+ GGA G Q   ++P      
Sbjct: 129 VVVHQEDRLQPGRRGVRAHLGLARRQHAGAVRQDAVVQGVEGGAQGGQRRGQVPDRGVGR 188

Query: 689 HPA 697
           HPA
Sbjct: 189 HPA 191


>UniRef50_Q4U972 Cluster: Translation elongation factor 1-alpha,
           putative; n=3; Theileria|Rep: Translation elongation
           factor 1-alpha, putative - Theileria annulata
          Length = 577

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 54/179 (30%), Positives = 87/179 (48%), Gaps = 13/179 (7%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK------FEKEAQEMGKG----SF 150
           R+ +N+VV+G VD+GKST  GH +     +DK+           ++   E  KG      
Sbjct: 95  RYPLNVVVLGAVDAGKSTLLGHFLTLTNCVDKKLKNVKHLSWILDQGDDERDKGITIDPT 154

Query: 151 KYAWVLDKLKAERERRYHNRYCSLEVRN---*QVLCYHIDAPGHRDFIKNMITGTSQADC 321
           K  + LD LK+ +    HN +  +   N     +    ID PGH D I+N++ G   A+ 
Sbjct: 155 KCQFNLD-LKSIKHNNNHNEH-QINTENPVYDHIKVNVIDTPGHHDLIQNLVMGAVFANS 212

Query: 322 AVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
           A++IV   + +            EH LL + LG++ +I+ VNK+D  E  YSE  + ++
Sbjct: 213 AIIIV--DSNDVLKSDFFGVYFSEHMLLLYLLGIRYIIICVNKIDRFE--YSETMYNKV 267



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 555 FVPISGWHGDNMLEPSTKMPWFKG 626
           F+P+SG  GDN+++ S  + W+KG
Sbjct: 286 FLPVSGLRGDNLIDKSNNLSWYKG 309


>UniRef50_UPI0000EB403C Cluster: UPI0000EB403C related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB403C UniRef100
           entry - Canis familiaris
          Length = 300

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 33/64 (51%), Positives = 39/64 (60%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGY+P  VAF  IS W+GD+M EPS  M     W+V    G      L+E LD 
Sbjct: 31  STYIKKIGYHPDTVAFASISIWNGDDMPEPSANM----AWKVTHNHGNTSETMLLEVLDC 86

Query: 690 ILPP 701
           ILPP
Sbjct: 87  ILPP 90



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 26/98 (26%), Positives = 42/98 (42%)
 Frame = +1

Query: 418 GVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQLLSLSCPFLDGTETTCWS 597
           G+KQLIVG  K+D TE  YS+ R +E  +E  +  +       +      +     + W+
Sbjct: 1   GMKQLIVGGGKVDFTESSYSQKRDKEPVRESTYIKK-------IGYHPDTVAFASISIWN 53

Query: 598 LQPKCLGSRDGRWSVRKAKLTENASLKLSMPSCHLPPT 711
                  S +  W V       + ++ L +  C LPPT
Sbjct: 54  GDDMPEPSANMAWKVTHNHGNTSETMLLEVLDCILPPT 91


>UniRef50_A7ANX2 Cluster: Elongation factor Tu GTP binding domain
           containing protein; n=1; Babesia bovis|Rep: Elongation
           factor Tu GTP binding domain containing protein -
           Babesia bovis
          Length = 601

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 51/162 (31%), Positives = 73/162 (45%), Gaps = 10/162 (6%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE-AQEMGKGSFKYAWVLDKLKAE 186
           +N+VV G VD GKST  GHL+   G +D R + + +     + G+        +D  KA 
Sbjct: 115 LNVVVCGRVDVGKSTLLGHLLTLLGAVDSRLLRESDMAWILDQGEDERARGITIDPTKAS 174

Query: 187 -----RERRYHNRYCSLE----VRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVA 339
                RE    N     E         V    ID PGH D I N++ G S A  A+++V 
Sbjct: 175 AIINLREPSESNAGSPTEEMAVTYPVNVKIDFIDTPGHHDLIANLVKGASFARAAIVVVD 234

Query: 340 AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
                 E    K G   +H  + + LGV++ I+ VNK+D  E
Sbjct: 235 ILDFLKE---DKYGYFEQHLFILWALGVREFIICVNKVDRLE 273


>UniRef50_Q74NG5 Cluster: NEQ270; n=1; Nanoarchaeum equitans|Rep:
           NEQ270 - Nanoarchaeum equitans
          Length = 396

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 54/168 (32%), Positives = 81/168 (48%), Gaps = 2/168 (1%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 186
           +++I+ IGHVD GK+T    L  K   +D  T ++ +++   +  G   ++   D  K E
Sbjct: 6   DLSIIFIGHVDHGKTTLAKALTGKW--LD--TYKEEQQKGITIRLGYIDFSIYKDPTK-E 60

Query: 187 RERRYHNRYCS--LEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
               Y  + C    E+R   +    +DAPGH   I  M++G +  D AVL+VAA  G   
Sbjct: 61  GYEAYTTQPCEGCEEIRKISL----VDAPGHESLIMVMLSGAALVDAAVLVVAANEGIMP 116

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
                  QT EH   A  +G+K  IV  NK+D      +   +EEIKK
Sbjct: 117 -------QTIEHLKAAEIMGIKHFIVAQNKIDLVTKEQAIKNYEEIKK 157


>UniRef50_A0JZN0 Cluster: Sulfate adenylyltransferase, large
           subunit; n=2; Arthrobacter|Rep: Sulfate
           adenylyltransferase, large subunit - Arthrobacter sp.
           (strain FB24)
          Length = 477

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 67/219 (30%), Positives = 96/219 (43%), Gaps = 23/219 (10%)
 Frame = +1

Query: 28  GHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKG--------SFKYAWVLDKLKA 183
           G VD GKST  G L++    I    ++   + + + G G        +   A + D L+A
Sbjct: 31  GSVDDGKSTLVGRLLHDSKAILADQLDAVARTSADRGFGGAGATGTKAIDLALLTDGLRA 90

Query: 184 ERERRYH----NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ERE+        RY + + R+  +L    D PGH  + KN +TG S AD  V+++ A  G
Sbjct: 91  EREQGITIDVAYRYFATDRRS-FILA---DCPGHVQYTKNTVTGASTADAVVVLIDARKG 146

Query: 352 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRL 531
             E       QTR H  +   L V  +IV VNK+D  +  +SE  F  I+ +     R L
Sbjct: 147 VLE-------QTRRHLSVLQLLRVAHVIVAVNKIDLVD--FSEDVFRGIEADVQKVGREL 197

Query: 532 -----ATTQLLSLSCPFLDG------TETTCWSLQPKCL 615
                  T LL +    LDG      +E T W   P  L
Sbjct: 198 GLGADGITDLLVVPVSALDGDNVVERSERTPWYTGPALL 236


>UniRef50_P18905 Cluster: Elongation factor Tu; n=2;
           Coleochaetales|Rep: Elongation factor Tu - Coleochaete
           orbicularis
          Length = 415

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 48/152 (31%), Positives = 67/152 (44%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGH   GK+T T  +     GI               G    K    +D    E+
Sbjct: 16  LNVGTIGHFSHGKTTLTAAITAVLAGI---------------GYTQPKQNDAIDSTSEEK 60

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        +E         H+D PGH ++I NMITG SQ D A+L+V+A  G      
Sbjct: 61  ARNMSIYVHHVEYETAARHYSHLDCPGHVNYINNMITGVSQMDGAILVVSAVDGPM---- 116

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
               QT+EH LLA  LG+  ++V +NK D  +
Sbjct: 117 ---AQTKEHILLAKLLGISSILVFINKEDELD 145


>UniRef50_Q2LU53 Cluster: Selenocysteine-specific protein
           translation Elongation Factor; n=1; Syntrophus
           aciditrophicus SB|Rep: Selenocysteine-specific protein
           translation Elongation Factor - Syntrophus
           aciditrophicus (strain SB)
          Length = 636

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 37/112 (33%), Positives = 60/112 (53%), Gaps = 2/112 (1%)
 Frame = +1

Query: 169 DKLKAERER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAA 342
           D+LK E+ER       + SL +RN Q+ C  +D PGH  F+KNM+ G +  D  ++++AA
Sbjct: 29  DRLKEEKERGITIELGFASLRLRNGQI-CGVVDVPGHERFVKNMVAGAAGIDMVLMVIAA 87

Query: 343 GTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
             G          QTREH  +   L +++ +V + K+D  +  + E   E+I
Sbjct: 88  DEGVMP-------QTREHLQICSLLNIRKGLVALTKIDLVDRDWMELIREDI 132


>UniRef50_UPI00006A2885 Cluster: UPI00006A2885 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2885 UniRef100 entry -
           Xenopus tropicalis
          Length = 315

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 38/102 (37%), Positives = 48/102 (47%)
 Frame = +1

Query: 130 EMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTS 309
           E G   FK    +D    E+ R        +E         H D PGH D++KNMITGTS
Sbjct: 7   EAGGAQFKKYEEIDNAPEEKARGITINASHVEYATANRHYAHTDCPGHADYVKNMITGTS 66

Query: 310 QADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           Q D  +L+VAA  G+         QTREH LLA    +  L+
Sbjct: 67  QMDGCILVVAATDGQMP-------QTREHLLLAKQANIHTLV 101


>UniRef50_Q9UVK0 Cluster: SUP35 homolog; n=1; Saccharomycodes
           ludwigii|Rep: SUP35 homolog - Saccharomycodes ludwigii
          Length = 305

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 24/50 (48%), Positives = 39/50 (78%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSF 150
           +  ++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++ G+  F
Sbjct: 256 KDHMSLLFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRFCF 305


>UniRef50_A7PFT2 Cluster: Chromosome chr11 scaffold_14, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr11 scaffold_14, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 247

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 27/41 (65%), Positives = 34/41 (82%)
 Frame = +1

Query: 358 EAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE 480
           +AGISK+GQTREHALLA  LGV+Q+I   NKM++T P YS+
Sbjct: 90  QAGISKDGQTREHALLALILGVRQMICCCNKMEATTPKYSK 130


>UniRef50_Q8TYZ3 Cluster: GTPase-translation elongation factor; n=1;
           Methanopyrus kandleri|Rep: GTPase-translation elongation
           factor - Methanopyrus kandleri
          Length = 459

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 39/115 (33%), Positives = 59/115 (51%), Gaps = 2/115 (1%)
 Frame = +1

Query: 166 LDKLKAERER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVA 339
           LDK   E+ER       + S E+ +  V    +DAPGH D I+ ++ G    D A+L+VA
Sbjct: 32  LDKHPEEKERGITIDLGFSSFELGDYTVTL--VDAPGHADLIRTVVAGAEIIDAAILVVA 89

Query: 340 AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
           A  G          QT EH ++   LG+ + ++ +NK+D  +    E R EEIK+
Sbjct: 90  ADEG-------PQVQTGEHLVVLNHLGIDRGVIALNKVDLVDEKTVERRIEEIKR 137


>UniRef50_Q4JIN1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; uncultured bacterium
           BAC10-10|Rep: Selenocysteine-specific translation
           elongation factor - uncultured bacterium BAC10-10
          Length = 634

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 1/100 (1%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH DF+KNM+ G    D A+LIVAA  G          QT EH  +    GV+  +
Sbjct: 67  VDVPGHEDFVKNMVAGVGSIDLALLIVAADDGWMP-------QTEEHLQILTYFGVRHAV 119

Query: 436 VGVNKMD-STEPPYSEPRFEEIKKEDPHTSRRLATTQLLS 552
           V + K D +T+P  +     E  ++ P  +  +  T +++
Sbjct: 120 VALTKADLTTDPAAAAVAVRERLRDTPFGAAPIVPTSVVT 159


>UniRef50_A1HSM1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Thermosinus carboxydivorans
           Nor1|Rep: Selenocysteine-specific translation elongation
           factor - Thermosinus carboxydivorans Nor1
          Length = 623

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 36/113 (31%), Positives = 59/113 (52%), Gaps = 2/113 (1%)
 Frame = +1

Query: 169 DKLKAERER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAA 342
           D+LK E+ R       + SL + +  ++   +D PGH  F+KNM+ GT   D A+L+VAA
Sbjct: 29  DRLKEEKLRGISIDLGFASLPLAD-DIVAGVVDVPGHERFLKNMLAGTGGIDMAMLVVAA 87

Query: 343 GTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
             G          QTREH  +    G+ Q +V +NK+D  +  + +   E+++
Sbjct: 88  DEGVMP-------QTREHLAMLHLYGISQGVVVLNKIDKVDAEWLDLVAEDVQ 133


>UniRef50_Q8XIK3 Cluster: Selenocysteine-specific elongation factor;
           n=8; Clostridia|Rep: Selenocysteine-specific elongation
           factor - Clostridium perfringens
          Length = 635

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 36/94 (38%), Positives = 50/94 (53%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  FIKNM+ G +  D  +LI+A      + GI    QT+EH  +   L VK+ I
Sbjct: 59  IDVPGHEKFIKNMLAGATSLDVVLLIIA-----LDEGIMP--QTKEHLEILELLEVKKCI 111

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLAT 537
           V + K D  +  ++E   E+IK     TS + AT
Sbjct: 112 VALTKRDLVDEEWAEMIKEDIKNYLKSTSFKDAT 145


>UniRef50_A6CK31 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Bacillus sp. SG-1|Rep:
           Selenocysteine-specific translation elongation factor -
           Bacillus sp. SG-1
          Length = 630

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 33/84 (39%), Positives = 43/84 (51%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  FIK MI G +  D  +L+VAA  G          QT+EH  +   LGV   I
Sbjct: 61  VDVPGHEKFIKQMIAGVAGIDLVILVVAADEGVMP-------QTKEHLEILSFLGVDHGI 113

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           V ++KMD  +        EEIK+E
Sbjct: 114 VVLSKMDKVDEELHNLAKEEIKEE 137


>UniRef50_Q74GZ1 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Proteobacteria|Rep:
           Selenocysteine-specific translation elongation factor -
           Geobacter sulfurreducens
          Length = 636

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 28/82 (34%), Positives = 43/82 (52%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F++ M+ G    D  +L++AA  G          QTREH  +   LGVK+ +
Sbjct: 59  VDVPGHERFVRTMVAGVGGMDLVMLVIAADEGVMP-------QTREHLEICQLLGVKKGL 111

Query: 436 VGVNKMDSTEPPYSEPRFEEIK 501
           V + K D  +P + E   EE++
Sbjct: 112 VALTKSDMVDPDWLELVVEEVR 133


>UniRef50_A0BK03 Cluster: Chromosome undetermined scaffold_111,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_111,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 446

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 43/178 (24%), Positives = 80/178 (44%), Gaps = 1/178 (0%)
 Frame = +1

Query: 16  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERER 195
           +V++G    GKST  G ++ +   +    + + ++  Q       +YA+++D+L+ ER+ 
Sbjct: 10  VVLLGAHGQGKSTVAGLIVNELNYVSPYALVRIDEHPQVQENPHLRYAFLMDRLRTERKT 69

Query: 196 RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 375
           +    + +            I+ PG   +I  M  G +  + AV ++ +G  E      K
Sbjct: 70  KQTQIFSTFHFTISNKKYTLINIPGQYQYINQMQLGIAYGEIAVFVL-SGVKEKYVQDFK 128

Query: 376 NGQTREHAL-LAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQL 546
              T E  L L   LG K +I  +N MD  E  Y +  +E +  +    S+RLA  ++
Sbjct: 129 GQSTLELQLRLWMALGKKHIICAINDMDLVE--YQQDCYEYVVND---FSQRLAKFEI 181


>UniRef50_Q46497 Cluster: Selenocysteine-specific elongation factor;
           n=4; Desulfovibrionales|Rep: Selenocysteine-specific
           elongation factor - Desulfovibrio baculatus
           (Desulfomicrobium baculatus)
          Length = 634

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 29/82 (35%), Positives = 44/82 (53%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  F+KNM++G +  D  +L++AA  G          QTREH  +   LG++  +
Sbjct: 58  IDVPGHERFVKNMVSGAAGIDFVLLVIAADEGIMP-------QTREHLEICSLLGIRAGL 110

Query: 436 VGVNKMDSTEPPYSEPRFEEIK 501
           V + K D  E  + E   EE++
Sbjct: 111 VALTKTDMVEEDWLELVHEEVQ 132


>UniRef50_A3SGF9 Cluster: Translation elongation factor,
           selenocysteine-specific; n=2; Sulfitobacter|Rep:
           Translation elongation factor, selenocysteine-specific -
           Sulfitobacter sp. EE-36
          Length = 623

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 39/109 (35%), Positives = 55/109 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           IDAPGH DFI+ M++G S A  A+L+V+A       GI+   QTREH  +A  L V   +
Sbjct: 58  IDAPGHEDFIRTMVSGASGAQGAMLVVSA-----VEGIA--AQTREHVQIARLLQVPVAV 110

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQLLSLSCPFLDGTE 582
           V V K+D         R  EI   D   ++ +   +L+  S     GT+
Sbjct: 111 VAVTKVDLIPDAALPARLVEI--ADALAAQGVTGAELVPCSATTAGGTD 157


>UniRef50_Q1MPY9 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Lawsonia intracellularis
           PHE/MN1-00|Rep: Selenocysteine-specific translation
           elongation factor - Lawsonia intracellularis (strain
           PHE/MN1-00)
          Length = 641

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 30/82 (36%), Positives = 42/82 (51%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  FIKNM+ G S  D  +L++AA  G          QT+EH  +   LG+K   
Sbjct: 58  IDVPGHEKFIKNMVAGASGIDVVMLVIAADEGVMP-------QTKEHIEICSLLGIKHGF 110

Query: 436 VGVNKMDSTEPPYSEPRFEEIK 501
           + + K D  +  + E   E+IK
Sbjct: 111 IVLTKTDIVDKEWLEVIKEDIK 132


>UniRef50_A6BIM9 Cluster: Putative uncharacterized protein; n=1;
           Dorea longicatena DSM 13814|Rep: Putative
           uncharacterized protein - Dorea longicatena DSM 13814
          Length = 637

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 28/84 (33%), Positives = 45/84 (53%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  FI NM+ G    D  +L++AA  G          QTREH  +   LG+++ I
Sbjct: 59  VDVPGHEKFINNMVAGVVGMDLVLLVIAADEGIMP-------QTREHMDILNLLGIEKSI 111

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           + +NK D  +  + E   E++++E
Sbjct: 112 IVLNKCDLVDEEWLEMMEEDVREE 135


>UniRef50_A4YIX9 Cluster: Protein synthesis factor, GTP-binding;
           n=1; Metallosphaera sedula DSM 5348|Rep: Protein
           synthesis factor, GTP-binding - Metallosphaera sedula
           DSM 5348
          Length = 415

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 48/170 (28%), Positives = 77/170 (45%), Gaps = 4/170 (2%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 186
           E+NI V+GHVD GK+T    L+    G+      +  K    +  G  + ++ L K   +
Sbjct: 9   EVNIGVVGHVDHGKTT----LVQALTGVWTSKHSEELKRGMTIRLGYAEASFGLCKSCRK 64

Query: 187 RERRYHNRYC----SLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 354
            +   +   C    S E          +DAPGH   +  M++GT+  D A+L+VAA    
Sbjct: 65  PDGYVNEPSCNSCGSDEEPEFLRRVSFVDAPGHEVLMATMLSGTAILDGAILVVAANEP- 123

Query: 355 FEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
                    QTREH +     G+ +LI+  NK+D      +  +F +IK+
Sbjct: 124 -----FPQPQTREHFVALGIAGINKLIIVQNKVDVVSKDAALAQFNQIKE 168


>UniRef50_Q5WBK2 Cluster: Translation elongation factor G; n=1;
           Bacillus clausii KSM-K16|Rep: Translation elongation
           factor G - Bacillus clausii (strain KSM-K16)
          Length = 647

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 41/114 (35%), Positives = 56/114 (49%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INI V+ HVD+GK+T T  ++Y+ G I         KEA  + KG+       D L  ER
Sbjct: 4   INIGVLAHVDAGKTTLTEQMLYQAGVI---------KEAGSVDKGN----TTTDTLAIER 50

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ER    +  ++      V    ID PGH DFI  +    +  D A+LIV+A  G
Sbjct: 51  ERGITVKAAAVSFFWNDVKVNIIDTPGHADFISEVEHALTILDGAILIVSAVEG 104


>UniRef50_A5KED2 Cluster: Elongation factor, putative; n=1;
           Plasmodium vivax|Rep: Elongation factor, putative -
           Plasmodium vivax
          Length = 833

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 25/62 (40%), Positives = 41/62 (66%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +NI+V+GH+D+GKST  G L+Y    + ++T++K+E   +     S KY ++LD+   ER
Sbjct: 118 LNILVLGHIDAGKSTLIGALLYNLSYVSEQTVKKYEHVRE-----SSKYTFILDEEDDER 172

Query: 190 ER 195
           ER
Sbjct: 173 ER 174



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 22/66 (33%), Positives = 35/66 (53%)
 Frame = +1

Query: 259 DAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIV 438
           D PGH + + N+ T +  AD A+L+V A          KN +T  +  +   +G+  +IV
Sbjct: 261 DTPGHNELVTNLHTWSFFADTAILVVDAN----NIYSKKNDETYRNVSILKAVGISNVIV 316

Query: 439 GVNKMD 456
            VNK+D
Sbjct: 317 AVNKLD 322


>UniRef50_Q1AUJ9 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Rubrobacter xylanophilus DSM
           9941|Rep: Selenocysteine-specific translation elongation
           factor - Rubrobacter xylanophilus (strain DSM 9941 /
           NBRC 16129)
          Length = 612

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 26/75 (34%), Positives = 43/75 (57%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F+KNM+ G++  D  +L++AA  G          QTREH  +   LGV++ +
Sbjct: 63  VDVPGHERFVKNMVAGSTGVDAFLLVIAADDGVMP-------QTREHLDVLRVLGVERGV 115

Query: 436 VGVNKMDSTEPPYSE 480
           V + K+D+ +   +E
Sbjct: 116 VALTKIDAVDAETAE 130


>UniRef50_A0Z3R3 Cluster: Selenocysteine-specific elongation factor;
           n=1; marine gamma proteobacterium HTCC2080|Rep:
           Selenocysteine-specific elongation factor - marine gamma
           proteobacterium HTCC2080
          Length = 641

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 31/82 (37%), Positives = 42/82 (51%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGHR FI  MI+G S  D  +L+VAA  G          QT EH  +   LGV+ + 
Sbjct: 56  IDVPGHRKFINTMISGISGVDMGLLVVAADDGPMP-------QTLEHIDVLEILGVESVC 108

Query: 436 VGVNKMDSTEPPYSEPRFEEIK 501
           V +NK+D  E        E+++
Sbjct: 109 VVINKIDRVEASRVHAVLEQVQ 130


>UniRef50_Q7VI67 Cluster: Selenocysteine-specific elongation factor
           SelB; n=2; Helicobacteraceae|Rep:
           Selenocysteine-specific elongation factor SelB -
           Helicobacter hepaticus
          Length = 632

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 31/80 (38%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH   +KNMI G    D  +L++AA  G          Q+ EH L+A  LG+   I
Sbjct: 62  IDVPGHNKLVKNMIAGAFGIDVLLLVIAANEGIMP-------QSIEHLLIADMLGISSCI 114

Query: 436 VGVNKMDSTEPPYSE-PRFE 492
             + K+D  E P  E PR E
Sbjct: 115 CVITKIDKLENPSLELPRLE 134


>UniRef50_Q0ATV7 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Syntrophomonas wolfei subsp.
           wolfei str. Goettingen|Rep: Selenocysteine-specific
           translation elongation factor - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 631

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 30/83 (36%), Positives = 42/83 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  FI++M+ G    D  V ++AA  G          QTREH  +   LGVKQ +
Sbjct: 59  VDVPGHERFIRHMLAGAFGIDMVVFVIAADEGIMP-------QTREHLDIIELLGVKQGV 111

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           V + K D  +  +     EEIK+
Sbjct: 112 VAITKKDLVDEEWLMLMEEEIKE 134


>UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS
           (Tet(S)); n=345; root|Rep: Tetracycline resistance
           protein tetS (Tet(S)) - Listeria monocytogenes
          Length = 641

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 42/149 (28%), Positives = 68/149 (45%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INI ++ HVD+GK+T T  L+Y  G I         KE   +  G+ K     D +  ER
Sbjct: 4   INIGILAHVDAGKTTLTESLLYSSGAI---------KELGSVDSGTTK----TDTMFLER 50

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           +R    +      +   V    +D PGH DF+ ++    S  D A+L+++A     + G+
Sbjct: 51  QRGITIQTAITSFQRENVKVNIVDTPGHMDFLADVYRSLSVLDGAILLISA-----KDGV 105

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMD 456
               +   HAL    +    +I  +NK+D
Sbjct: 106 QSQTRILFHALRKMNI---PIIFFINKID 131


>UniRef50_Q46455 Cluster: Selenocysteine-specific elongation factor;
           n=5; Clostridia|Rep: Selenocysteine-specific elongation
           factor - Moorella thermoacetica (Clostridium
           thermoaceticum)
          Length = 634

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 2/114 (1%)
 Frame = +1

Query: 169 DKLKAERERRYHNR--YCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAA 342
           D+LK E+ER       +  L + + + L   +D PGH  FI+ M+ G    D  +L+VAA
Sbjct: 29  DRLKEEKERGISIELGFAPLTLPSGRQLGL-VDVPGHERFIRQMLAGVGGMDLVMLVVAA 87

Query: 343 GTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
             G          QTREH  +   L +K+ I+ + K+D  E  + E   EE+++
Sbjct: 88  DEGVMP-------QTREHLAIIDLLQIKKGIIVITKIDLVEADWLELVREEVRQ 134


>UniRef50_A3LLY2 Cluster: GTP-binding protein LepA; n=4;
           Bacteria|Rep: GTP-binding protein LepA - Pseudomonas
           aeruginosa 2192
          Length = 617

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 55/173 (31%), Positives = 80/173 (46%), Gaps = 5/173 (2%)
 Frame = +1

Query: 4   HEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           H  N  +I H+D GKST     I  CGG+  R     E EAQ           VLD +  
Sbjct: 6   HIRNFSIIAHIDHGKSTLADRFIQMCGGLSDR-----EMEAQ-----------VLDSMDL 49

Query: 184 ERER----RYHNRYCSLEVRN*QVLCYH-IDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
           ERER    + H+     + ++ +    + ID PGH DF   +    +  + A+L+V AG 
Sbjct: 50  ERERGITIKAHSVTLHYKAQDGKTYQLNFIDTPGHVDFTYEVSRSLAACEGALLVVDAGQ 109

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           G  EA      Q+  +   A   G++ + V +NKMD    P +EP  E +K+E
Sbjct: 110 G-VEA------QSVANCYTAIEQGLEVMPV-LNKMDL---PQAEP--ERVKEE 149


>UniRef50_Q46306 Cluster: Tetracycline resistance protein tetP
           (TetB(P)); n=4; Clostridium|Rep: Tetracycline resistance
           protein tetP (TetB(P)) - Clostridium perfringens
          Length = 652

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 54/196 (27%), Positives = 86/196 (43%), Gaps = 2/196 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INI ++ HVD+GK+T T +L+Y  G I         K    +  G+ +     D ++ ER
Sbjct: 5   INIGIVAHVDAGKTTITENLLYYSGAI---------KSVGRVDLGNTQ----TDSMELER 51

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           +R    +  ++      V    ID PGH DFI  +    +  D A+L+++   G      
Sbjct: 52  KRGITIKSSTISFNWNNVKVNIIDTPGHVDFISEVERSLNSLDGAILVISGVEG------ 105

Query: 370 SKNGQTREHALLAFTLGVKQL--IVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQ 543
               QTR   +L  TL    +  I+ VNK+D     +++  FEEIKK   +   RL    
Sbjct: 106 -IQSQTR---ILFDTLKELNIPTIIFVNKLDRIGANFNKV-FEEIKKNMSNKVVRLQEVY 160

Query: 544 LLSLSCPFLDGTETTC 591
            +     ++     TC
Sbjct: 161 DVGSKAVYIKKLFDTC 176


>UniRef50_Q3E0L1 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=1; Chloroflexus aurantiacus J-10-fl|Rep:
           Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain - Chloroflexus aurantiacus J-10-fl
          Length = 622

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 30/83 (36%), Positives = 46/83 (55%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  FIKNM+ G    D  +L++AA     EA +    QTREH  +   L ++  I
Sbjct: 63  IDVPGHERFIKNMLAGVGGIDAVLLVIAAD----EAVMP---QTREHLAIIDLLAIRHGI 115

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           V ++K+D  +  + E   EE+++
Sbjct: 116 VVLSKVDLVDADWLELVREEVRE 138


>UniRef50_A6DB59 Cluster: Putative selenocysteine-specific
           elongation factor; n=1; Caminibacter mediatlanticus
           TB-2|Rep: Putative selenocysteine-specific elongation
           factor - Caminibacter mediatlanticus TB-2
          Length = 607

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 39/112 (34%), Positives = 52/112 (46%)
 Frame = +1

Query: 169 DKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
           D+L+ E+ER          ++   V    ID PGH   +KNMI+G    D    + A  T
Sbjct: 29  DELEEEKERGITIDLSFTNMKKGDVNVAFIDVPGHEKLVKNMISGAFGFDAT--LFAIDT 86

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
            E   GI    QT EH  +   L VK +IV + K D   P   E R +EIK+
Sbjct: 87  NE---GIMP--QTIEHLEVLDILKVKNIIVALTKKDLATPELIEKRKKEIKE 133


>UniRef50_Q7R7M3 Cluster: Elongation factor Tu family, putative;
           n=6; Plasmodium|Rep: Elongation factor Tu family,
           putative - Plasmodium yoelii yoelii
          Length = 597

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 24/62 (38%), Positives = 40/62 (64%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +NI+V+GH+D+GKST  G L+Y    ++ + ++K+E   +     S KY ++LD+   ER
Sbjct: 107 LNILVLGHIDAGKSTLIGALLYNLNYVNDQMLKKYENIRE-----SSKYTYILDEEGDER 161

Query: 190 ER 195
           ER
Sbjct: 162 ER 163



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 26/82 (31%), Positives = 43/82 (52%)
 Frame = +1

Query: 259 DAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIV 438
           D PGH + + N+ T +  ADCA+L+V A          KN +T  +  +   +G+  +I+
Sbjct: 230 DTPGHNELVNNLHTCSFFADCAILVVDAN----NVYNKKNDETYRNVCILKYVGISNIII 285

Query: 439 GVNKMDSTEPPYSEPRFEEIKK 504
            +NK+D  +  Y E  F +I K
Sbjct: 286 VINKIDLFD--YDENIFNDICK 305


>UniRef50_Q8TJT7 Cluster: Translation initiation factor 2 subunit
           gamma; n=48; Archaea|Rep: Translation initiation factor
           2 subunit gamma - Methanosarcina acetivorans
          Length = 443

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 43/170 (25%), Positives = 78/170 (45%), Gaps = 5/170 (2%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV-LDKLKAE 186
           +NI ++GHVD GK+T    L+    G+   T  +  K    +  G     ++   K  A 
Sbjct: 41  VNIGMVGHVDHGKTT----LVKALSGVWTDTHSEEVKRGISIRLGYADSPFMKCPKCPAP 96

Query: 187 R----ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 354
           +    E+   N  C  +    +++ + +DAPGH   +  M++G +  D AVL++AA    
Sbjct: 97  QCYTVEKTCPN--CGEKTEEHRIVSF-VDAPGHETLMATMLSGAAIMDGAVLVIAANEE- 152

Query: 355 FEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
                    QT+EH +    +G+K +++  NK+D          + +IK+
Sbjct: 153 -----CPQPQTKEHLMALDIIGIKNIVIVQNKIDLVSREKLVENYHQIKE 197


>UniRef50_Q4S9H1 Cluster: Chromosome undetermined SCAF14696, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF14696,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 395

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 47/150 (31%), Positives = 65/150 (43%), Gaps = 3/150 (2%)
 Frame = +1

Query: 25  IGHVDSGKSTTTGHL---IYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERER 195
           IG  D GK+T T  +   +   GG + R+ E  +    E   G F     ++   A   R
Sbjct: 21  IGQRDHGKTTLTAAITKVLADAGGAEYRSYEDIDDAPGEQALGVFVKMSCVEY--ATESR 78

Query: 196 RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 375
           RY                YH D P H D+IK         D  +L+VAA  G+       
Sbjct: 79  RY----------------YHTDCPAHADYIK--------MDGCILVVAATGGQMP----- 109

Query: 376 NGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
             QTREH LLA  +GV+ ++V +NK D+ E
Sbjct: 110 --QTREHLLLARQIGVEHVVVFINKADAVE 137


>UniRef50_Q5GBH8 Cluster: TetT; n=2; Lactobacillales|Rep: TetT -
           Enterococcus faecalis (Streptococcus faecalis)
          Length = 651

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 35/114 (30%), Positives = 53/114 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INI ++ HVD+GK+T T  L+YK G I+K  I + +                 D ++ ER
Sbjct: 4   INIGILAHVDAGKTTVTEGLLYKSGAINK--IGRVDNATT-----------TTDSMELER 50

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           +R    R  ++           ID PGH DFI  +       D A+L+++A  G
Sbjct: 51  DRGITIRASTVSFNYNDTKVNIIDTPGHMDFIAEVERTLKVLDGAILVISAKEG 104


>UniRef50_Q18YZ1 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Desulfitobacterium
           hafniense|Rep: Selenocysteine-specific translation
           elongation factor - Desulfitobacterium hafniense (strain
           DCB-2)
          Length = 634

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 2/113 (1%)
 Frame = +1

Query: 169 DKLKAERER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAA 342
           D+L+ E+ R       + SL + + Q++   ID PGH  F+K M+ G +  D  +L++AA
Sbjct: 29  DRLEEEKRRGMTIELGFASLTLPSGQIVSI-IDVPGHEKFVKTMVAGVTGIDLVMLVIAA 87

Query: 343 GTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
             G          QTREH  +   L V   ++ + K D  +  + E   E+I+
Sbjct: 88  DEGIMP-------QTREHLDILNLLNVTTGVIALTKTDLVDDEWLEMIIEDIR 133


>UniRef50_A1FN34 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Pseudomonas|Rep:
           Selenocysteine-specific translation elongation factor -
           Pseudomonas putida W619
          Length = 640

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 27/71 (38%), Positives = 35/71 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  FI NM+ G    D  +L+VAA  G          QTREH  +   LG+   +
Sbjct: 57  IDVPGHERFIHNMLAGAHGIDLVLLVVAADDGVMP-------QTREHLAIIELLGIPLAL 109

Query: 436 VGVNKMDSTEP 468
           V ++K D   P
Sbjct: 110 VAISKCDRVAP 120


>UniRef50_Q931D5 Cluster: SelB selenocysteine-specific elongation
           factor; n=4; Alphaproteobacteria|Rep: SelB
           selenocysteine-specific elongation factor - Rhizobium
           meliloti (Sinorhizobium meliloti)
          Length = 666

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 38/109 (34%), Positives = 52/109 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  FI  M+ G    D A+L+VAA     + GI    QT EH  +   LGV + +
Sbjct: 56  VDVPGHERFIHTMLAGAGGIDYAMLVVAA-----DDGIKP--QTLEHLAILDLLGVSRGL 108

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQLLSLSCPFLDGTE 582
           V + K D  +P   E   +EI      TS R A  ++L +S     G E
Sbjct: 109 VAITKADLADPARLENLTDEIGAVLSSTSLRDA--EILPVSVAAGQGIE 155


>UniRef50_A0LHL0 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Syntrophobacter fumaroxidans
           MPOB|Rep: Selenocysteine-specific translation elongation
           factor - Syntrophobacter fumaroxidans (strain DSM 10017
           / MPOB)
          Length = 642

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/72 (36%), Positives = 38/72 (52%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F+K+M+ G +  D   L++AA  G          QTREH  +   L VKQ +
Sbjct: 59  VDVPGHERFVKHMVAGATGIDLVALVIAADEGVMP-------QTREHMEICELLRVKQGL 111

Query: 436 VGVNKMDSTEPP 471
           V + K+D  + P
Sbjct: 112 VVLTKIDLVDDP 123


>UniRef50_A7PCT1 Cluster: Chromosome chr17 scaffold_12, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr17 scaffold_12, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 304

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 31/93 (33%), Positives = 44/93 (47%)
 Frame = +1

Query: 130 EMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTS 309
           E GK        +DK   E++R        +E    +    H+D PGH D+ KNMITG +
Sbjct: 184 EEGKAKVVALDEIDKAPKEKKRGITIAMAHVEYETAKRHYAHVDCPGHADYEKNMITGAA 243

Query: 310 QADCAVLIVAAGTGEFEAGISKNGQTREHALLA 408
           Q D ++ +V A  G          +T+EH LLA
Sbjct: 244 QMDVSIQVVFAPNGPMP-------RTKEHILLA 269


>UniRef50_Q9C1V6 Cluster: Tranlsation elongation factor 1a; n=2;
           Trichaptum abietinum|Rep: Tranlsation elongation factor
           1a - Trichaptum abietinum
          Length = 133

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 31/78 (39%), Positives = 38/78 (48%)
 Frame = +1

Query: 460 TEPPYSEPRFEEIKKEDPHTSRRLATTQLLSLSCPFLDGTETTCWSLQPKCLGSRDGRWS 639
           T   +SE RF E+ ++ P + RR ATT   SLS  F  GT TTC      CLG+R G   
Sbjct: 48  TRRRWSEDRFNEMSRKRPTSLRRSATTPSPSLSFRFPAGTVTTCLRSLQTCLGTRAGPRR 107

Query: 640 VRKAKLTENASLKLSMPS 693
            R  +     S    MPS
Sbjct: 108 RRPVRARAKLSSMRLMPS 125


>UniRef50_Q2B7L6 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Bacillus sp. NRRL B-14911|Rep:
           Selenocysteine-specific translation elongation factor -
           Bacillus sp. NRRL B-14911
          Length = 618

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 30/84 (35%), Positives = 43/84 (51%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  FI+ MI G +  D  +L+VAA  G          QT+EH  +   LG+++ I
Sbjct: 52  IDVPGHERFIRQMIAGVAGIDLVILVVAADEGVMP-------QTKEHLQILGFLGIEKGI 104

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           V ++K D  +  +     EEI  E
Sbjct: 105 VVISKADRVDEEFIGLVEEEILLE 128


>UniRef50_A7Q762 Cluster: Chromosome chr5 scaffold_58, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_58, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 177

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = +1

Query: 130 EMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTS 309
           E GK        +DK   E++R        +E    +  C H+D PGH D++KNMITG +
Sbjct: 80  EEGKAKVVALDEIDKAPKEKKRGITIATTHVEYETAKRHCDHVDCPGHADYVKNMITGAA 139

Query: 310 QADCAVLIV 336
           Q D ++ +V
Sbjct: 140 QMDGSIQVV 148


>UniRef50_A5DTX8 Cluster: Putative uncharacterized protein; n=3;
           Saccharomycetales|Rep: Putative uncharacterized protein
           - Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 826

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 52/164 (31%), Positives = 73/164 (44%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +I H+D+GK+TTT  +IY  G           K    + +G      V D L+AERE
Sbjct: 57  NIGIIAHIDAGKTTTTERMIYYSGK---------SKRIGNVDEGDT----VTDYLQAERE 103

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R    +  ++ +         ID PGH DF   +I      D AV I+ A      AG+ 
Sbjct: 104 RGITIQLAAITIPWNNHKINIIDTPGHADFTFEVIRSLRVLDGAVTILDA-----VAGV- 157

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
              QT +    A  L + ++I  VNKMD     +S    E I+K
Sbjct: 158 -EAQTEKVWKQASALKLPRMIY-VNKMDRPGAGFSRTVKEVIQK 199


>UniRef50_P43927 Cluster: Selenocysteine-specific elongation factor;
           n=21; Pasteurellaceae|Rep: Selenocysteine-specific
           elongation factor - Haemophilus influenzae
          Length = 619

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 34/99 (34%), Positives = 51/99 (51%)
 Frame = +1

Query: 211 YCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 390
           Y  L + N +VL + ID PGH  F+ NM+ G      A+LIVAA     + G++   QT+
Sbjct: 42  YAYLPLEN-KVLGF-IDVPGHEKFLSNMLAGLGGVHYAMLIVAA-----DEGVAV--QTK 92

Query: 391 EHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           EH  +   L   ++IV + K D T     E   + IK++
Sbjct: 93  EHLAILRQLQFHEIIVVITKADRTNSAQIESLIQTIKQD 131


>UniRef50_Q47F25 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Dechloromonas aromatica
           RCB|Rep: Translation elongation factor,
           selenocysteine-specific - Dechloromonas aromatica
           (strain RCB)
          Length = 627

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 28/81 (34%), Positives = 40/81 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH   I NM+ G +  D A+L++AA  G          QTREH  +   LG+K+  
Sbjct: 51  IDVPGHEKLIHNMLAGATGIDFALLVIAADDGPMP-------QTREHLEIIELLGIKRGA 103

Query: 436 VGVNKMDSTEPPYSEPRFEEI 498
           V + K+D+      +    EI
Sbjct: 104 VALTKIDNASAERQQQAKAEI 124


>UniRef50_A7H0F4 Cluster: Selenocysteine-specific translation
           elongation factor; n=13; Campylobacter|Rep:
           Selenocysteine-specific translation elongation factor -
           Campylobacter curvus 525.92
          Length = 605

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 29/82 (35%), Positives = 38/82 (46%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH   +K MI+G    D  +L+VAA  G          QT+EH  +   LGV  +I
Sbjct: 57  IDVPGHESLVKTMISGAFGFDACLLVVAANEGIMP-------QTKEHINILSLLGVNSII 109

Query: 436 VGVNKMDSTEPPYSEPRFEEIK 501
           V + K D         R  EI+
Sbjct: 110 VAITKSDLVGAQELAQREREIR 131


>UniRef50_A6P2V2 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 629

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 30/83 (36%), Positives = 44/83 (53%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  FI+NM++G + A   +L V AG G          QTREH  L   LG+++ I
Sbjct: 59  VDVPGHEKFIRNMLSGAAGAGGVLLTVDAGKGIMP-------QTREHLALCALLGMERGI 111

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           V + K D  +    E R  ++K+
Sbjct: 112 VALTKADLAD----ERRLTQVKE 130


>UniRef50_A0YGX4 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; marine gamma
           proteobacterium HTCC2143|Rep: Translation elongation
           factor, selenocysteine-specific - marine gamma
           proteobacterium HTCC2143
          Length = 627

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 34/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (1%)
 Frame = +1

Query: 169 DKLKAERER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAA 342
           D+L+ E+ R    +  Y   ++ + QV+ + ID PGH  FI +MI G    D A+L+VAA
Sbjct: 26  DRLEEEKRRGLSINLGYAFKKLDDGQVIGF-IDVPGHTRFINSMIAGVGGIDMAMLVVAA 84

Query: 343 GTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
             G          QT EH  +   LG +Q +V + K+D  +
Sbjct: 85  DDGVMP-------QTTEHLDVLRLLGQQQFVVVITKIDRVD 118


>UniRef50_P34617 Cluster: Uncharacterized GTP-binding protein
           ZK1236.1; n=2; Caenorhabditis|Rep: Uncharacterized
           GTP-binding protein ZK1236.1 - Caenorhabditis elegans
          Length = 645

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 45/148 (30%), Positives = 66/148 (44%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  ++ HVD GKST    L+  CG +        +K+             +LDKL+ ERE
Sbjct: 44  NFGIVAHVDHGKSTLADRLLEMCGAVPPG-----QKQ-------------MLDKLQVERE 85

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R    +  +  +R+   L   ID PGH DF   +    +  D  +L+VAA  G       
Sbjct: 86  RGITVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQG------- 138

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD 456
              QT  +  LAF   + Q+I  +NK+D
Sbjct: 139 VQAQTIANFWLAFEKNI-QIIPVINKID 165


>UniRef50_Q1Z854 Cluster: Hypothetical selenocysteine-specific
           translation elongation factor; n=4; Vibrionaceae|Rep:
           Hypothetical selenocysteine-specific translation
           elongation factor - Photobacterium profundum 3TCK
          Length = 616

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/71 (30%), Positives = 37/71 (52%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  +++NM+ G    +  +L+VAA  G           T  H  +A  +G++++I
Sbjct: 67  IDVPGHERYLRNMVAGVWHLNALILVVAADEGWMP-------MTTSHVQVAHAMGIEEII 119

Query: 436 VGVNKMDSTEP 468
           + +NK D   P
Sbjct: 120 LCINKRDKVSP 130


>UniRef50_Q1NKM4 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=3; Deltaproteobacteria|Rep: Translation
           elongation factor, selenocysteine-specific:Small GTP-
           binding protein domain - delta proteobacterium MLMS-1
          Length = 639

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 33/115 (28%), Positives = 53/115 (46%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F++NM+ G +  D    +VAA  G          QTREH  +   LG+++ +
Sbjct: 59  VDVPGHERFVRNMVAGAAGIDLVAFVVAADEGIMP-------QTREHFEICRLLGIQRGL 111

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQLLSLSCPFLDGTETTCWSL 600
           + + K D  +    E   +EI+  D      LA   +L++S    +G      SL
Sbjct: 112 IVITKRDLVDEELLELVEDEIR--DFFQDSFLAEAPVLTVSATTGEGISRVVASL 164


>UniRef50_Q0BZB1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Hyphomonas neptunium ATCC
           15444|Rep: Selenocysteine-specific translation
           elongation factor - Hyphomonas neptunium (strain ATCC
           15444)
          Length = 623

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 29/71 (40%), Positives = 41/71 (57%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +DAPGH++FI+ M+ G + A  A L+V+A  G  EA      QT EH  +  TLG+   I
Sbjct: 58  VDAPGHQNFIRAMVGGAAGARSAALVVSAAEG-VEA------QTLEHIAVIETLGIHAGI 110

Query: 436 VGVNKMDSTEP 468
           V ++K D   P
Sbjct: 111 VVLSKADLVAP 121


>UniRef50_Q6F0Z6 Cluster: GTP-binding membrane protein, elongation
           factor; n=7; Bacteria|Rep: GTP-binding membrane protein,
           elongation factor - Mesoplasma florum (Acholeplasma
           florum)
          Length = 612

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 48/168 (28%), Positives = 76/168 (45%), Gaps = 2/168 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INI VI HVD+GKST    L+ K GG  +   E  E+              ++D    ER
Sbjct: 7   INIAVIAHVDAGKSTLVDALL-KQGGAFRDNQEVVEQ--------------IMDSNDQER 51

Query: 190 ER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           ER    +++ C++E +  ++    +D PGH DF   +       D  +L+V +  G    
Sbjct: 52  ERGITIYSKNCAIEYKGTKINI--VDTPGHADFSSEVERIMKTVDTVILLVDSSEGPMP- 108

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
                 QTR     A  LG+  +++ +NK+D       + R EE+ +E
Sbjct: 109 ------QTRFVLSKALELGLNPILM-INKIDK-----KDQRAEEVVEE 144


>UniRef50_A0KL71 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Aeromonas|Rep:
           Selenocysteine-specific translation elongation factor -
           Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966
           / NCIB 9240)
          Length = 627

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/71 (35%), Positives = 36/71 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  +I+NM+ G    D  +L++AA  G           T +H  L   +GV +L+
Sbjct: 60  IDVPGHERYIRNMVAGLWSLDLVLLVIAADEGWMP-------MTGDHLRLLKAMGVPRLL 112

Query: 436 VGVNKMDSTEP 468
           V +NK D   P
Sbjct: 113 VCINKCDLVTP 123


>UniRef50_Q6FMS9 Cluster: Candida glabrata strain CBS138 chromosome
           K complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome K complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 727

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 34/158 (21%), Positives = 66/158 (41%), Gaps = 11/158 (6%)
 Frame = +1

Query: 16  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG-----------KGSFKYAW 162
           + + G   SGKST  G L +  G   +  I   + + + M              +  + W
Sbjct: 282 VPMFGLPGSGKSTILGQLSFHLGLTTREDIRVIKTDMERMHFRRIDKLDTRLLTTSPFCW 341

Query: 163 VLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAA 342
           V+D+   ER+  + N    L ++         + PG  D    + T     +  +++V+A
Sbjct: 342 VVDETTEERQFGHSNNIKPLHIKYNDTDIIINEVPGSFDLCSTIETKRYVGNSVIIVVSA 401

Query: 343 GTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
             G++EA      +  E  +    +GV++++  +NKMD
Sbjct: 402 ELGDYEANFDMKKRLIEKLIYCNGVGVRRILTIINKMD 439


>UniRef50_Q67QI5 Cluster: Selenocysteine-specific elongation factor;
           n=1; Symbiobacterium thermophilum|Rep:
           Selenocysteine-specific elongation factor -
           Symbiobacterium thermophilum
          Length = 629

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  F++NM+ G +  D  +L+VAA  G          QTREH  +   L + + +
Sbjct: 59  IDVPGHEKFVRNMLAGITGIDLVILVVAADEGVMP-------QTREHLDILRLLEISKGL 111

Query: 436 VGVNKMD 456
           V + K+D
Sbjct: 112 VAITKID 118


>UniRef50_A0DB90 Cluster: Chromosome undetermined scaffold_44, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_44,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 466

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 51/173 (29%), Positives = 76/173 (43%), Gaps = 11/173 (6%)
 Frame = +1

Query: 16  IVVIGHVDSGKSTTTGHLIYKC-----GGIDKRTIE-KFEKE---AQEMGKGSFKYAWVL 168
           + +IG+VDSGKST  G L         GG  +R    K EKE      + +    +   L
Sbjct: 11  LAIIGNVDSGKSTLVGVLTKGILDDGRGGARERVFNYKHEKENGRTSSVAQEIMGFDENL 70

Query: 169 DKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITG--TSQADCAVLIVAA 342
            ++  ER  +  N+Y SL V   + +   +D  GH  ++K  I G      D +++IV A
Sbjct: 71  KQVLPERFNQNKNKYWSLVVEKSRKIVTFLDLCGHEKYLKTTIFGLVAMIPDYSLIIVGA 130

Query: 343 GTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIK 501
                  G+SK   TREH  ++  L +   IV + K+D           E IK
Sbjct: 131 -----NMGVSK--MTREHLGVSLFLKIPFAIV-LTKIDIAPQNVYNETIENIK 175


>UniRef50_P14081 Cluster: Selenocysteine-specific elongation factor;
           n=33; Enterobacteriaceae|Rep: Selenocysteine-specific
           elongation factor - Escherichia coli (strain K12)
          Length = 614

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 28/84 (33%), Positives = 40/84 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  F+ NM+ G    D A+L+VA   G          QTREH  +    G   L 
Sbjct: 56  IDVPGHEKFLSNMLAGVGGIDHALLVVACDDGVM-------AQTREHLAILQLTGNPMLT 108

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           V + K D  +    E R +E++++
Sbjct: 109 VALTKADRVD----EARVDEVERQ 128


>UniRef50_O36041 Cluster: Eukaryotic translation initiation factor 2
           subunit gamma; n=1; Spironucleus vortens|Rep: Eukaryotic
           translation initiation factor 2 subunit gamma -
           Spironucleus vortens
          Length = 210

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 25/82 (30%), Positives = 44/82 (53%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH D++  M++G +  D  +L+++A     E    +  QTREH       G K++I
Sbjct: 84  IDCPGHHDYMTTMLSGVAAMDGTLLLISA-----EQRCPQE-QTREHFQAIQATGQKKII 137

Query: 436 VGVNKMDSTEPPYSEPRFEEIK 501
           +  NK+D      ++  ++EI+
Sbjct: 138 IAQNKIDLVTEQQAQNNYQEIQ 159


>UniRef50_A0YH51 Cluster: Selenocysteine-specific elongation factor;
           n=1; marine gamma proteobacterium HTCC2143|Rep:
           Selenocysteine-specific elongation factor - marine gamma
           proteobacterium HTCC2143
          Length = 642

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 29/96 (30%), Positives = 44/96 (45%)
 Frame = +1

Query: 169 DKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
           D+L  E++R            N  +    ID PGH+ FI NM+TG +  D A+L++AA  
Sbjct: 26  DRLPEEKKRGLTIELGFAYHHNEDIAVGFIDVPGHQKFIANMLTGIAALDLALLVIAADD 85

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
           G          QT EH      +G+ +  + + K D
Sbjct: 86  GPMP-------QTYEHLAALNLMGLTRAAIVITKTD 114


>UniRef50_Q8TVI5 Cluster: Translation elongation factor, GTPase;
           n=1; Methanopyrus kandleri|Rep: Translation elongation
           factor, GTPase - Methanopyrus kandleri
          Length = 358

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/67 (40%), Positives = 38/67 (56%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGHRD+I+NM+     AD A+L+VAA  G           T +HAL+    G + L 
Sbjct: 66  VDVPGHRDYIRNMLASAWSADYAILVVAADEGPCPG-------TIDHALVVSFYGARVLP 118

Query: 436 VGVNKMD 456
           V V+K+D
Sbjct: 119 V-VSKVD 124


>UniRef50_P46943 Cluster: GTP-binding protein GUF1; n=37; root|Rep:
           GTP-binding protein GUF1 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 645

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 49/154 (31%), Positives = 69/154 (44%), Gaps = 6/154 (3%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  ++ HVD GKST +  L+     ID     K                 VLDKL+ ERE
Sbjct: 48  NFSIVAHVDHGKSTLSDRLLEITHVIDPNARNK----------------QVLDKLEVERE 91

Query: 193 R--RYHNRYCSLEVRN*QV----LCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 354
           R      + CS+  ++ +     L + ID PGH DF   +    +    A+L+V A  G 
Sbjct: 92  RGITIKAQTCSMFYKDKRTGKNYLLHLIDTPGHVDFRGEVSRSYASCGGAILLVDASQG- 150

Query: 355 FEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
                    QT  +  LAF+LG+K LI  +NK+D
Sbjct: 151 ------IQAQTVANFYLAFSLGLK-LIPVINKID 177


>UniRef50_A6G2B2 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Plesiocystis pacifica
           SIR-1|Rep: Translation elongation factor,
           selenocysteine-specific - Plesiocystis pacifica SIR-1
          Length = 696

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 2/87 (2%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   ++ M+ G    D  +L+++A     E G+    QTREH  +   LG++  +
Sbjct: 75  VDVPGHEALVRTMVAGAGGMDAVLLVISA-----EDGVMP--QTREHLHVCELLGLRHAV 127

Query: 436 VGVNKMDSTEPPYSEPRFE--EIKKED 510
           V + K+D  +    + + E  E+ +ED
Sbjct: 128 VALTKIDRLDGESEDDKEELLELARED 154


>UniRef50_A5Z9F8 Cluster: Putative uncharacterized protein; n=1;
           Eubacterium ventriosum ATCC 27560|Rep: Putative
           uncharacterized protein - Eubacterium ventriosum ATCC
           27560
          Length = 535

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 36/111 (32%), Positives = 54/111 (48%), Gaps = 1/111 (0%)
 Frame = +1

Query: 22  VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERRY 201
           +I H D+GK+T T   +   G I+     K        GK + KYA V D +  E+ER  
Sbjct: 21  IISHPDAGKTTLTEKFLLYGGAINTAGSVK--------GKANSKYA-VSDWMGIEKERGI 71

Query: 202 HNRYCSLEVRN*QVLCYHI-DAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
                +L+  N +  C +I D PGH+DF ++       AD AV+++ A  G
Sbjct: 72  SVTSSALQF-NYEGYCINILDTPGHQDFSEDTYRTLMAADSAVMVIDASKG 121


>UniRef50_A0X1J6 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Shewanella pealeana ATCC
           700345|Rep: Selenocysteine-specific translation
           elongation factor - Shewanella pealeana ATCC 700345
          Length = 635

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 2/115 (1%)
 Frame = +1

Query: 169 DKLKAERER--RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAA 342
           D+L  E++R       Y  +++ + + L + +D PGH  FI  M+ G S A  A+LI+A 
Sbjct: 26  DRLPEEKQRGMTIELGYAFMDLSDGERLAF-VDVPGHSKFINTMLAGVSCAKHALLIIAC 84

Query: 343 GTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             G          QT EH  +   L ++ LIV + K D  +      R +E+K++
Sbjct: 85  DDGVMP-------QTYEHLAILQLLNLEHLIVVLTKQDKVD----ATRVDEVKEQ 128


>UniRef50_A4RX89 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 563

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 50/183 (27%), Positives = 79/183 (43%), Gaps = 2/183 (1%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHL--IYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 174
           R  +N+ V+GH+DSGK++    +   +    +DK           ++G  SF   +  D 
Sbjct: 4   RLNVNVGVLGHIDSGKTSLARAISTAFSTASLDKCPQSAARGITLDLGFSSFLAEFPDDV 63

Query: 175 LKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 354
             A RE  Y     +L           +D PGH   IK ++ G S  D  +L+V A    
Sbjct: 64  DDATREA-YDGAQFTL-----------VDCPGHASLIKTVLGGASIIDLMILVVDA---- 107

Query: 355 FEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLA 534
            + G+    QT E  L+   +   +LIV VNK+D+      E R E++ K     +   A
Sbjct: 108 -QKGVQT--QTAE-CLVVGEITTDRLIVAVNKIDAFA---EEVREEKVAKMQAKLASVFA 160

Query: 535 TTQ 543
            T+
Sbjct: 161 KTK 163


>UniRef50_A3FPW4 Cluster: Elongation factor-like protein; n=3;
           Cryptosporidium|Rep: Elongation factor-like protein -
           Cryptosporidium parvum Iowa II
          Length = 1100

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 43/151 (28%), Positives = 67/151 (44%), Gaps = 3/151 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKR---TIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           N+ +I HVD GK+T   +L+     +  +   TI   +    E      +Y  +  K  A
Sbjct: 7   NVCIIAHVDHGKTTLADYLLASNNILSNKSAGTIRYLDSREDE------QYRLITMKSSA 60

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
              +  +     LEV +   L   ID+PGH DF   +I+    +D A+L+V    G    
Sbjct: 61  VSLKFKYEEEIKLEVEDGDYLINLIDSPGHVDFTYEVISSLRISDGALLLVDVAEG---- 116

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
                 QTR+    AF   +K ++V +NKMD
Sbjct: 117 ---IGDQTRKVLQHAFKERLKIILV-LNKMD 143


>UniRef50_Q1VQ31 Cluster: Tetracycline resistance protein; n=1;
           Psychroflexus torquis ATCC 700755|Rep: Tetracycline
           resistance protein - Psychroflexus torquis ATCC 700755
          Length = 660

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 37/114 (32%), Positives = 50/114 (43%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INI ++ HVD+GK+T T   +Y  G I         K    + KGS +     D L  E+
Sbjct: 6   INIGILAHVDAGKTTLTEQFLYNSGAI---------KILGSVDKGSTR----TDSLDIEK 52

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           ER    +  +       V    ID PGH DF   +       D AVL+V+A  G
Sbjct: 53  ERGISIKAATTSFEWKGVKINLIDTPGHVDFSSEVERVLCIVDTAVLVVSAVEG 106


>UniRef50_Q7Q5R3 Cluster: ENSANGP00000020583; n=3; Diptera|Rep:
           ENSANGP00000020583 - Anopheles gambiae str. PEST
          Length = 522

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 45/156 (28%), Positives = 70/156 (44%), Gaps = 2/156 (1%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHL--IYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           +NI ++GHVDSGK+T    L  I      DK    +      ++G  + +    +D    
Sbjct: 5   LNIGILGHVDSGKTTLARALSAIASTAAFDKNPQSQERGITLDLGFSALQ----VDLPDH 60

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
            RE+     Y  L+          +D PGH   I+ +I G    D  +L++ A     E 
Sbjct: 61  LREQAIAEGYEKLQYT-------FVDCPGHASLIRTIIGGAQIIDMMLLVIDA-----EK 108

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
           GI    QT E  LL   L  +++IV +NK+D+ + P
Sbjct: 109 GIQP--QTAE-CLLIGELTCRKMIVVLNKVDALQDP 141


>UniRef50_P0A3B4 Cluster: GTP-binding protein typA/bipA; n=97;
           Bacteria|Rep: GTP-binding protein typA/bipA - Shigella
           flexneri
          Length = 607

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 44/148 (29%), Positives = 62/148 (41%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +I HVD GK+T    L+ + G  D R       E QE          V+D    E+E
Sbjct: 7   NIAIIAHVDHGKTTLVDKLLQQSGTFDSRA------ETQER---------VMDSNDLEKE 51

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R       +  ++        +D PGH DF   +    S  D  +L+V A  G       
Sbjct: 52  RGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMP---- 107

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD 456
              QTR     AF  G+K ++V +NK+D
Sbjct: 108 ---QTRFVTKKAFAYGLKPIVV-INKVD 131


>UniRef50_UPI0000D62D3D Cluster: UPI0000D62D3D related cluster; n=1;
           Mus musculus|Rep: UPI0000D62D3D UniRef100 entry - Mus
           musculus
          Length = 787

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 39/116 (33%), Positives = 55/116 (47%), Gaps = 3/116 (2%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFE---KEAQEMGKGSFKYAWVLDKLKA 183
           N+ VI HVD GKS  T  L+ K G ID+    +F    K+ QE    + K   +  +L A
Sbjct: 20  NMSVIAHVDHGKSMLTDTLVCKVGIIDRIGETRFTDTCKDEQECCI-TIKSTAIFYEL-A 77

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           E +  Y  ++ +        L   ID+PGH DF   M T  S  D A+ +V   +G
Sbjct: 78  END-LYFIKFITTIKDGSGFLINFIDSPGHLDFFSEMRTALSVTDGALAVVDCVSG 132


>UniRef50_Q73LA2 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Treponema denticola|Rep:
           Selenocysteine-specific translation elongation factor -
           Treponema denticola
          Length = 590

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 1/102 (0%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  FI+NM+ GT   D A+LIVAA  G  +        + +H  +   + ++ ++
Sbjct: 58  VDVPGHERFIRNMVAGTWGLDAALLIVAADDGWMQ-------MSSDHLRVLKAMKIESIL 110

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE-DPHTSRRLATTQLLSLS 558
           + + K D  E    E   E+   + +    R+L    + SL+
Sbjct: 111 LVITKSDLAEKDMLELLIEDANAQCEKIIGRKLPAVAVSSLT 152


>UniRef50_P70882 Cluster: Tetracycline resistance protein tetQ
           (Tet(Q)) (TetA(Q)3); n=17; Bacteria|Rep: Tetracycline
           resistance protein tetQ (Tet(Q)) (TetA(Q)3) -
           Bacteroides fragilis
          Length = 641

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 32/114 (28%), Positives = 52/114 (45%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           IN+ ++ H+D+GK++ T +L++  G  +K            +  G      + D +  E+
Sbjct: 4   INLGILAHIDAGKTSVTENLLFASGATEK---------CGRVDNGDT----ITDSMDIEK 50

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
            R    R  +  +    V C  ID PGH DFI  +       D AVLI++A  G
Sbjct: 51  RRGITVRASTTSIIWNGVKCNIIDTPGHMDFIAEVERTFKMLDGAVLILSAKEG 104


>UniRef50_Q30SC0 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Thiomicrospira
           denitrificans ATCC 33889|Rep: Translation elongation
           factor, selenocysteine-specific - Thiomicrospira
           denitrificans (strain ATCC 33889 / DSM 1351)
          Length = 611

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/67 (37%), Positives = 33/67 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH   +KNMI G    DC +++V+   G          QT EH  +   LGVK  +
Sbjct: 58  IDVPGHEKLVKNMIAGAFSFDCVLIVVSVIDG-------IKPQTIEHLEILNLLGVKNAV 110

Query: 436 VGVNKMD 456
           + V K D
Sbjct: 111 LVVTKKD 117


>UniRef50_Q1ETS8 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=6; Clostridiales|Rep: Translation elongation
           factor, selenocysteine-specific:Small GTP- binding
           protein domain - Clostridium oremlandii OhILAs
          Length = 631

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/75 (33%), Positives = 38/75 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  FI+NM+ G S  D  +L+VAA  G          QT+EH  +   L +++ I
Sbjct: 59  IDVPGHEKFIRNMLAGVSGMDIVLLVVAADEGVMP-------QTKEHLDILSLLKIEKGI 111

Query: 436 VGVNKMDSTEPPYSE 480
           + + K    +  + E
Sbjct: 112 IVITKASLVDDEWVE 126


>UniRef50_A7HHY2 Cluster: Selenocysteine-specific translation
           elongation factor precursor; n=5; Cystobacterineae|Rep:
           Selenocysteine-specific translation elongation factor
           precursor - Anaeromyxobacter sp. Fw109-5
          Length = 649

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/67 (37%), Positives = 33/67 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F++ M  G    D  VL++AA  G          QTREH  +   LGV + +
Sbjct: 59  VDVPGHERFVRAMAAGAGGIDLVVLVIAADEGVMP-------QTREHLDICRLLGVPRGL 111

Query: 436 VGVNKMD 456
           V V K D
Sbjct: 112 VAVTKSD 118


>UniRef50_A4E707 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 655

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/75 (32%), Positives = 38/75 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  +++ M+ G +  D AVL+V+A  G          QTREH  +   LGV  ++
Sbjct: 67  VDVPGHSHYLRAMVQGATGIDVAVLVVSAVEGVMP-------QTREHVHVLELLGVTHMV 119

Query: 436 VGVNKMDSTEPPYSE 480
           V +   D  +   +E
Sbjct: 120 VALTMCDLADAEMTE 134


>UniRef50_Q54D77 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 677

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 44/175 (25%), Positives = 73/175 (41%), Gaps = 9/175 (5%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKCGGID----KRTIEKF-EKEAQEMGKGSFKYAWVL- 168
           EI +V  G+VD+GKST  G  + KCG +D    K  +  F  +   E G+ S     ++ 
Sbjct: 212 EIRVVCCGNVDAGKSTLLG--VLKCGVLDDGRGKARLNVFRHRHEVESGRTSSISQEIVG 269

Query: 169 --DKLKAERERRYHNRYCSLEV-RN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVA 339
              K K       H+     E+  +   +   +D  GH  ++K  + G + +     ++A
Sbjct: 270 FDSKGKIVNYNTLHSSLSPSEICESSSKIITFVDLAGHEKYLKTTLFGMTSSSPDYCMIA 329

Query: 340 AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
            G     A     G  +EH  +A +L +   IV + K+D            +IKK
Sbjct: 330 VGANTMGA----TGMCKEHLGIALSLHIPVYIV-ITKIDRAPENVLAATMTDIKK 379


>UniRef50_Q4Q219 Cluster: Mitochondrial elongation factor G,
           putative; n=8; Trypanosomatidae|Rep: Mitochondrial
           elongation factor G, putative - Leishmania major
          Length = 746

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 34/134 (25%), Positives = 60/134 (44%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +H  NI +  H+DSGK+T +  +++  G I K           E+ KG  +    +D ++
Sbjct: 27  KHMRNIGISAHIDSGKTTLSERILFYSGRIGK---------IHEV-KGGTEVGATMDSME 76

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            E+ER    R  + + R        ID PGH DF   +       D A+L++ A  G   
Sbjct: 77  LEKERGITIRSAATQCRWKNSTINIIDTPGHVDFTIEVERALRVLDGAILLMCAVGGVQS 136

Query: 361 AGISKNGQTREHAL 402
             ++ + Q + + +
Sbjct: 137 QTLTVDRQMKRYGV 150


>UniRef50_O67141 Cluster: Elongation factor SelB; n=1; Aquifex
           aeolicus|Rep: Elongation factor SelB - Aquifex aeolicus
          Length = 582

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 28/81 (34%), Positives = 37/81 (45%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  FIKN I G   A   +L+V    G          QT EH  +A + G+K  I
Sbjct: 60  IDVPGHERFIKNAIAGICSASGLILVVDPNEGIMP-------QTIEHLRVAKSFGIKHGI 112

Query: 436 VGVNKMDSTEPPYSEPRFEEI 498
             + KMD  +   +    EE+
Sbjct: 113 AVLTKMDKVDEELAHIAEEEL 133


>UniRef50_Q1ZC67 Cluster: Selenocysteine synthase; n=1; Psychromonas
           sp. CNPT3|Rep: Selenocysteine synthase - Psychromonas
           sp. CNPT3
          Length = 523

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/67 (29%), Positives = 36/67 (53%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  +I+NM++G +  +  +L+++A  G           T +H  +A  LG   +I
Sbjct: 65  VDVPGHERYIRNMVSGIANLNAVILVISATEGWMP-------MTTDHVQIAQALGQTNII 117

Query: 436 VGVNKMD 456
           + +NK D
Sbjct: 118 ICINKSD 124


>UniRef50_Q1JYY0 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Desulfuromonas acetoxidans DSM
           684|Rep: Selenocysteine-specific translation elongation
           factor - Desulfuromonas acetoxidans DSM 684
          Length = 642

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 26/84 (30%), Positives = 41/84 (48%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  FI NM+ G    D  +L++    G          QT EH  +   L +++ I
Sbjct: 64  VDVPGHERFISNMLAGIGGIDLVLLVIDVMEGMMP-------QTHEHLEILELLQIRRGI 116

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           + +NK D  E  + E   EEI+++
Sbjct: 117 IVLNKCDLAEEDWIELVEEEIREK 140


>UniRef50_Q8I592 Cluster: Elongation factor g, putative; n=1;
           Plasmodium falciparum 3D7|Rep: Elongation factor g,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 803

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 4/128 (3%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+D+GK+T T  ++Y  G I         K   E+ +G+      +D ++ ERE
Sbjct: 46  NIGISAHIDAGKTTLTERILYYTGKI---------KSIHEV-RGNDGVGATMDSMELERE 95

Query: 193 R----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           +    +     C  E+ N +     ID PGH DF   +       D A+L++   +G   
Sbjct: 96  KGITIQSATTNCVWEINNKKYNINIIDTPGHVDFTIEVERSLRVLDSAILVICGVSGVQS 155

Query: 361 AGISKNGQ 384
             ++ N Q
Sbjct: 156 QTLTVNRQ 163


>UniRef50_Q55002 Cluster: Oxytetracycline resistance protein; n=2;
           Streptomyces|Rep: Oxytetracycline resistance protein -
           Streptomyces rimosus
          Length = 663

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 43/151 (28%), Positives = 67/151 (44%)
 Frame = +1

Query: 4   HEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 183
           +++N+ ++ HVD+GK++ T  L+++ G ID         E   +  G+       D ++ 
Sbjct: 2   NKLNLGILAHVDAGKTSLTERLLHRTGVID---------EVGSVDAGT----TTTDSMEL 48

Query: 184 ERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 363
           ER+R    R          +    ID PGH DFI  +       D AVL+V+A  G    
Sbjct: 49  ERQRGITIRSAVATFVLDDLKVNLIDTPGHSDFISEVERALGVLDGAVLVVSAVEG---- 104

Query: 364 GISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
                 QTR        LG+  L+  VNK+D
Sbjct: 105 ---VQPQTRILMRTLRRLGIPTLVF-VNKID 131


>UniRef50_Q8UFQ0 Cluster: Tetracycline resistance protein, tetM/tetO
           subfamily; n=2; Rhizobium/Agrobacterium group|Rep:
           Tetracycline resistance protein, tetM/tetO subfamily -
           Agrobacterium tumefaciens (strain C58 / ATCC 33970)
          Length = 649

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 33/114 (28%), Positives = 53/114 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+ ++ HVD+GK++ T  L++  G IDK            +  G+ +     D L+ ER
Sbjct: 4   LNLGILAHVDAGKTSLTERLLFDVGVIDK---------LGSVDTGNTQ----TDSLELER 50

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           +R    R   +       +   ID PGH DFI  +       D AV++V+A  G
Sbjct: 51  QRGITIRAAVVSFTIGDTVVNLIDTPGHPDFIAEVERVLGLLDAAVVVVSAVEG 104


>UniRef50_Q81NX9 Cluster: GTP-binding elongation factor protein,
           TetM/TetO family; n=9; Bacillus cereus group|Rep:
           GTP-binding elongation factor protein, TetM/TetO family
           - Bacillus anthracis
          Length = 647

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 32/114 (28%), Positives = 53/114 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INI ++ HVD+GK++ T  ++Y+   I         KE   +  GS +     D ++ ER
Sbjct: 4   INIEIVAHVDAGKTSLTERILYETNVI---------KEVGRVDSGSTQ----TDSMELER 50

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           +R    +   +      +    ID PGH DFI  +       D A+L+++A  G
Sbjct: 51  QRGITIKASVVSFFIDDIKVNVIDTPGHADFIAEVERSFRVLDGAILVISAVEG 104


>UniRef50_A4FHF5 Cluster: Tetracycline resistance protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: Tetracycline
           resistance protein - Saccharopolyspora erythraea (strain
           NRRL 23338)
          Length = 594

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 33/114 (28%), Positives = 51/114 (44%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+ ++ HVD+GK++ T  L++  G +D         E   +  GS +     D    ER
Sbjct: 4   LNLGILAHVDAGKTSLTERLLHSAGVVD---------EVGNVDDGSTR----TDSTALER 50

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           +R    R   +      V    ID PGH DFI  +       D AVL+++A  G
Sbjct: 51  QRGITIRSAVVSFVVGDVAVNLIDTPGHPDFIAEVERALGVLDGAVLVISAVEG 104


>UniRef50_A0Q2C8 Cluster: Translation elongation factor G; n=1;
           Clostridium novyi NT|Rep: Translation elongation factor
           G - Clostridium novyi (strain NT)
          Length = 666

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 36/114 (31%), Positives = 54/114 (47%), Gaps = 1/114 (0%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ HVD GK+TTT  ++Y  G I         +E   + KGS K  +  + ++ +R 
Sbjct: 6   NIGLVAHVDGGKTTTTEQMLYISGAI---------RELGSVDKGSAKMDY--NSIEKKRG 54

Query: 193 RRYHNRYCSLEVRN*QVLCYH-IDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
               +   S   ++    C + ID PGH DF   +       D AVLIV+A  G
Sbjct: 55  ITIFSDQTSFTWKD---ACINLIDTPGHIDFSSELERSLKALDGAVLIVSAVEG 105


>UniRef50_Q8ZZV4 Cluster: Translation initiation factor aIF-2 gamma
           subunit, putative; n=5; Thermoproteaceae|Rep:
           Translation initiation factor aIF-2 gamma subunit,
           putative - Pyrobaculum aerophilum
          Length = 411

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 24/82 (29%), Positives = 41/82 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M++G +  D A+L+V A         +   QT EH  +   +GV+ ++
Sbjct: 88  LDVPGHEVLVATMVSGAAVVDGALLVVDASQP------APQPQTVEHFAVLDIIGVRHMV 141

Query: 436 VGVNKMDSTEPPYSEPRFEEIK 501
           V  NK+D      +   +E+IK
Sbjct: 142 VAQNKIDLVTKEKALENYEQIK 163


>UniRef50_Q8N442 Cluster: GTP-binding protein GUF1 homolog; n=108;
           cellular organisms|Rep: GTP-binding protein GUF1 homolog
           - Homo sapiens (Human)
          Length = 669

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 50/168 (29%), Positives = 69/168 (41%), Gaps = 6/168 (3%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  ++ HVD GKST    L+   G IDK    K  K+             VLDKL+ ERE
Sbjct: 70  NFSIVAHVDHGKSTLADRLLELTGTIDK---TKNNKQ-------------VLDKLQVERE 113

Query: 193 R----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           R    +             Q L   ID PGH DF   +    S     +L+V A  G   
Sbjct: 114 RGITVKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG--- 170

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMD--STEPPYSEPRFEEI 498
                  QT  +  LAF   +  + V +NK+D  + +P   E + E++
Sbjct: 171 ----IQAQTVANFFLAFEAQLSVIPV-INKIDLKNADPERVENQIEKV 213


>UniRef50_A3Q882 Cluster: Selenocysteine-specific translation
           elongation factor; n=6; Mycobacterium|Rep:
           Selenocysteine-specific translation elongation factor -
           Mycobacterium sp. (strain JLS)
          Length = 570

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F+ NM+ G       + +VAA  G          Q+ EH      LGV+  +
Sbjct: 56  VDVPGHERFVANMLAGVGPVPAVMFVVAATEGWMP-------QSEEHLAALDALGVRHAL 108

Query: 436 VGVNKMDSTEP 468
           + V K D T+P
Sbjct: 109 LIVTKADLTDP 119


>UniRef50_Q9LS91 Cluster: Elongation factor EF-2; n=1; Arabidopsis
           thaliana|Rep: Elongation factor EF-2 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 963

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ HVD GK+T   HLI   GG             +  GK  F     +D L  E+ 
Sbjct: 11  NICILAHVDHGKTTLADHLIASSGG--------GVLHPRLAGKLRF-----MDYLDEEQR 57

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  S+ ++        ID+PGH DF   + T    +D A+++V A  G
Sbjct: 58  RAITMKSSSISLKYKDYSLNLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEG 110


>UniRef50_Q6CBI0 Cluster: Yarrowia lipolytica chromosome C of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome C of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 802

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 46/148 (31%), Positives = 64/148 (43%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +I H+D+GK+TTT  ++Y  G I         K    + +G       +D L AERE
Sbjct: 17  NIGIIAHIDAGKTTTTERILYLSGTI---------KHLGNVDEGD----TTMDFLPAERE 63

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R       +            ID PGH DF   +I      D AV I+     +  AG+ 
Sbjct: 64  RGITIASAATSFNWNNHTVNLIDTPGHADFTFEVIRSIRVLDGAVCIL-----DGVAGV- 117

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD 456
              QT +    A  +G+ + I  VNKMD
Sbjct: 118 -EAQTEKVWKQASEMGIPK-IAFVNKMD 143


>UniRef50_A2R454 Cluster: Function: GTPBP1 of H. sapiens is
           structurally related to elongation factor 1alpha; n=16;
           Dikarya|Rep: Function: GTPBP1 of H. sapiens is
           structurally related to elongation factor 1alpha -
           Aspergillus niger
          Length = 694

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 48/177 (27%), Positives = 81/177 (45%), Gaps = 11/177 (6%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKCGGID----KRTIEKF-EKEAQEMGKGSFKYAWVLD 171
           EI + V+G+VD+GKST  G L+   G +D    K  +  F  K   E G+ S     ++ 
Sbjct: 190 EIRMAVVGNVDAGKSTMLGVLVK--GNLDDGRGKARLNLFRHKHEIESGRTSSVGMEIMG 247

Query: 172 -KLKAERERRYHNRYCSLEV---RN*QVLCYHIDAPGHRDFIKNMITG--TSQADCAVLI 333
              + +     H R  S E    R+ +V+ +  D  GH  +++  + G  +S  +  +L+
Sbjct: 248 FDSRGDIVSSAHGRKMSWEEIGRRSAKVISFS-DLAGHERYLRTTVFGMLSSSPNYCLLM 306

Query: 334 VAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
           VAA  G         G ++EH  +A  L V  +++ V K+D   P   E    ++ K
Sbjct: 307 VAANNGLI-------GMSKEHLGIAVALHVPVMVI-VTKIDICPPQILEETLSQLSK 355


>UniRef50_Q98QW3 Cluster: GTP-binding protein lepA; n=52; cellular
           organisms|Rep: GTP-binding protein lepA - Mycoplasma
           pulmonis
          Length = 597

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 45/164 (27%), Positives = 76/164 (46%), Gaps = 2/164 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  +I H+D GKST    ++        +T+   E +AQ            LD +  E+E
Sbjct: 8   NFSIIAHIDHGKSTLADRILE-----ITQTVSTRELKAQH-----------LDSMDLEQE 51

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R    +  +++++    + + ID PGH DF   +    + ++ A+L+V A  G  EA   
Sbjct: 52  RGITIKLNAVQIKYKDYIFHLIDTPGHVDFTYEVSRSLAASEGALLLVDATQG-IEA--- 107

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD--STEPPYSEPRFEEI 498
              QT  +A LA    +K +I  +NK+D  S +P   +   EE+
Sbjct: 108 ---QTLANAYLALENNLK-IIPIINKIDLPSADPERIKGEIEEV 147


>UniRef50_Q4T508 Cluster: Chromosome 1 SCAF9472, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 1 SCAF9472, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 329

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 51/168 (30%), Positives = 69/168 (41%), Gaps = 6/168 (3%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  +I H+D GKST    L+   G      I K EK  Q           VLDKL+ ERE
Sbjct: 17  NFCIIAHIDHGKSTLADRLLEITG-----AIAKTEKNKQ-----------VLDKLQVERE 60

Query: 193 R----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           R    +          +  Q L   ID PGH DF   +    S     +LIV A  G   
Sbjct: 61  RGITVKAQTASLFYSHQGQQYLLNLIDTPGHVDFSYEVSRSISACQGVLLIVDANQG--- 117

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMD--STEPPYSEPRFEEI 498
                  QT  +  LAF   +  +I  +NK+D  + +P   E + E++
Sbjct: 118 ----IQAQTVANFYLAFEAQL-AIIPVINKIDLRNADPERVESQIEKV 160


>UniRef50_Q663U2 Cluster: Selenocysteine-specific elongation factor
           EF; n=11; Yersinia|Rep: Selenocysteine-specific
           elongation factor EF - Yersinia pseudotuberculosis
          Length = 657

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 25/70 (35%), Positives = 32/70 (45%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  F+ NM+ G    D A+L+VA   G          QTREH  +    G   L 
Sbjct: 56  IDVPGHEKFLANMLAGVGGIDHALLVVACDDGVM-------AQTREHLAILRLSGRPALT 108

Query: 436 VGVNKMDSTE 465
           V + K D  +
Sbjct: 109 VALTKADRVD 118


>UniRef50_A7QN79 Cluster: Chromosome undetermined scaffold_131,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_131, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 355

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 17/42 (40%), Positives = 29/42 (69%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNG 381
           +DA GH++++ NMI+G SQ D  +L++ A   +FE G  ++G
Sbjct: 83  LDAWGHKNYVPNMISGASQVDIGMLVIYAQKVKFETGGERSG 124


>UniRef50_Q7Q3I6 Cluster: ENSANGP00000010178; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000010178 - Anopheles gambiae
           str. PEST
          Length = 682

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 43/165 (26%), Positives = 69/165 (41%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ H+D+GK+TTT  ++Y  G  D            E+  G+     V D L+ ERE
Sbjct: 5   NIGILAHIDAGKTTTTERMLYYSGRTDM---------LGEVKLGN----TVTDFLQQERE 51

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R       ++     +     +D PGH DF   +       D  V+I+    G     ++
Sbjct: 52  RGITICSAAVSFNWKEYRINLLDTPGHIDFTMEVEQSLGAVDGTVIILDGSAGVEAQTVT 111

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
             GQ   H L          +V VNKMD     + +   E+++K+
Sbjct: 112 VWGQADRHRL--------PRLVFVNKMDKESADF-DACLEDLEKK 147


>UniRef50_Q4Y6S3 Cluster: Elongation factor g, putative; n=4;
           Plasmodium|Rep: Elongation factor g, putative -
           Plasmodium chabaudi
          Length = 776

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 4/128 (3%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+D+GK+T T  ++Y  G I         K   E+ +G+      +D +  ERE
Sbjct: 44  NIGISAHIDAGKTTLTERILYYTGKI---------KSIHEV-RGTDGVGATMDSMDLERE 93

Query: 193 R----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           +    +    +C   V N +     ID PGH DF   +       D AVL++   +G   
Sbjct: 94  KGITIQSAATHCVWNVNNNKYDINIIDTPGHVDFTIEVERSLRVLDAAVLVICGVSGVQS 153

Query: 361 AGISKNGQ 384
             ++ N Q
Sbjct: 154 QTLTVNRQ 161


>UniRef50_A3LWR2 Cluster: Mitochondrial elongation factor G-like
           protein; n=2; Pichia|Rep: Mitochondrial elongation
           factor G-like protein - Pichia stipitis (Yeast)
          Length = 845

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 48/164 (29%), Positives = 73/164 (44%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +I H+D+GK+TTT  ++Y  G    +T     K    + +G      V D L +ER+
Sbjct: 42  NIGIIAHIDAGKTTTTERMLYYSG----KT-----KRIGNVDEGD----TVTDYLPSERQ 88

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R    +  ++ +         ID PGH DF   +       D AV I+     +  AG+ 
Sbjct: 89  RGITIQSAAISIPWNNHKINIIDTPGHADFTFEVTRSLRVLDGAVTIL-----DGVAGV- 142

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
              QT +    A +L + + I  VNKMD     +S    E I+K
Sbjct: 143 -EAQTEKVWKQATSLNIPK-IAYVNKMDRPGAGFSRTVMEIIEK 184


>UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog;
           n=93; Bacteria|Rep: GTP-binding protein TypA/BipA
           homolog - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 611

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 42/148 (28%), Positives = 66/148 (44%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +I HVD GK+T    L+ + G     T +K E+ ++           ++D    E+E
Sbjct: 11  NIAIIAHVDHGKTTLVDKLLQQSG-----TFKKHEEFSER----------IMDSNDLEKE 55

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R       +  ++  +     ID PGH DF   +    S  D  +L+V A  G       
Sbjct: 56  RGITILAKNTAIQWKKYRINIIDTPGHADFGGEVERILSMVDSVLLVVDALEGPMP---- 111

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMD 456
              QTR     AF+ G+K ++V +NK+D
Sbjct: 112 ---QTRFVTQKAFSYGIKPIVV-INKID 135


>UniRef50_Q8C3X4-2 Cluster: Isoform 2 of Q8C3X4 ; n=3; Murinae|Rep:
           Isoform 2 of Q8C3X4 - Mus musculus (Mouse)
          Length = 563

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 48/152 (31%), Positives = 62/152 (40%), Gaps = 4/152 (2%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  +I HVD GKST    L+   G     TI+K +K  Q           VLDKL+ ERE
Sbjct: 52  NFSIIAHVDHGKSTLADRLLELTG-----TIDKTKKNKQ-----------VLDKLQVERE 95

Query: 193 R----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           R    +             Q L   ID PGH DF   +    S     +L+V A  G   
Sbjct: 96  RGITVKAQTASLFYSFGGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG--- 152

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
                  QT  +  LAF   +  + V +NK+D
Sbjct: 153 ----IQAQTVANFFLAFEAQLSVIPV-INKID 179


>UniRef50_Q1IHM2 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Acidobacteria|Rep:
           Selenocysteine-specific translation elongation factor -
           Acidobacteria bacterium (strain Ellin345)
          Length = 628

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 28/84 (33%), Positives = 42/84 (50%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  FI+NM+ G    D  +LI++A     E  I    QTREH  +   LG+++ +
Sbjct: 63  VDVPGHERFIRNMLAGVGGIDLVMLIISA-----EESIKP--QTREHFDICRMLGIERGL 115

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
             + K D  +    E   E +K E
Sbjct: 116 TVLTKSDLVD----EETLEVVKAE 135


>UniRef50_Q6MAV2 Cluster: Probable peptide chain release factor 3;
           n=2; Chlamydiae/Verrucomicrobia group|Rep: Probable
           peptide chain release factor 3 - Protochlamydia
           amoebophila (strain UWE25)
          Length = 533

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 28/110 (25%), Positives = 50/110 (45%)
 Frame = +1

Query: 22  VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERRY 201
           +I H D+GK+T T  L+   G I    + +  K     G+ +    W    +  E+ER  
Sbjct: 20  IISHPDAGKTTLTEKLLLYSGMIHTAGMVRGRK-----GRKAAASDW----MAMEQERGI 70

Query: 202 HNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
                +++      +   +D PGH DF ++     + ADCA++++ A  G
Sbjct: 71  SITASAMQFTYNNTIINVLDTPGHEDFSEDTYRTLTAADCAIMVIDAAKG 120


>UniRef50_Q0LF89 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Herpetosiphon aurantiacus ATCC
           23779|Rep: Selenocysteine-specific translation
           elongation factor - Herpetosiphon aurantiacus ATCC 23779
          Length = 627

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 28/101 (27%), Positives = 50/101 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   IKNM+ G +  D  + +VAA  G          Q+ EH  +   LG++  +
Sbjct: 58  VDVPGHERLIKNMLAGVTGFDGVLFVVAADEG-------MQPQSHEHLQILNQLGIEHGL 110

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQLLSLS 558
           + ++K+D  +  + E    +I+ +   TS  LA   ++ +S
Sbjct: 111 IIISKIDLVDAEWLEFISGDIQAQFAATS--LANAPIVPVS 149


>UniRef50_A6C5F4 Cluster: Elongation factor G; n=1; Planctomyces
           maris DSM 8797|Rep: Elongation factor G - Planctomyces
           maris DSM 8797
          Length = 714

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 39/150 (26%), Positives = 64/150 (42%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+DSGK+T T  ++Y  G I K       +E +    G+      +D +  ERE
Sbjct: 9   NIGISAHIDSGKTTLTERVLYYSGRIHK------VREVRGGDGGA-----TMDSMDLERE 57

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           R       + +V+        ID PGH DF   +       D A+L++ +  G     ++
Sbjct: 58  RGITIASAATQVQWKDTTINIIDTPGHVDFTVEVERSLRVLDGAILVLCSVGGVQSQSLT 117

Query: 373 KNGQTREHALLAFTLGVKQLIVGVNKMDST 462
            + Q + + +          I  +NKMD T
Sbjct: 118 VDRQMKRYKV--------PRIAFINKMDRT 139


>UniRef50_Q6ESY0 Cluster: Putative elongation factor 2; n=2; Oryza
           sativa|Rep: Putative elongation factor 2 - Oryza sativa
           subsp. japonica (Rice)
          Length = 1005

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 35/118 (29%), Positives = 52/118 (44%), Gaps = 5/118 (4%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  ++ HVD GK++   HLI   G          E+   E   GS   A V+D L+ E+ 
Sbjct: 18  NTCILAHVDHGKTSLADHLIAAYGS---------ERRVSERMAGS---ARVMDHLEEEQR 65

Query: 193 RRYHNRYCSLEVRN*QV-----LCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  S+ +R           + ID+PGH DF   +      AD A+++V A  G
Sbjct: 66  RAITMKSASIALRRGGEDGGGHRVHLIDSPGHIDFCSEVSAAARLADSALVLVDAAEG 123


>UniRef50_Q4UIT0 Cluster: Elongation factor 2, putative; n=2;
           Theileria|Rep: Elongation factor 2, putative - Theileria
           annulata
          Length = 1226

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 44/152 (28%), Positives = 71/152 (46%), Gaps = 4/152 (2%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKF----EKEAQEMGKGSFKYAWVLDKLK 180
           N+  + HVD GK+T +  LI   G I ++   K      ++ ++M   + K +  +  L 
Sbjct: 16  NVCFLAHVDHGKTTLSDSLISSVGIISEKLSGKLRYLDNRDDEQMRMITIKSS-SISLLY 74

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            +     HN   S   +N +VL   ID+PGH DF   + T     D A+L+V     +  
Sbjct: 75  TKYGHLNHNSN-SNSPKNDKVLINLIDSPGHVDFSIEVSTAARLCDGALLVV-----DVV 128

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
            GI    QTR     A+   VK +++ +NK+D
Sbjct: 129 EGICP--QTRAVLRQAWLENVKTVLI-LNKID 157


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 765,839,921
Number of Sequences: 1657284
Number of extensions: 16272302
Number of successful extensions: 51595
Number of sequences better than 10.0: 413
Number of HSP's better than 10.0 without gapping: 48140
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51224
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57438021881
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -