SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4SP80 Cluster: Chromosome 15 SCAF14542, whole genome s...   148   1e-34
UniRef50_Q14240 Cluster: Eukaryotic initiation factor 4A-II; n=3...   148   1e-34
UniRef50_P38919 Cluster: Eukaryotic initiation factor 4A-III; n=...   138   2e-31
UniRef50_UPI0001553738 Cluster: PREDICTED: hypothetical protein;...   137   2e-31
UniRef50_Q4T4A9 Cluster: Chromosome undetermined SCAF9757, whole...   123   4e-27
UniRef50_A2AAP7 Cluster: DEAD (Asp-Glu-Ala-Asp) box polypeptide ...   115   1e-24
UniRef50_Q23U16 Cluster: DEAD/DEAH box helicase family protein; ...   112   7e-24
UniRef50_UPI000065E01D Cluster: Homolog of Brachydanio rerio "Eu...   109   7e-23
UniRef50_A0BEU9 Cluster: Chromosome undetermined scaffold_102, w...    93   8e-18
UniRef50_Q0E2Q3 Cluster: Putative eukaryotic initiation factor 4...    88   2e-16
UniRef50_A0D232 Cluster: Chromosome undetermined scaffold_35, wh...    87   4e-16
UniRef50_Q3LWE1 Cluster: Translation initiation factor 4A2; n=1;...    81   3e-14
UniRef50_A2DVG1 Cluster: DEAD/DEAH box helicase family protein; ...    79   1e-13
UniRef50_A2EPG4 Cluster: DEAD/DEAH box helicase family protein; ...    78   2e-13
UniRef50_Q4S6B9 Cluster: Chromosome 9 SCAF14729, whole genome sh...    77   6e-13
UniRef50_A5BNE7 Cluster: Putative uncharacterized protein; n=1; ...    75   1e-12
UniRef50_Q9UHL0 Cluster: ATP-dependent RNA helicase DDX25; n=111...    73   7e-12
UniRef50_A2SQE1 Cluster: DEAD/DEAH box helicase domain protein; ...    72   1e-11
UniRef50_Q0AVQ9 Cluster: ATP-dependent RNA helicase; n=1; Syntro...    69   2e-10
UniRef50_Q9KAA6 Cluster: ATP-dependent RNA helicase; n=5; Firmic...    68   2e-10
UniRef50_Q22308 Cluster: Putative uncharacterized protein; n=7; ...    68   3e-10
UniRef50_P96614 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    66   6e-10
UniRef50_Q5KBP5 Cluster: ATP-dependent RNA helicase DBP5; n=3; F...    66   8e-10
UniRef50_Q2NEZ7 Cluster: Predicted helicase; n=6; cellular organ...    66   1e-09
UniRef50_Q81VG0 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    66   1e-09
UniRef50_Q8XKJ8 Cluster: ATP-dependent RNA helicase; n=12; Clost...    64   3e-09
UniRef50_Q8EZ11 Cluster: ATP-dependent RNA helicase; n=4; Leptos...    63   8e-09
UniRef50_Q3AFI3 Cluster: ATP-dependent RNA helicase, DEAD box fa...    63   8e-09
UniRef50_A4RIF1 Cluster: ATP-dependent RNA helicase DBP5; n=7; A...    63   8e-09
UniRef50_A6NSW7 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_Q8SSD2 Cluster: ATP-DEPENDENT RNA HELICASE INVOLVED IN ...    61   2e-08
UniRef50_Q6D2K3 Cluster: ATP-independent RNA helicase; n=6; Prot...    60   4e-08
UniRef50_Q014T4 Cluster: Chromosome 07 contig 1, DNA sequence; n...    60   5e-08
UniRef50_Q5L3G9 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    60   5e-08
UniRef50_A6Q8Y9 Cluster: ATP-dependent RNA helicase, DEAD-box fa...    60   7e-08
UniRef50_P19109 Cluster: ATP-dependent RNA helicase p62; n=9; Eu...    60   7e-08
UniRef50_O83749 Cluster: ATP-dependent RNA helicase; n=2; Trepon...    59   9e-08
UniRef50_Q7QNT5 Cluster: GLP_88_2286_3572; n=1; Giardia lamblia ...    59   9e-08
UniRef50_UPI00005A557C Cluster: PREDICTED: similar to eukaryotic...    58   2e-07
UniRef50_Q0RTL3 Cluster: Cold-shock DeaD box ATP-dependent RNA h...    58   2e-07
UniRef50_A4V6K5 Cluster: DEAD box polypeptide 19 protein; n=3; P...    58   2e-07
UniRef50_Q11UP8 Cluster: ATP-dependent RNA helicase; n=1; Cytoph...    58   3e-07
UniRef50_A0RP33 Cluster: Putative ATP-dependent RNA helicase Rhl...    58   3e-07
UniRef50_Q6YPL1 Cluster: Superfamily II DNA and RNA helicase; n=...    57   4e-07
UniRef50_O26305 Cluster: ATP-dependent RNA helicase, eIF-4A fami...    57   4e-07
UniRef50_Q67NW1 Cluster: ATP-dependent RNA helicase; n=5; Firmic...    57   5e-07
UniRef50_Q1VPX9 Cluster: ATP-independent RNA helicase; n=9; Bact...    56   7e-07
UniRef50_Q725W5 Cluster: ATP-dependent RNA helicase, DEAD/DEAH f...    56   9e-07
UniRef50_P20449 Cluster: ATP-dependent RNA helicase DBP5; n=23; ...    56   9e-07
UniRef50_Q6MN67 Cluster: ATP-dependent RNA helicase; n=3; Deltap...    55   2e-06
UniRef50_P39517 Cluster: ATP-dependent RNA helicase DHH1; n=103;...    55   2e-06
UniRef50_Q5CIF9 Cluster: DEAD-box RNA helicase; n=2; Cryptospori...    54   3e-06
UniRef50_Q2FKY7 Cluster: DEAD/DEAH box helicase-like; n=1; Metha...    54   3e-06
UniRef50_Q89M45 Cluster: ATP-dependent RNA helicase; n=29; cellu...    54   3e-06
UniRef50_Q2J6D3 Cluster: DEAD/DEAH box helicase-like; n=2; Frank...    54   3e-06
UniRef50_O66866 Cluster: ATP-dependent RNA helicase DeaD; n=1; A...    54   3e-06
UniRef50_A6TUK6 Cluster: DEAD/DEAH box helicase domain protein; ...    54   3e-06
UniRef50_UPI0000499A01 Cluster: DEAD/DEAH box helicase; n=1; Ent...    54   5e-06
UniRef50_A6TTG0 Cluster: DEAD/DEAH box helicase domain protein; ...    54   5e-06
UniRef50_Q5CNJ7 Cluster: Similar to RNA-dependent helicase p68; ...    54   5e-06
UniRef50_Q5JKF2 Cluster: DEAD-box ATP-dependent RNA helicase 40;...    54   5e-06
UniRef50_UPI0000E495C3 Cluster: PREDICTED: hypothetical protein;...    53   6e-06
UniRef50_Q7MT81 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    53   6e-06
UniRef50_Q5QWG1 Cluster: ATP-dependent RNA helicase; n=1; Idioma...    53   6e-06
UniRef50_A3J7I3 Cluster: ATP-independent RNA helicase; n=5; Bact...    53   6e-06
UniRef50_A0RUV7 Cluster: Superfamily II helicase; n=3; Thermopro...    53   6e-06
UniRef50_Q8A8L3 Cluster: ATP-independent RNA helicase; n=7; Bact...    53   8e-06
UniRef50_Q5GZA1 Cluster: ATP-dependent RNA helicase; n=6; Xantho...    53   8e-06
UniRef50_Q0M1B5 Cluster: Helicase-like:DEAD/DEAH box helicase-li...    53   8e-06
UniRef50_A0BDT5 Cluster: Chromosome undetermined scaffold_101, w...    53   8e-06
UniRef50_Q9LYJ9 Cluster: DEAD-box ATP-dependent RNA helicase 46;...    53   8e-06
UniRef50_Q8D563 Cluster: Superfamily II DNA and RNA helicase; n=...    52   1e-05
UniRef50_Q6A841 Cluster: Putative ATP-dependent RNA helicase; n=...    52   1e-05
UniRef50_A1KUM8 Cluster: Putative ATP-dependent RNA helicase; n=...    52   1e-05
UniRef50_Q6MN50 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    52   2e-05
UniRef50_A7HKQ8 Cluster: DEAD/DEAH box helicase domain protein; ...    52   2e-05
UniRef50_A6GPV2 Cluster: Helicase; n=1; Limnobacter sp. MED105|R...    51   2e-05
UniRef50_A1XCP2 Cluster: Vasa-like protein; n=2; Coelomata|Rep: ...    51   2e-05
UniRef50_Q9SQV1 Cluster: Probable DEAD-box ATP-dependent RNA hel...    51   2e-05
UniRef50_Q9NXZ2 Cluster: Probable ATP-dependent RNA helicase DDX...    51   2e-05
UniRef50_P42305 Cluster: ATP-dependent RNA helicase dbpA; n=9; F...    51   2e-05
UniRef50_Q5VQL1-2 Cluster: Isoform 2 of Q5VQL1 ; n=2; Magnolioph...    51   3e-05
UniRef50_UPI0000E87E35 Cluster: putative ATP-dependent RNA helic...    50   4e-05
UniRef50_Q5NN72 Cluster: DNA and RNA helicase; n=3; Sphingomonad...    50   4e-05
UniRef50_Q2BIX8 Cluster: Probable ATP-dependent RNA helicase; n=...    50   4e-05
UniRef50_A4C0F9 Cluster: ATP-dependent RNA helicase; n=6; Bacter...    50   4e-05
UniRef50_A4S107 Cluster: Predicted protein; n=1; Ostreococcus lu...    50   4e-05
UniRef50_A5K071 Cluster: ATP-dependent RNA helicase, putative; n...    50   4e-05
UniRef50_Q2S6I0 Cluster: ATP-dependent RNA helicase; n=1; Salini...    50   6e-05
UniRef50_O07897 Cluster: Heat resistant RNA dependent ATPase; n=...    50   6e-05
UniRef50_A1G315 Cluster: DEAD/DEAH box helicase-like; n=2; Salin...    50   6e-05
UniRef50_Q4T821 Cluster: Chromosome undetermined SCAF7914, whole...    50   8e-05
UniRef50_Q92GV2 Cluster: ATP-dependent RNA helicase RhlE; n=10; ...    50   8e-05
UniRef50_Q1MYS3 Cluster: Probable ATP-dependent RNA helicase; n=...    50   8e-05
UniRef50_A6QC93 Cluster: ATP-independent RNA helicase DbpA; n=1;...    50   8e-05
UniRef50_Q9GV13 Cluster: Vasa-related protein CnVAS1; n=3; Eumet...    50   8e-05
UniRef50_Q4JF01 Cluster: Vasa homlogue; n=2; Eukaryota|Rep: Vasa...    50   8e-05
UniRef50_Q2H4C0 Cluster: Putative uncharacterized protein; n=1; ...    50   8e-05
UniRef50_Q10RI7 Cluster: DEAD-box ATP-dependent RNA helicase 38;...    50   8e-05
UniRef50_Q5KJI2 Cluster: ATP-dependent RNA helicase DHH1; n=4; D...    50   8e-05
UniRef50_Q26CN9 Cluster: ATP-dependent RNA helicase; n=1; Flavob...    49   1e-04
UniRef50_Q1J0S9 Cluster: DEAD/DEAH box helicase-like protein; n=...    49   1e-04
UniRef50_Q7RNB9 Cluster: Helicase conserved C-terminal domain, p...    49   1e-04
UniRef50_Q66WQ1 Cluster: DEAD box DNA helicase; n=2; Plasmodium ...    49   1e-04
UniRef50_Q8SQM5 Cluster: ATP-dependent RNA helicase eIF4A; n=1; ...    49   1e-04
UniRef50_Q7UNV7 Cluster: ATP-dependent RNA helicase; n=2; Planct...    49   1e-04
UniRef50_Q4PNH7 Cluster: Putative cold-shock dead-box protein A;...    49   1e-04
UniRef50_Q0BSI7 Cluster: ATP-dependent RNA helicase; n=12; Alpha...    49   1e-04
UniRef50_Q8MZI3 Cluster: GH10652p; n=2; Drosophila melanogaster|...    49   1e-04
UniRef50_Q5CWY8 Cluster: Rok1p, eIF4A-1-family RNA SFII helicase...    49   1e-04
UniRef50_A2DES1 Cluster: DEAD/DEAH box helicase family protein; ...    49   1e-04
UniRef50_Q7A4G0 Cluster: Probable DEAD-box ATP-dependent RNA hel...    49   1e-04
UniRef50_P09052 Cluster: ATP-dependent RNA helicase vasa; n=5; E...    49   1e-04
UniRef50_A7JLA3 Cluster: ATP-dependent RNA helicase; n=20; Franc...    48   2e-04
UniRef50_A2TP65 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    48   2e-04
UniRef50_Q5CHB7 Cluster: Putative uncharacterized protein; n=2; ...    48   2e-04
UniRef50_O97031 Cluster: DjVLGA; n=1; Dugesia japonica|Rep: DjVL...    48   2e-04
UniRef50_A7U5W6 Cluster: DEAD-box helicase 1; n=8; Aconoidasida|...    48   2e-04
UniRef50_Q9M2F9 Cluster: DEAD-box ATP-dependent RNA helicase 52;...    48   2e-04
UniRef50_Q9NQI0 Cluster: Probable ATP-dependent RNA helicase DDX...    48   2e-04
UniRef50_Q7VFA9 Cluster: ATP-dependent RNA helicase DeaD; n=6; H...    48   2e-04
UniRef50_Q5FUQ9 Cluster: ATP-dependent RNA helicase; n=11; cellu...    48   2e-04
UniRef50_Q3SF48 Cluster: DEAD/DEAH box helicase; n=6; cellular o...    48   2e-04
UniRef50_A1FEC3 Cluster: DEAD/DEAH box helicase-like; n=21; Gamm...    48   2e-04
UniRef50_Q17JB5 Cluster: DEAD box ATP-dependent RNA helicase; n=...    48   2e-04
UniRef50_A0CUL6 Cluster: Chromosome undetermined scaffold_28, wh...    48   2e-04
UniRef50_Q58083 Cluster: Probable ATP-dependent RNA helicase MJ0...    48   2e-04
UniRef50_O00148 Cluster: ATP-dependent RNA helicase DDX39; n=27;...    48   2e-04
UniRef50_A5CVQ6 Cluster: ATP-dependent RNA helicase DeaD; n=2; s...    48   3e-04
UniRef50_Q17II7 Cluster: DEAD box ATP-dependent RNA helicase; n=...    48   3e-04
UniRef50_O00571 Cluster: ATP-dependent RNA helicase DDX3X; n=74;...    48   3e-04
UniRef50_P21693 Cluster: ATP-independent RNA helicase dbpA; n=19...    48   3e-04
UniRef50_A4LYS0 Cluster: DEAD/DEAH box helicase domain protein; ...    47   4e-04
UniRef50_Q7QDB7 Cluster: ENSANGP00000017541; n=1; Anopheles gamb...    47   4e-04
UniRef50_Q3ZDP1 Cluster: Vasa-like protein; n=7; Neoptera|Rep: V...    47   4e-04
UniRef50_A0EA02 Cluster: Chromosome undetermined scaffold_85, wh...    47   4e-04
UniRef50_A0D361 Cluster: Chromosome undetermined scaffold_36, wh...    47   4e-04
UniRef50_O22907 Cluster: DEAD-box ATP-dependent RNA helicase 24;...    47   4e-04
UniRef50_P24784 Cluster: ATP-dependent RNA helicase DBP1; n=103;...    47   4e-04
UniRef50_UPI0000F1F65D Cluster: PREDICTED: hypothetical protein;...    47   5e-04
UniRef50_Q9KKW0 Cluster: ATP-dependent RNA helicase, DEAD box fa...    47   5e-04
UniRef50_A6DK15 Cluster: ATP-dependent RNA helicase, specific fo...    47   5e-04
UniRef50_A2U1Q9 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    47   5e-04
UniRef50_A1UCR5 Cluster: DEAD/DEAH box helicase domain protein; ...    47   5e-04
UniRef50_Q012T2 Cluster: DEAD-box protein abstrakt; n=3; Ostreoc...    47   5e-04
UniRef50_A5K9H3 Cluster: Pre-mRNA splicing factor RNA helicase P...    47   5e-04
UniRef50_Q9NR30 Cluster: Nucleolar RNA helicase 2; n=51; Euteleo...    47   5e-04
UniRef50_Q5BFU7 Cluster: ATP-dependent RNA helicase dbp10; n=14;...    47   5e-04
UniRef50_Q2LY23 Cluster: Superfamily II DNA and RNA helicases; n...    46   7e-04
UniRef50_Q1QYG3 Cluster: DEAD/DEAH box helicase-like protein; n=...    46   7e-04
UniRef50_Q0C4R1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    46   7e-04
UniRef50_A5G1U8 Cluster: DEAD/DEAH box helicase domain protein; ...    46   7e-04
UniRef50_Q16XX4 Cluster: DEAD box ATP-dependent RNA helicase; n=...    46   7e-04
UniRef50_A4RBW7 Cluster: Putative uncharacterized protein; n=4; ...    46   7e-04
UniRef50_P93008 Cluster: DEAD-box ATP-dependent RNA helicase 21;...    46   7e-04
UniRef50_UPI0000E48294 Cluster: PREDICTED: similar to DEAD (Asp-...    46   0.001
UniRef50_Q9DF36 Cluster: RNA helicase II/Gu; n=9; Tetrapoda|Rep:...    46   0.001
UniRef50_Q9PGP6 Cluster: ATP-dependent RNA helicase; n=10; cellu...    46   0.001
UniRef50_Q98RE0 Cluster: ATP-DEPENDENT RNA HELICASE; n=1; Mycopl...    46   0.001
UniRef50_Q8D3Y6 Cluster: ATP-dependent RNA helicase, DEAD box fa...    46   0.001
UniRef50_A3ZWP8 Cluster: ATP-dependent RNA helicase; n=1; Blasto...    46   0.001
UniRef50_A3I1F5 Cluster: DEAD/DEAH box helicase-like protein; n=...    46   0.001
UniRef50_A4V6M8 Cluster: Nucleolar RNA helicase II/Gu protein; n...    46   0.001
UniRef50_Q2H6N4 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q13838 Cluster: Spliceosome RNA helicase BAT1; n=55; Eu...    46   0.001
UniRef50_Q9CL21 Cluster: ATP-dependent DNA helicase recQ; n=71; ...    46   0.001
UniRef50_Q8SRB2 Cluster: ATP-dependent RNA helicase DBP2; n=103;...    46   0.001
UniRef50_Q81RE0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    46   0.001
UniRef50_A6H0L1 Cluster: Probable ATP-dependent RNA helicase, DE...    46   0.001
UniRef50_A3N1C2 Cluster: ATP-dependent DNA helicase RecQ; n=2; A...    46   0.001
UniRef50_Q1AG34 Cluster: Ded1-like DEAD-box RNA helicase; n=1; C...    46   0.001
UniRef50_Q17KA8 Cluster: DEAD box ATP-dependent RNA helicase; n=...    46   0.001
UniRef50_A2EVI2 Cluster: DEAD/DEAH box helicase family protein; ...    46   0.001
UniRef50_Q27268 Cluster: ATP-dependent RNA helicase WM6; n=82; E...    46   0.001
UniRef50_P0A9P8 Cluster: Cold-shock DEAD box protein A; n=54; Ga...    46   0.001
UniRef50_P44586 Cluster: Cold-shock DEAD box protein A homolog; ...    46   0.001
UniRef50_Q8A2K2 Cluster: ATP-dependent RNA helicase; n=10; cellu...    45   0.002
UniRef50_Q835K0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    45   0.002
UniRef50_Q81JK1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    45   0.002
UniRef50_Q5FLW7 Cluster: RNA helicase; n=9; Lactobacillus|Rep: R...    45   0.002
UniRef50_Q185X0 Cluster: ATP-dependent RNA helicase; n=3; Clostr...    45   0.002
UniRef50_A3PFY9 Cluster: DEAD/DEAH box helicase domain protein; ...    45   0.002
UniRef50_A0JYP4 Cluster: DEAD/DEAH box helicase domain protein; ...    45   0.002
UniRef50_Q00T47 Cluster: Putative RNA helicase, DRH1; n=1; Ostre...    45   0.002
UniRef50_A5BHG9 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A2WLP5 Cluster: Putative uncharacterized protein; n=3; ...    45   0.002
UniRef50_Q24I45 Cluster: DEAD/DEAH box helicase family protein; ...    45   0.002
UniRef50_Q0W8H7 Cluster: ATP-dependent RNA helicase; n=1; uncult...    45   0.002
UniRef50_A4FZ46 Cluster: DEAD/DEAH box helicase domain protein; ...    45   0.002
UniRef50_Q56XG6 Cluster: DEAD-box ATP-dependent RNA helicase 15;...    45   0.002
UniRef50_Q9VHP0 Cluster: ATP-dependent RNA helicase bel; n=4; Pr...    45   0.002
UniRef50_Q9KNA4 Cluster: ATP-dependent RNA helicase, DEAD box fa...    45   0.002
UniRef50_Q2BP56 Cluster: Putative ATP-dependent RNA helicase; n=...    45   0.002
UniRef50_A7CUH7 Cluster: DEAD/DEAH box helicase domain protein; ...    45   0.002
UniRef50_A6DIU5 Cluster: Probable ATP dependent RNA helicase; n=...    45   0.002
UniRef50_A0M3C7 Cluster: RhlE-like DEAD box family ATP-dependent...    45   0.002
UniRef50_Q016I5 Cluster: Predicted ATP-dependent RNA helicase FA...    45   0.002
UniRef50_A2ZD51 Cluster: Putative uncharacterized protein; n=7; ...    45   0.002
UniRef50_Q61JF4 Cluster: Putative uncharacterized protein CBG098...    45   0.002
UniRef50_Q54TF8 Cluster: DEAD-box RNA helicase; n=2; Dictyosteli...    45   0.002
UniRef50_O97032 Cluster: DjVLGB; n=2; Dugesia|Rep: DjVLGB - Duge...    45   0.002
UniRef50_UPI0001509D93 Cluster: DEAD/DEAH box helicase family pr...    44   0.003
UniRef50_Q17CR5 Cluster: DEAD box ATP-dependent RNA helicase; n=...    44   0.003
UniRef50_Q8W4E1 Cluster: DEAD-box ATP-dependent RNA helicase 47;...    44   0.003
UniRef50_Q4IP34 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    44   0.003
UniRef50_A4RK80 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    44   0.003
UniRef50_Q6FM43 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    44   0.003
UniRef50_Q8SQK9 Cluster: ATP-dependent RNA helicase DHH1; n=1; E...    44   0.003
UniRef50_Q4IF76 Cluster: ATP-dependent RNA helicase DBP2; n=4; F...    44   0.003
UniRef50_Q6C7X8 Cluster: ATP-dependent RNA helicase DBP10; n=3; ...    44   0.003
UniRef50_UPI00015BD198 Cluster: UPI00015BD198 related cluster; n...    44   0.004
UniRef50_UPI00006CEB85 Cluster: DEAD/DEAH box helicase family pr...    44   0.004
UniRef50_A4BBH5 Cluster: Probable ATP-dependent RNA helicase; n=...    44   0.004
UniRef50_A4B5L7 Cluster: ATP-dependent RNA helicase DbpA; n=3; P...    44   0.004
UniRef50_A1U3D6 Cluster: DEAD/DEAH box helicase domain protein; ...    44   0.004
UniRef50_A0Z0M4 Cluster: ATP-dependent RNA helicase; n=1; marine...    44   0.004
UniRef50_A0VLH7 Cluster: DEAD/DEAH box helicase domain protein; ...    44   0.004
UniRef50_Q54TJ4 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q4W7T8 Cluster: VASA RNA helicase; n=1; Artemia francis...    44   0.004
UniRef50_Q4W7T7 Cluster: VASA RNA helicase; n=3; Daphniidae|Rep:...    44   0.004
UniRef50_Q16T16 Cluster: DEAD box ATP-dependent RNA helicase; n=...    44   0.004
UniRef50_Q0E3X4 Cluster: DEAD-box ATP-dependent RNA helicase 35A...    44   0.004
UniRef50_Q89UH0 Cluster: Dead-box ATP-dependent RNA helicase; n=...    44   0.005
UniRef50_Q5GRS8 Cluster: Superfamily II DNA/RNA helicase; n=4; W...    44   0.005
UniRef50_Q28T45 Cluster: DEAD/DEAH box helicase-like protein; n=...    44   0.005
UniRef50_A7HDE9 Cluster: DEAD/DEAH box helicase domain protein; ...    44   0.005
UniRef50_A6T3R2 Cluster: ATP-dependent RNA helicase; n=52; cellu...    44   0.005
UniRef50_A1USG3 Cluster: DEAD/DEAH box helicase domain/helicase ...    44   0.005
UniRef50_A0V009 Cluster: DEAD/DEAH box helicase-like; n=1; Clost...    44   0.005
UniRef50_Q015D2 Cluster: DEAD/DEAH box helicase family protein /...    44   0.005
UniRef50_Q8I0W7 Cluster: Snrnp protein, putative; n=6; Plasmodiu...    44   0.005
UniRef50_Q5CP59 Cluster: DEAD box polypeptide, Y chromosome-rela...    44   0.005
UniRef50_Q4MYL1 Cluster: ATP-dependent RNA helicase, putative; n...    44   0.005
UniRef50_Q9P9G7 Cluster: DEAD-box RNA helicase; n=3; Methanosarc...    44   0.005
UniRef50_Q9PA24 Cluster: ATP-dependent RNA helicase rhlB; n=87; ...    44   0.005
UniRef50_Q0UMB6 Cluster: ATP-dependent RNA helicase DBP10; n=1; ...    44   0.005
UniRef50_Q8EUW5 Cluster: ATP-dependent RNA helicase; n=1; Mycopl...    43   0.007
UniRef50_Q1FMF9 Cluster: Helicase-like:DbpA, RNA-binding:DEAD/DE...    43   0.007
UniRef50_Q11UI8 Cluster: DEAD box-related helicase; n=3; Sphingo...    43   0.007
UniRef50_Q087U7 Cluster: DEAD/DEAH box helicase domain protein; ...    43   0.007
UniRef50_A6VWX2 Cluster: DEAD/DEAH box helicase domain protein; ...    43   0.007
UniRef50_Q388E8 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    43   0.007
UniRef50_Q22LR2 Cluster: Type III restriction enzyme, res subuni...    43   0.007
UniRef50_A7RY08 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...    43   0.007
UniRef50_A7TRT2 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_Q6CDS6 Cluster: ATP-dependent RNA helicase ROK1; n=1; Y...    43   0.007
UniRef50_Q84TG1 Cluster: DEAD-box ATP-dependent RNA helicase 57;...    43   0.007
UniRef50_Q26696 Cluster: Putative DEAD-box RNA helicase HEL64; n...    43   0.007
UniRef50_Q966L9 Cluster: ATP-dependent RNA helicase glh-2; n=4; ...    43   0.007
UniRef50_Q81QF0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    43   0.009
UniRef50_Q9S531 Cluster: DEAD-box protein; n=4; Cystobacterineae...    43   0.009
UniRef50_Q12QV2 Cluster: DEAD/DEAH box helicase-like protein; n=...    43   0.009
UniRef50_Q7K4L8 Cluster: LD33749p; n=1; Drosophila melanogaster|...    43   0.009
UniRef50_A6RW79 Cluster: Putative uncharacterized protein; n=1; ...    43   0.009
UniRef50_Q5N7W4 Cluster: DEAD-box ATP-dependent RNA helicase 30;...    43   0.009
UniRef50_Q9KE87 Cluster: SNF2 helicase; n=1; Bacillus halodurans...    42   0.011
UniRef50_Q0LVA0 Cluster: Helicase-like:DEAD/DEAH box helicase-li...    42   0.011
UniRef50_Q0AR94 Cluster: DEAD/DEAH box helicase domain protein; ...    42   0.011
UniRef50_Q21736 Cluster: Putative uncharacterized protein; n=2; ...    42   0.011
UniRef50_Q0CX32 Cluster: DEAD-box protein 3; n=11; Pezizomycotin...    42   0.011
UniRef50_Q9LUW5 Cluster: DEAD-box ATP-dependent RNA helicase 53;...    42   0.011
UniRef50_Q9LU46 Cluster: DEAD-box ATP-dependent RNA helicase 35;...    42   0.011
UniRef50_Q9P7C7 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    42   0.011
UniRef50_UPI00015B4FC0 Cluster: PREDICTED: similar to bombesin r...    42   0.015
UniRef50_UPI00006CD03A Cluster: P68-like protein, putative; n=1;...    42   0.015
UniRef50_UPI0000498D2C Cluster: DEAD/DEAH box helicase; n=3; Ent...    42   0.015
UniRef50_Q81LV0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    42   0.015
UniRef50_Q6KI10 Cluster: DEAD-box ATP-dependent RNA helicase; n=...    42   0.015
UniRef50_Q5ZT20 Cluster: ATP-dependent RNA helicase; n=4; Legion...    42   0.015
UniRef50_A6DL95 Cluster: Probable ATP-dependent RNA helicase; n=...    42   0.015
UniRef50_A3JG19 Cluster: ATP-dependent RNA helicase; n=1; Marino...    42   0.015
UniRef50_Q9GNP1 Cluster: Vasa homolog; n=18; Eumetazoa|Rep: Vasa...    42   0.015
UniRef50_Q7R3F3 Cluster: GLP_158_79919_77949; n=1; Giardia lambl...    42   0.015
UniRef50_Q7QTB0 Cluster: GLP_15_15676_17025; n=1; Giardia lambli...    42   0.015
UniRef50_Q7QA96 Cluster: ENSANGP00000013118; n=5; Eumetazoa|Rep:...    42   0.015
UniRef50_A4V6K8 Cluster: Putative RNA helicase protein; n=1; Dug...    42   0.015
UniRef50_Q6KZC2 Cluster: ATP-dependent RNA helicase; n=1; Picrop...    42   0.015
UniRef50_Q4PEX7 Cluster: ATP-dependent RNA helicase DBP8; n=1; U...    42   0.015
UniRef50_Q82T78 Cluster: RhlE; ATP-dependent RNA helicase RhlE; ...    42   0.020
UniRef50_Q31AC4 Cluster: DEAD/DEAH box helicase-like protein; n=...    42   0.020
UniRef50_Q1MY97 Cluster: DEAD/DEAH box helicase-like protein; n=...    42   0.020
UniRef50_Q1GJ43 Cluster: DEAD/DEAH box helicase-like protein; n=...    42   0.020
UniRef50_A0KZD5 Cluster: DEAD/DEAH box helicase domain protein; ...    42   0.020
UniRef50_Q9FPI7 Cluster: AT4g37020; n=3; core eudicotyledons|Rep...    42   0.020
UniRef50_Q4YVD7 Cluster: RNA helicase , putative; n=2; Plasmodiu...    42   0.020
UniRef50_Q4Y1I3 Cluster: Helicase, putative; n=2; Plasmodium|Rep...    42   0.020
UniRef50_Q234J0 Cluster: DEAD/DEAH box helicase family protein; ...    42   0.020
UniRef50_A0E4U1 Cluster: Chromosome undetermined scaffold_79, wh...    42   0.020
UniRef50_Q4PFD9 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    42   0.020
UniRef50_UPI00015B61D8 Cluster: PREDICTED: similar to vasa-like ...    41   0.026
UniRef50_UPI0000E25CDC Cluster: PREDICTED: hypothetical protein;...    41   0.026
UniRef50_Q8F0Q7 Cluster: ATP-dependent RNA helicase; n=4; Leptos...    41   0.026
UniRef50_Q6MN90 Cluster: RNA helicase; n=1; Bdellovibrio bacteri...    41   0.026
UniRef50_Q6MBR0 Cluster: Putative ATP-dependent RNA helicase; n=...    41   0.026
UniRef50_Q66FY3 Cluster: ATP-dependent DNA helicase; n=24; Prote...    41   0.026
UniRef50_Q5FNK0 Cluster: ATP-dependent RNA helicase; n=1; Glucon...    41   0.026
UniRef50_O83141 Cluster: ATP-dependent DNA helicase, putative; n...    41   0.026
UniRef50_Q21EB3 Cluster: DEAD/DEAH box helicase-like protein; n=...    41   0.026
UniRef50_Q1Q4V2 Cluster: Similar to ATP-independent RNA helicase...    41   0.026
UniRef50_A6QHA1 Cluster: ATP-dependent RNA helicase DEAD/DEAH bo...    41   0.026
UniRef50_A6G4U7 Cluster: DEAD/DEAH box helicase; n=2; Plesiocyst...    41   0.026
UniRef50_A3EUK2 Cluster: Superfamily II DNA and RNA helicase; n=...    41   0.026
UniRef50_A1VA48 Cluster: DEAD/DEAH box helicase domain protein; ...    41   0.026
UniRef50_A0LLL9 Cluster: DEAD/DEAH box helicase domain protein; ...    41   0.026
UniRef50_A4RW46 Cluster: Predicted protein; n=2; Ostreococcus|Re...    41   0.026
UniRef50_Q4QC38 Cluster: RNA helicase, putative; n=7; Trypanosom...    41   0.026
UniRef50_Q4JG17 Cluster: Vasa-like protein; n=1; Litopenaeus van...    41   0.026
UniRef50_Q2PZC2 Cluster: Vasa protein; n=3; Apidae|Rep: Vasa pro...    41   0.026
UniRef50_A7U5X1 Cluster: DEAD-box helicase 11; n=11; Plasmodium|...    41   0.026
UniRef50_A7U5W8 Cluster: DEAD-box helicase 5; n=6; Plasmodium|Re...    41   0.026
UniRef50_A7AWJ7 Cluster: DEAD/DEAH box helicase and helicase con...    41   0.026
UniRef50_A2E0F8 Cluster: DEAD/DEAH box helicase family protein; ...    41   0.026
UniRef50_P23394 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    41   0.026
UniRef50_UPI00004988F8 Cluster: DEAD/DEAH box helicase; n=1; Ent...    41   0.035
UniRef50_Q4FSS4 Cluster: Possible ATP-dependent DEAD/DEAH box RN...    41   0.035
UniRef50_Q480Z7 Cluster: ATP-dependent RNA helicase, DEAD box fa...    41   0.035
UniRef50_Q3AZR1 Cluster: DEAD/DEAH box helicase-like; n=2; Synec...    41   0.035
UniRef50_Q39MK8 Cluster: DEAD/DEAH box helicase; n=10; Proteobac...    41   0.035
UniRef50_Q188H5 Cluster: Putative ATP-dependent RNA helicase; n=...    41   0.035
UniRef50_Q11QF9 Cluster: Inducible ATP-independent RNA helicase;...    41   0.035
UniRef50_A4B385 Cluster: ATP-dependent RNA helicase, DEAD box fa...    41   0.035
UniRef50_Q9N341 Cluster: Putative uncharacterized protein; n=2; ...    41   0.035
UniRef50_Q9GV07 Cluster: Vasa-related protein PlVAS1; n=1; Duges...    41   0.035
UniRef50_Q54CB8 Cluster: Putative uncharacterized protein; n=1; ...    41   0.035
UniRef50_Q4N9Q9 Cluster: DEAD box RNA helicase, putative; n=3; P...    41   0.035
UniRef50_Q2LZJ8 Cluster: GA19670-PA; n=1; Drosophila pseudoobscu...    41   0.035
UniRef50_Q93ZG7 Cluster: DEAD-box ATP-dependent RNA helicase 38;...    41   0.035
UniRef50_Q7RYZ7 Cluster: ATP-dependent RNA helicase dbp-8; n=15;...    41   0.035
UniRef50_UPI00015609AE Cluster: PREDICTED: similar to DEAD (Asp-...    40   0.046
UniRef50_Q8YXJ0 Cluster: ATP-dependent RNA helicase; n=11; Cyano...    40   0.046
UniRef50_Q8XKQ9 Cluster: ATP-dependent DNA helicase; n=4; Clostr...    40   0.046
UniRef50_Q5QY63 Cluster: ATP-dependent RNA helicase; n=3; Altero...    40   0.046
UniRef50_Q5NML9 Cluster: DNA and RNA helicase; n=28; Alphaproteo...    40   0.046
UniRef50_A4M6V6 Cluster: DEAD/DEAH box helicase domain protein; ...    40   0.046
UniRef50_Q9SWV9 Cluster: Ethylene-responsive RNA helicase; n=5; ...    40   0.046
UniRef50_Q00Y68 Cluster: ATP-dependent RNA helicase; n=3; Ostreo...    40   0.046
UniRef50_A4S6M9 Cluster: Predicted protein; n=3; Ostreococcus|Re...    40   0.046
UniRef50_Q7QV50 Cluster: GLP_435_34658_36088; n=1; Giardia lambl...    40   0.046
UniRef50_A5KB15 Cluster: ATP-dependent RNA helicase, putative; n...    40   0.046
UniRef50_A2DFG9 Cluster: DEAD/DEAH box helicase family protein; ...    40   0.046
UniRef50_A1IIT4 Cluster: RNA helicase; n=1; Neobenedenia girella...    40   0.046
UniRef50_P45818 Cluster: ATP-dependent RNA helicase ROK1; n=11; ...    40   0.046
UniRef50_Q9FZ92 Cluster: Putative DEAD-box ATP-dependent RNA hel...    40   0.046
UniRef50_Q11039 Cluster: Cold-shock DEAD box protein A homolog; ...    40   0.046
UniRef50_Q4P3W3 Cluster: ATP-dependent RNA helicase DBP10; n=1; ...    40   0.046
UniRef50_Q5KMS9 Cluster: ATP-dependent RNA helicase DBP10; n=1; ...    40   0.046
UniRef50_Q2H0R2 Cluster: ATP-dependent RNA helicase DBP10; n=1; ...    40   0.046
UniRef50_UPI000049944E Cluster: recQ family DNA helicase; n=1; E...    40   0.061
UniRef50_UPI00004992E6 Cluster: DEAD/DEAH box helicase; n=3; Ent...    40   0.061
UniRef50_Q9KLE2 Cluster: ATP-dependent RNA helicase DeaD; n=35; ...    40   0.061
UniRef50_A5UZK3 Cluster: DEAD/DEAH box helicase domain protein; ...    40   0.061
UniRef50_A2X7L1 Cluster: Putative uncharacterized protein; n=1; ...    40   0.061
UniRef50_Q61FS8 Cluster: Putative uncharacterized protein CBG115...    40   0.061
UniRef50_Q4UDY7 Cluster: RNA helicase, putative; n=2; Theileria|...    40   0.061
UniRef50_Q4Q2Z6 Cluster: ATP-dependent RNA helicase, putative; n...    40   0.061
UniRef50_Q23WN3 Cluster: Helicase conserved C-terminal domain co...    40   0.061
UniRef50_A2DP01 Cluster: DEAD/DEAH box helicase family protein; ...    40   0.061
UniRef50_Q4P559 Cluster: Putative uncharacterized protein; n=1; ...    40   0.061
UniRef50_P38712 Cluster: ATP-dependent rRNA helicase RRP3; n=6; ...    40   0.061
UniRef50_Q8L7S8 Cluster: DEAD-box ATP-dependent RNA helicase 3; ...    40   0.061
UniRef50_O49289 Cluster: Putative DEAD-box ATP-dependent RNA hel...    40   0.061
UniRef50_Q4P9P3 Cluster: ATP-dependent RNA helicase DRS1; n=1; U...    40   0.061
UniRef50_Q9RXH8 Cluster: ATP-dependent RNA helicase, putative; n...    40   0.080
UniRef50_Q97PV7 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    40   0.080
UniRef50_Q3AX69 Cluster: DEAD/DEAH box helicase-like; n=15; Cyan...    40   0.080
UniRef50_Q2J919 Cluster: Helicase-like; n=3; Frankia|Rep: Helica...    40   0.080
UniRef50_Q18W60 Cluster: DEAD/DEAH box helicase-like; n=2; Desul...    40   0.080
UniRef50_Q14NT1 Cluster: Putative atp-dependent rna helicase pro...    40   0.080
UniRef50_A7BCL2 Cluster: Putative uncharacterized protein; n=1; ...    40   0.080
UniRef50_A6Q863 Cluster: ATP-dependent RNA helicase; n=1; Sulfur...    40   0.080
UniRef50_A4BET4 Cluster: DEAD/DEAH box helicase-like protein; n=...    40   0.080
UniRef50_A7P8T9 Cluster: Chromosome chr3 scaffold_8, whole genom...    40   0.080
UniRef50_Q581A3 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    40   0.080
UniRef50_Q4UBP8 Cluster: RNA helicase, putative; n=4; Eukaryota|...    40   0.080
UniRef50_A7SVK2 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.080
UniRef50_Q5KME7 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    40   0.080
UniRef50_Q9Y2R4 Cluster: Probable ATP-dependent RNA helicase DDX...    40   0.080
UniRef50_Q9BUQ8 Cluster: Probable ATP-dependent RNA helicase DDX...    40   0.080
UniRef50_Q9UHI6 Cluster: Probable ATP-dependent RNA helicase DDX...    40   0.080
UniRef50_Q5KPU1 Cluster: ATP-dependent RNA helicase DBP8; n=2; F...    40   0.080
UniRef50_UPI00004994C0 Cluster: DEAD/DEAH box helicase; n=2; Ent...    39   0.11 
UniRef50_Q62IF8 Cluster: ATP-dependent RNA helicase RhlE; n=59; ...    39   0.11 
UniRef50_Q5NZY2 Cluster: ATP-dependent RNA helicase DeaD; n=18; ...    39   0.11 
UniRef50_Q15T34 Cluster: DEAD/DEAH box helicase-like; n=1; Pseud...    39   0.11 
UniRef50_A7CSF3 Cluster: DEAD/DEAH box helicase domain protein; ...    39   0.11 
UniRef50_A5FST0 Cluster: DEAD/DEAH box helicase domain protein; ...    39   0.11 
UniRef50_A4SWL3 Cluster: DEAD/DEAH box helicase domain protein; ...    39   0.11 
UniRef50_A1WB42 Cluster: DEAD/DEAH box helicase domain protein; ...    39   0.11 
UniRef50_Q012E3 Cluster: DEAD-box protein abstrakt; n=1; Ostreoc...    39   0.11 
UniRef50_Q95QN2 Cluster: Putative uncharacterized protein; n=2; ...    39   0.11 
UniRef50_Q4UBV5 Cluster: DEAD-box family (RNA) helicase, putativ...    39   0.11 
UniRef50_Q4N0E9 Cluster: ATP-dependent RNA helicase, putative; n...    39   0.11 
UniRef50_A0CM98 Cluster: Chromosome undetermined scaffold_21, wh...    39   0.11 
UniRef50_Q9SF41 Cluster: DEAD-box ATP-dependent RNA helicase 45;...    39   0.11 
UniRef50_A4R5B8 Cluster: ATP-dependent RNA helicase DBP10; n=2; ...    39   0.11 
UniRef50_Q484Q1 Cluster: RNA helicase DeaD; n=1; Colwellia psych...    39   0.14 
UniRef50_O54116 Cluster: Probable DEAD-box RNA helicase; n=10; S...    39   0.14 
UniRef50_Q44NG9 Cluster: Helicase, C-terminal:DEAD/DEAH box heli...    39   0.14 
UniRef50_Q11U28 Cluster: ATP-dependent RNA helicase protein; n=4...    39   0.14 
UniRef50_A6NQG8 Cluster: Putative uncharacterized protein; n=2; ...    39   0.14 
UniRef50_A6CFZ8 Cluster: ATP-dependent RNA helicase; n=1; Planct...    39   0.14 
UniRef50_A5EYB1 Cluster: ATP-dependent rna helicase Rhl; n=2; Ga...    39   0.14 
UniRef50_Q9LKL6 Cluster: DEAD box protein P68; n=5; Viridiplanta...    39   0.14 
UniRef50_A4S294 Cluster: Predicted protein; n=1; Ostreococcus lu...    39   0.14 
UniRef50_Q4UE18 Cluster: RNA helicase, putative; n=2; Theileria|...    39   0.14 
UniRef50_A7RGX3 Cluster: Predicted protein; n=3; Eukaryota|Rep: ...    39   0.14 
UniRef50_Q5V7B7 Cluster: Putative uncharacterized protein; n=1; ...    39   0.14 
UniRef50_Q4P3U9 Cluster: ATP-dependent rRNA helicase RRP3; n=20;...    39   0.14 
UniRef50_Q8H0U8 Cluster: DEAD-box ATP-dependent RNA helicase 42;...    39   0.14 
UniRef50_P38719 Cluster: ATP-dependent RNA helicase DBP8; n=14; ...    39   0.14 
UniRef50_P20447 Cluster: ATP-dependent RNA helicase DBP3; n=20; ...    39   0.14 
UniRef50_Q08BL1 Cluster: Zgc:153386; n=2; Danio rerio|Rep: Zgc:1...    38   0.19 
UniRef50_Q6MR64 Cluster: ATP-dependent RNA helicase; n=5; cellul...    38   0.19 
UniRef50_Q6MQY6 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    38   0.19 
UniRef50_Q1IMK6 Cluster: DEAD/DEAH box helicase-like; n=1; Acido...    38   0.19 
UniRef50_A7CSF4 Cluster: Helicase domain protein; n=1; Opitutace...    38   0.19 
UniRef50_A6C005 Cluster: ATP-dependent DNA helicase RecG; n=1; P...    38   0.19 
UniRef50_Q9AW05 Cluster: DEAD box protein; n=1; Guillardia theta...    38   0.19 
UniRef50_Q8MYE9 Cluster: Similar to Mus musculus (Mouse). DEAD-b...    38   0.19 
UniRef50_Q8IJ90 Cluster: Putative uncharacterized protein; n=1; ...    38   0.19 
UniRef50_Q8I416 Cluster: ATP-dependent RNA helicase, putative; n...    38   0.19 
UniRef50_Q7R3I2 Cluster: GLP_158_41121_38797; n=1; Giardia lambl...    38   0.19 
UniRef50_A7SE71 Cluster: Predicted protein; n=1; Nematostella ve...    38   0.19 
UniRef50_A3FQ46 Cluster: U5 snRNP 100 kD protein, putative; n=2;...    38   0.19 
UniRef50_A2E9Y0 Cluster: DEAD/DEAH box helicase family protein; ...    38   0.19 
UniRef50_UPI0000DAE40A Cluster: hypothetical protein Rgryl_01000...    38   0.25 
UniRef50_Q8YH70 Cluster: ATP-DEPENDENT RNA HELICASE RHLE; n=10; ...    38   0.25 
UniRef50_Q893G8 Cluster: ATP-dependent RNA helicase; n=4; Clostr...    38   0.25 
UniRef50_Q62J95 Cluster: ATP-dependent RNA helicase RhlE, putati...    38   0.25 
UniRef50_Q30P62 Cluster: DEAD/DEAH box helicase-like; n=1; Thiom...    38   0.25 
UniRef50_Q4AEL1 Cluster: Helicase, C-terminal:DEAD/DEAH box heli...    38   0.25 
UniRef50_Q11WD3 Cluster: Possible ATP-dependent RNA helicase; n=...    38   0.25 
UniRef50_Q01PH0 Cluster: DEAD/DEAH box helicase domain protein; ...    38   0.25 
UniRef50_A6PQ62 Cluster: DEAD/DEAH box helicase domain protein; ...    38   0.25 
UniRef50_A3ZXX1 Cluster: ATP-dependent RNA helicase; n=2; Planct...    38   0.25 
UniRef50_A2SJY2 Cluster: Putative ATP-dependent RNA helicase; n=...    38   0.25 
UniRef50_Q93382 Cluster: Putative uncharacterized protein; n=2; ...    38   0.25 
UniRef50_Q8IJI8 Cluster: RNA helicase, putative; n=1; Plasmodium...    38   0.25 
UniRef50_Q978T9 Cluster: ATP-dependent RNA helicase; n=3; Thermo...    38   0.25 
UniRef50_O26752 Cluster: ATP-dependent RNA helicase related prot...    38   0.25 
UniRef50_Q98I01 Cluster: UvrABC system protein B; n=368; cellula...    38   0.25 
UniRef50_P44701 Cluster: ATP-dependent RNA helicase srmB homolog...    38   0.25 
UniRef50_A5DIX5 Cluster: ATP-dependent RNA helicase ROK1; n=2; P...    38   0.25 
UniRef50_Q5KIK3 Cluster: ATP-dependent RNA helicase DRS1; n=1; F...    38   0.25 
UniRef50_UPI0000E87F40 Cluster: ATP-dependent DNA helicase; n=1;...    38   0.32 
UniRef50_Q64VR8 Cluster: ATP-dependent RNA helicase DeaD; n=14; ...    38   0.32 
UniRef50_Q0HYG8 Cluster: DEAD/DEAH box helicase domain protein; ...    38   0.32 
UniRef50_Q0HKH0 Cluster: DEAD/DEAH box helicase domain protein; ...    38   0.32 
UniRef50_A0KTC9 Cluster: DEAD/DEAH box helicase domain protein; ...    38   0.32 
UniRef50_Q7Q0A7 Cluster: ENSANGP00000011621; n=5; Endopterygota|...    38   0.32 
UniRef50_Q5CPP0 Cluster: Dbp6p, eIF4a-1 family RNA SFII helicase...    38   0.32 
UniRef50_Q4Q5M6 Cluster: ATP-dependent RNA helicase-like protein...    38   0.32 
UniRef50_A7AWZ5 Cluster: DEAD/DEAH box helicase and helicase con...    38   0.32 
UniRef50_A5KCF7 Cluster: ATP-dependent RNA helicase, putative; n...    38   0.32 
UniRef50_Q8L4E9 Cluster: DEAD-box ATP-dependent RNA helicase 36;...    38   0.32 
UniRef50_Q5KHB7 Cluster: ATP-dependent RNA helicase DBP3; n=2; F...    38   0.32 
UniRef50_UPI0000499ECF Cluster: DEAD/DEAH box helicase; n=1; Ent...    37   0.43 
UniRef50_Q81SY8 Cluster: ATP-dependent DNA helicase RecQ; n=10; ...    37   0.43 
UniRef50_Q6MHS8 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    37   0.43 
UniRef50_Q2YZZ9 Cluster: Putative uncharacterized protein; n=1; ...    37   0.43 
UniRef50_Q1I3W1 Cluster: ATP-dependent RNA helicase RhlE, DEAD b...    37   0.43 
UniRef50_Q0TQ86 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    37   0.43 
UniRef50_A7GN22 Cluster: ATP-dependent DNA helicase, RecQ family...    37   0.43 
UniRef50_A6VTY7 Cluster: DEAD/DEAH box helicase domain protein; ...    37   0.43 
UniRef50_A4EAF2 Cluster: Putative uncharacterized protein; n=1; ...    37   0.43 
UniRef50_A3WD13 Cluster: DNA and RNA helicase; n=2; Alphaproteob...    37   0.43 
UniRef50_Q019E9 Cluster: ATP-dependent RNA helicase; n=2; Ostreo...    37   0.43 
UniRef50_Q9V3C4 Cluster: CG6539-PA; n=1; Drosophila melanogaster...    37   0.43 
UniRef50_Q965K2 Cluster: Putative uncharacterized protein; n=2; ...    37   0.43 
UniRef50_Q4UA43 Cluster: DEAD-family helicase, putative; n=3; Pi...    37   0.43 
UniRef50_A0C369 Cluster: Chromosome undetermined scaffold_146, w...    37   0.43 
UniRef50_Q09775 Cluster: ATP-dependent RNA helicase rok1; n=1; S...    37   0.43 
UniRef50_UPI00015564E6 Cluster: PREDICTED: similar to DEAD (Asp-...    37   0.57 
UniRef50_UPI0000E49D13 Cluster: PREDICTED: similar to DEAD (Asp-...    37   0.57 
UniRef50_UPI00003C8469 Cluster: hypothetical protein Faci_030017...    37   0.57 
UniRef50_UPI0000F3242A Cluster: Probable ATP-dependent RNA helic...    37   0.57 
UniRef50_Q0FAJ4 Cluster: Dead-box ATP-dependent RNA helicase; n=...    37   0.57 
UniRef50_A4S3A0 Cluster: Predicted protein; n=2; Ostreococcus|Re...    37   0.57 
UniRef50_Q7QWI2 Cluster: GLP_538_22840_21176; n=2; Giardia intes...    37   0.57 
UniRef50_Q4QJI9 Cluster: Nucleolar RNA helicase II, putative; n=...    37   0.57 
UniRef50_A2EPC6 Cluster: Type III restriction enzyme, res subuni...    37   0.57 
UniRef50_A1IIT5 Cluster: RNA helicase; n=1; Neobenedenia girella...    37   0.57 
UniRef50_A3H9E9 Cluster: DEAD/DEAH box helicase-like; n=1; Caldi...    37   0.57 
UniRef50_Q5EAK4 Cluster: ATP-dependent DNA helicase tlh1; n=3; S...    37   0.57 
UniRef50_UPI0000E4A052 Cluster: PREDICTED: similar to DEAD/H box...    36   0.75 
UniRef50_Q8G567 Cluster: ATP-dependent DNA helicase RecQ; n=4; B...    36   0.75 
UniRef50_Q6APU7 Cluster: Related to ATP-dependent RNA helicase; ...    36   0.75 
UniRef50_Q30YG9 Cluster: DEAD/DEAH box helicase-like; n=3; Delta...    36   0.75 
UniRef50_Q1IHX8 Cluster: ATP-dependent DNA helicase RecG; n=2; A...    36   0.75 
UniRef50_A7HG33 Cluster: DEAD/DEAH box helicase domain protein; ...    36   0.75 
UniRef50_A6TX45 Cluster: ATP-dependent DNA helicase RecQ; n=1; A...    36   0.75 
UniRef50_A4RUB4 Cluster: Predicted protein; n=2; Ostreococcus|Re...    36   0.75 
UniRef50_Q65XX1 Cluster: Vasa-and belle-like helicase protein 1,...    36   0.75 
UniRef50_Q4Z5Q6 Cluster: ATP-dependent RNA helicase, putative; n...    36   0.75 
UniRef50_Q4XYT8 Cluster: RNA helicase, putative; n=3; Plasmodium...    36   0.75 
UniRef50_Q4N5F8 Cluster: ATP-dependent RNA helicase, putative; n...    36   0.75 
UniRef50_Q240I5 Cluster: DEAD/DEAH box helicase family protein; ...    36   0.75 
UniRef50_Q22MC1 Cluster: Type III restriction enzyme, res subuni...    36   0.75 
UniRef50_Q5UQD1 Cluster: Putative ATP-dependent RNA helicase R45...    36   0.75 
UniRef50_P54475 Cluster: Probable ATP-dependent RNA helicase yqf...    36   0.75 

>UniRef50_Q4SP80 Cluster: Chromosome 15 SCAF14542, whole genome
           shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 15
           SCAF14542, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 366

 Score =  148 bits (359), Expect = 1e-34
 Identities = 66/82 (80%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSA+HGDMD
Sbjct: 208 QFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMD 267

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 268 QKERDVIMREFRSGSSRVLITT 289



 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 45/76 (59%), Positives = 53/76 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 NFVTE D+R L+DIE F
Sbjct: 291 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRVLRDIETF 350

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T++ EMP +VA+LI
Sbjct: 351 YNTTVEEMPMNVADLI 366


>UniRef50_Q14240 Cluster: Eukaryotic initiation factor 4A-II; n=37;
           Bilateria|Rep: Eukaryotic initiation factor 4A-II - Homo
           sapiens (Human)
          Length = 407

 Score =  148 bits (359), Expect = 1e-34
 Identities = 66/82 (80%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSA+HGDMD
Sbjct: 249 QFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMD 308

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 309 QKERDVIMREFRSGSSRVLITT 330



 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 45/76 (59%), Positives = 53/76 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 NFVTE D+R L+DIE F
Sbjct: 332 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETF 391

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T++ EMP +VA+LI
Sbjct: 392 YNTTVEEMPMNVADLI 407


>UniRef50_P38919 Cluster: Eukaryotic initiation factor 4A-III;
           n=366; root|Rep: Eukaryotic initiation factor 4A-III -
           Homo sapiens (Human)
          Length = 411

 Score =  138 bits (333), Expect = 2e-31
 Identities = 59/85 (69%), Positives = 74/85 (87%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVS+MHGDM 
Sbjct: 253 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP 312

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ERE IM++FR+G+SRVLI+T  W
Sbjct: 313 QKERESIMKEFRSGASRVLISTDVW 337



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 37/74 (50%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV QVS +INYDLP+NRE Y                 NFV   D R L+DIE +Y 
Sbjct: 338 ARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYS 397

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 398 TQIDEMPMNVADLI 411


>UniRef50_UPI0001553738 Cluster: PREDICTED: hypothetical protein;
           n=2; Mus musculus|Rep: PREDICTED: hypothetical protein -
           Mus musculus
          Length = 490

 Score =  137 bits (332), Expect = 2e-31
 Identities = 61/73 (83%), Positives = 69/73 (94%)
 Frame = +2

Query: 35  EWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMR 214
           EWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSA+HGDMDQ+ER+VIMR
Sbjct: 350 EWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMR 409

Query: 215 QFRTGSSRVLITT 253
           +FR+GSSRVLITT
Sbjct: 410 EFRSGSSRVLITT 422



 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 43/76 (56%), Positives = 50/76 (65%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLA GIDVQQVS VINYDLP+NRENY                 NFVTE D+R L+DIE F
Sbjct: 424 LLAHGIDVQQVSLVINYDLPTNRENY---------IHRKGVAINFVTEEDKRILRDIETF 474

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T + EMP +V +LI
Sbjct: 475 YNTPVEEMPMNVGDLI 490


>UniRef50_Q4T4A9 Cluster: Chromosome undetermined SCAF9757, whole
           genome shotgun sequence; n=2; Euteleostomi|Rep:
           Chromosome undetermined SCAF9757, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 215

 Score =  123 bits (297), Expect = 4e-27
 Identities = 53/74 (71%), Positives = 68/74 (91%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           +EWKL TLCDLY+TL+I QAVIF NTRRKVDWLTE++  +DFTVSAMHGDM+Q+ R+++M
Sbjct: 113 QEWKLPTLCDLYETLTITQAVIFVNTRRKVDWLTENLLGKDFTVSAMHGDMEQKTRDLVM 172

Query: 212 RQFRTGSSRVLITT 253
           ++FR+GSSR+LITT
Sbjct: 173 KEFRSGSSRILITT 186



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 24/26 (92%), Positives = 25/26 (96%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           LLARGIDVQQVS VINYDLP+NRENY
Sbjct: 188 LLARGIDVQQVSLVINYDLPANRENY 213


>UniRef50_A2AAP7 Cluster: DEAD (Asp-Glu-Ala-Asp) box polypeptide 48;
           n=5; Fungi/Metazoa group|Rep: DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 48 - Mus musculus (Mouse)
          Length = 299

 Score =  115 bits (276), Expect = 1e-24
 Identities = 49/68 (72%), Positives = 59/68 (86%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVS+MHGDM 
Sbjct: 232 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP 291

Query: 188 QREREVIM 211
           Q+ERE IM
Sbjct: 292 QKERESIM 299


>UniRef50_Q23U16 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Tetrahymena thermophila SB210|Rep: DEAD/DEAH box
           helicase family protein - Tetrahymena thermophila SB210
          Length = 475

 Score =  112 bits (270), Expect = 7e-24
 Identities = 47/82 (57%), Positives = 70/82 (85%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYIA++ EEWK +TL +LY+ + IAQA+I+CNT+++VD L + +  ++ TVSAMHG+MD
Sbjct: 316 QFYIALDKEEWKFDTLVELYNNIEIAQAIIYCNTKKRVDELRDKLIEKNMTVSAMHGEMD 375

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ R++IM++FRTG+SRVLITT
Sbjct: 376 QQNRDLIMKEFRTGTSRVLITT 397



 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 34/75 (45%), Positives = 44/75 (58%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LL+RGID+ QV+ VINYDLP  +E+Y                 NFV  AD + LK+ E +
Sbjct: 399 LLSRGIDIHQVNLVINYDLPLKKESYIHRIGRSGRFGRKGVAINFVVPADAKFLKETEKY 458

Query: 436 YHTSIVEMPSDVANL 480
           Y T IVEMP DV+ +
Sbjct: 459 YQTQIVEMPLDVSQI 473


>UniRef50_UPI000065E01D Cluster: Homolog of Brachydanio rerio
           "Eukaryotic translation initiation factor 4A, isoform
           1A.; n=1; Takifugu rubripes|Rep: Homolog of Brachydanio
           rerio "Eukaryotic translation initiation factor 4A,
           isoform 1A. - Takifugu rubripes
          Length = 357

 Score =  109 bits (262), Expect = 7e-23
 Identities = 49/82 (59%), Positives = 63/82 (76%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI  E EE KLE+LC LY TL+I QAVIF NTR+K +WLT+ +  +DFTVS +H +M 
Sbjct: 199 QFYIKTETEEKKLESLCGLYSTLTITQAVIFVNTRKKAEWLTQELMSKDFTVSVLHSEMG 258

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER+  M++FR+GSSRV ITT
Sbjct: 259 QSERDTTMKEFRSGSSRVFITT 280



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 30/76 (39%), Positives = 44/76 (57%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LL+RGIDVQQVS VIN+DLP+  E+Y                 N VTE  +  L  I++F
Sbjct: 282 LLSRGIDVQQVSLVINFDLPTKLESYIHRIGRSGRFGRGGVAINMVTEESQPMLAIIQNF 341

Query: 436 YHTSIVEMPSDVANLI 483
           Y   I E+P+++ +++
Sbjct: 342 YDFKIKELPANMVDIV 357


>UniRef50_A0BEU9 Cluster: Chromosome undetermined scaffold_102,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_102,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 395

 Score = 92.7 bits (220), Expect = 8e-18
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F+I ++ E+WK ETLCDLY+  SI Q+VIFC T++K +WL   M   +FTV  +H  M 
Sbjct: 237 QFFIQVDKEDWKFETLCDLYEIASITQSVIFCQTKQKCEWLVNKMLESNFTVVQIHEGMS 296

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q++R  IMR ++ G  RVLI T
Sbjct: 297 QQQRNEIMRDYKQGIKRVLIGT 318



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/76 (27%), Positives = 38/76 (50%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           +L R +D++ VS +INYD+P+++E Y                   +   D + L  IE +
Sbjct: 320 ILRRCLDIEYVSLIINYDVPTSKELYILRIGRKGKFGRKGVAITLIRSEDFKILNQIEQY 379

Query: 436 YHTSIVEMPSDVANLI 483
           Y T I E+P +  +++
Sbjct: 380 YSTQIKELPINFTDIL 395


>UniRef50_Q0E2Q3 Cluster: Putative eukaryotic initiation factor
           4A-2; n=5; Oryza sativa|Rep: Putative eukaryotic
           initiation factor 4A-2 - Oryza sativa subsp. japonica
           (Rice)
          Length = 416

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 38/82 (46%), Positives = 60/82 (73%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ +E E+ KL+ LC L+DT+ I +++IF NTR     LTE +  + +TVSA+HG + 
Sbjct: 261 QFYVNVEKEDCKLDKLCGLFDTMEITRSIIFVNTRHHAKSLTEKIRGKGYTVSAIHGGIH 320

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR R+  +++F++GSSR+LITT
Sbjct: 321 QRARDKAVQEFQSGSSRILITT 342



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 25/73 (34%), Positives = 35/73 (47%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHT 444
           RGIDV +    I YDLP+    Y                 +F+T  D R    I+ F +T
Sbjct: 345 RGIDVLRAPAAIFYDLPTQPVCYLRHVQSGQHGRKGVAI-SFITSTDERVFSTIQKFCNT 403

Query: 445 SIVEMPSDVANLI 483
            I E+PS+VA+L+
Sbjct: 404 QIEELPSNVADLL 416


>UniRef50_A0D232 Cluster: Chromosome undetermined scaffold_35, whole
           genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_35,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 434

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 34/82 (41%), Positives = 62/82 (75%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYIAI+ E+ K + L +LY  L+++Q+++FCN+++ VD L + +    FTVS +H  M+
Sbjct: 272 QFYIAIQQEDQKFKVLVELYKNLTVSQSILFCNSKKTVDDLYDKLTAEGFTVSKIHSQME 331

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ERE +M++F+ G++R+L++T
Sbjct: 332 QKEREQVMQEFKKGAARILVST 353



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/75 (37%), Positives = 40/75 (53%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L+ RGIDVQQ+S VINY+ P  +E Y                 N V + +   L ++E +
Sbjct: 355 LMGRGIDVQQLSLVINYEFPRLKEQYIHRVGRAGRYGRKGVAINMVAQQEANLLLEVEKY 414

Query: 436 YHTSIVEMPSDVANL 480
           Y+T I EMP D+A +
Sbjct: 415 YNTKIDEMPKDLAEV 429


>UniRef50_Q3LWE1 Cluster: Translation initiation factor 4A2; n=1;
           Bigelowiella natans|Rep: Translation initiation factor
           4A2 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 378

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 35/82 (42%), Positives = 54/82 (65%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI++ +EE KL  L D+++TL + Q +IFCNT RK +W+   +   +F V  +HG + 
Sbjct: 225 QFYISVFIEENKLLALLDIFETLLVGQVLIFCNTIRKANWIHNKLLANNFNVGLIHGRVI 284

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER  I + FR G +R L+TT
Sbjct: 285 QKERTNIFKNFRDGKTRALVTT 306



 Score = 37.1 bits (82), Expect = 0.43
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+++ +VS VINYD+P+ ++ Y                 NF    D   +K++E  + 
Sbjct: 310 SRGLNIPEVSLVINYDIPTFKDVYLHRIGRTGRFGRQGVAINFAKLRDLHNIKNLEVHFS 369

Query: 442 TSIVEM 459
            +I E+
Sbjct: 370 ITIEEL 375


>UniRef50_A2DVG1 Cluster: DEAD/DEAH box helicase family protein;
           n=3; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 478

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 34/82 (41%), Positives = 57/82 (69%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++    K + L D+Y ++SI +A+IF N++  VD+++E +    F V+ +H  +D
Sbjct: 310 QFYVDVQETSNKFDCLLDIYGSVSIQKAIIFANSKNAVDYISEQLQQHGFGVAPIHAGLD 369

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER+ IMR FRTG++RVLI+T
Sbjct: 370 QLERDRIMRDFRTGTARVLIST 391



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/76 (35%), Positives = 40/76 (52%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQV+ VIN++LP   E Y                 N     D   ++ +++ 
Sbjct: 393 LLARGIDVQQVTLVINFELPKKLEQYIHRIGRSGRYGRKGVAINICDHEDMNVIEMLKNH 452

Query: 436 YHTSIVEMPSDVANLI 483
           Y T+I E+PSD+  ++
Sbjct: 453 YMTTINELPSDIERVV 468


>UniRef50_A2EPG4 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 389

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 35/82 (42%), Positives = 53/82 (64%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++ + +E EEWK +TL D+Y +++I +AVIF N+  K +WL   M    FTV+ +HG M 
Sbjct: 229 QYVVRVENEEWKFDTLIDIYQSIAIEKAVIFVNSVEKGNWLKGKMVDSGFTVALVHGQMT 288

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  I  +FR+G +RVLI T
Sbjct: 289 MDDRAKITEEFRSGEARVLIAT 310



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           + +RGIDV+ V+ VIN+D     + Y                      E+D   L+ +E 
Sbjct: 312 VFSRGIDVRNVTLVINFDFALTCDVYLHRIGRSGRFGRKGLAITLCAGESDEMKLRKLEK 371

Query: 433 FYHTSIVEMPSDV 471
           ++ T I  +PSD+
Sbjct: 372 YFSTKIGPLPSDL 384


>UniRef50_Q4S6B9 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 9 SCAF14729, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 457

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 33/82 (40%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI    +E K   LC+LY  L+IAQ ++FC TRR   WL ESM      V  + G+M 
Sbjct: 278 QFYIMCGSKEEKFSALCNLYGCLTIAQTIVFCQTRRMASWLAESMTREGHQVGVLSGEMT 337

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ ++R G  +VL+TT
Sbjct: 338 VEQRAAVIERYREGKEKVLVTT 359


>UniRef50_A5BNE7 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 339

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 37/74 (50%), Positives = 51/74 (68%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           I ++ EE  LE +   +  +   ++VIF NTRRKVD  T+ +  RD TVSA HGDMDQ+ 
Sbjct: 149 ILVKREELTLEGIRQFHVNVE-RESVIFANTRRKVDCFTDQLRSRDHTVSATHGDMDQKT 207

Query: 197 REVIMRQFRTGSSR 238
           R++IMR+FR+GS R
Sbjct: 208 RDLIMREFRSGSMR 221


>UniRef50_Q9UHL0 Cluster: ATP-dependent RNA helicase DDX25; n=111;
           Eumetazoa|Rep: ATP-dependent RNA helicase DDX25 - Homo
           sapiens (Human)
          Length = 483

 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 32/82 (39%), Positives = 51/82 (62%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+  E  + K + LC++Y +++I QA+IFC TRR   WLT  M      VS + G++ 
Sbjct: 314 QYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELT 373

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  I+++FR G  +VLITT
Sbjct: 374 VEQRASIIQRFRDGKEKVLITT 395



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 6/75 (8%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNR------ENYXXXXXXXXXXXXXXXXXNFVTEADRRALKD 423
           ARGIDV+QV+ V+N+DLP  +      E Y                 N +   +  +L  
Sbjct: 399 ARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMK 458

Query: 424 IEDFYHTSIVEMPSD 468
           I+D +++SI ++ ++
Sbjct: 459 IQDHFNSSIKQLNAE 473


>UniRef50_A2SQE1 Cluster: DEAD/DEAH box helicase domain protein;
           n=6; cellular organisms|Rep: DEAD/DEAH box helicase
           domain protein - Methanocorpusculum labreanum (strain
           ATCC 43576 / DSM 4855 / Z)
          Length = 656

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 37/80 (46%), Positives = 50/80 (62%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           YI +  E  KLE LC   D  +   A++FCNT+R VD L   M  R + V A+HGDM Q+
Sbjct: 223 YIEVR-ERDKLEALCRTLDMNNPELALVFCNTKRTVDDLMSRMQARGYFVEALHGDMKQQ 281

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +R+ +M +FR+GS  VLI T
Sbjct: 282 QRDRVMARFRSGSIDVLIAT 301



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 21/67 (31%), Positives = 28/67 (41%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGIDV  V  V NYD+P + E Y                  FV   +   L+DI+ +  
Sbjct: 305 ARGIDVDDVDIVFNYDVPQDVEYYVHRIGRTARAGRTGKSVTFVAPREIYKLRDIQRYAK 364

Query: 442 TSIVEMP 462
             I + P
Sbjct: 365 IQIAKTP 371


>UniRef50_Q0AVQ9 Cluster: ATP-dependent RNA helicase; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           ATP-dependent RNA helicase - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 530

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 29/71 (40%), Positives = 44/71 (61%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+ETLC + D      ++IFC T+R  D L   +  R +   A+HGDM QRER+ +M  F
Sbjct: 228 KIETLCRIIDAQQPPISLIFCRTKRNADELARVLTSRGYNADALHGDMSQRERDHVMHGF 287

Query: 221 RTGSSRVLITT 253
           R G++++L+ T
Sbjct: 288 RQGNTKILVAT 298


>UniRef50_Q9KAA6 Cluster: ATP-dependent RNA helicase; n=5;
           Firmicutes|Rep: ATP-dependent RNA helicase - Bacillus
           halodurans
          Length = 539

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 31/82 (37%), Positives = 50/82 (60%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY  + LE  KL++LC + D+  I   ++FC T++ V  LTE++  R +    +HGD+ 
Sbjct: 220 QFYYKV-LERNKLDSLCRIIDSEQIDLGILFCRTKKGVAELTEALQARGYIADGLHGDLT 278

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +R+ +MR+FR  S   LI T
Sbjct: 279 QSQRDAVMRKFRDSSIEFLIAT 300



 Score = 39.5 bits (88), Expect = 0.080
 Identities = 23/63 (36%), Positives = 29/63 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGIDV  VS VINYD+P + E+Y                   VT  + + L+ IE    
Sbjct: 304 ARGIDVGNVSHVINYDIPQDPESYVHRIGRTGRAGRKGLALTLVTPREMKHLRSIEQEIK 363

Query: 442 TSI 450
            SI
Sbjct: 364 MSI 366


>UniRef50_Q22308 Cluster: Putative uncharacterized protein; n=7;
            Bilateria|Rep: Putative uncharacterized protein -
            Caenorhabditis elegans
          Length = 1022

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = +2

Query: 8    RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
            +FY+     + K   + +LY  L++A +VIFC+T+  V WL E+M  R   V  +HGDM 
Sbjct: 840  QFYVQCACRDSKYAAIVNLYSGLAVASSVIFCHTKASVMWLYENMRARGHQVDVLHGDMT 899

Query: 188  QREREVIMRQFRTGSSRVLITT 253
              ER   +  F+ G  +VLITT
Sbjct: 900  VVERADTIIHFKRGDFKVLITT 921



 Score = 35.9 bits (79), Expect = 0.99
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLP 315
           + ARGIDV QVS VINYDLP
Sbjct: 923 VFARGIDVAQVSVVINYDLP 942


>UniRef50_P96614 Cluster: DEAD-box ATP-dependent RNA helicase ydbR;
           n=90; Bacilli|Rep: DEAD-box ATP-dependent RNA helicase
           ydbR - Bacillus subtilis
          Length = 494

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 31/82 (37%), Positives = 52/82 (63%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ E  K +TL  L D  S   A++F  T+R+VD L E+++LR +    +HGD+ 
Sbjct: 218 QFYLEVQ-ERKKFDTLTRLLDIQSPELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLT 276

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +R V +R+F+ G+  VL+ T
Sbjct: 277 QAKRMVALRKFKEGAIEVLVAT 298



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 16/56 (28%), Positives = 27/56 (48%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARG+D+  V+ V N+D+P + E+Y                  F+T  ++  L+ IE
Sbjct: 302 ARGLDISGVTHVYNFDVPQDPESYVHRIGRTGRAGKTGMAMTFITPREKSMLRAIE 357


>UniRef50_Q5KBP5 Cluster: ATP-dependent RNA helicase DBP5; n=3;
           Filobasidiella neoformans|Rep: ATP-dependent RNA
           helicase DBP5 - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 546

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 30/82 (36%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           + Y+  + E+ K E L  LYD L I Q+++FC  +   D + E +      V+++HGD  
Sbjct: 364 QLYLECDSEDQKYEALSALYDCLVIGQSIVFCKRKVTADHIAERLISEGHAVASLHGDKL 423

Query: 188 QREREVIMRQFRTGSSRVLITT 253
            +ER+ I+  FR G ++VLITT
Sbjct: 424 SQERDAILDGFRNGETKVLITT 445


>UniRef50_Q2NEZ7 Cluster: Predicted helicase; n=6; cellular
           organisms|Rep: Predicted helicase - Methanosphaera
           stadtmanae (strain DSM 3091)
          Length = 583

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 27/74 (36%), Positives = 45/74 (60%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E+ KLE L  L D      +++FCNT+RKVD L   + +R +    +HGD+ Q +R+ +M
Sbjct: 227 EDMKLELLSRLLDLHDFDLSLVFCNTKRKVDKLVSHLQIRGYLADGLHGDLTQNQRDRVM 286

Query: 212 RQFRTGSSRVLITT 253
            +F+ G+  +L+ T
Sbjct: 287 SKFKKGNIEILVAT 300



 Score = 39.5 bits (88), Expect = 0.080
 Identities = 21/67 (31%), Positives = 32/67 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGIDV  V  V N+D+P++ E Y                 +FV+  +   L+DI+ +  
Sbjct: 304 ARGIDVGGVEAVFNFDIPNDNEYYVHRIGRTGRAGKTGKAYSFVSGREIYQLRDIQRYAK 363

Query: 442 TSIVEMP 462
           T I + P
Sbjct: 364 TKIEQAP 370


>UniRef50_Q81VG0 Cluster: DEAD-box ATP-dependent RNA helicase ydbR;
           n=16; cellular organisms|Rep: DEAD-box ATP-dependent RNA
           helicase ydbR - Bacillus anthracis
          Length = 528

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/82 (36%), Positives = 53/82 (64%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ E+ K + L  L D  S   A++F  T+R+VD L+E+++LR +    +HGD+ 
Sbjct: 217 QFYLEVQ-EKKKFDVLTRLLDIQSPELAIVFGRTKRRVDELSEALNLRGYAAEGIHGDLT 275

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +R  ++R+F+ GS  VL+ T
Sbjct: 276 QAKRMSVLRKFKEGSIEVLVAT 297



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 18/56 (32%), Positives = 27/56 (48%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARG+D+  V+ V N+D+P + E+Y                  FVT  +   LK+IE
Sbjct: 301 ARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKKGIAMLFVTPRESGQLKNIE 356


>UniRef50_Q8XKJ8 Cluster: ATP-dependent RNA helicase; n=12;
           Clostridium|Rep: ATP-dependent RNA helicase -
           Clostridium perfringens
          Length = 528

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 32/82 (39%), Positives = 46/82 (56%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY  I+  + + ETLC + D      A+IFC T++ VD + E M  R + V  MHGDM 
Sbjct: 222 QFYFEIKHRD-RFETLCRVLDFDEPNAAIIFCKTKKGVDEVVEKMQARGYMVEGMHGDMS 280

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q  R   +R+F+ GS   L+ T
Sbjct: 281 QNHRLQTLRKFKEGSLDFLVAT 302



 Score = 41.1 bits (92), Expect = 0.026
 Identities = 22/64 (34%), Positives = 31/64 (48%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGIDV+ V+ VINYDLP + E+Y                 + VT  +   LK I+    
Sbjct: 306 ARGIDVESVTHVINYDLPQDNESYVHRIGRTGRANREGVAYSLVTPKEYMMLKQIQKHTK 365

Query: 442 TSIV 453
           + I+
Sbjct: 366 SKII 369


>UniRef50_Q8EZ11 Cluster: ATP-dependent RNA helicase; n=4;
           Leptospira|Rep: ATP-dependent RNA helicase - Leptospira
           interrogans
          Length = 521

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 29/82 (35%), Positives = 50/82 (60%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           + Y  I+ E  K E L  L +  ++  A++FCNT+ +VD + E +  R +   A+HGD++
Sbjct: 225 QIYYEIQ-ENAKGEALARLIEYRNVKLALVFCNTKAQVDTVVELLKSRGYFAEALHGDLN 283

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q++R+ +M  FR GS  +L+ T
Sbjct: 284 QKQRDKVMSGFRKGSIEILVAT 305



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 14/23 (60%), Positives = 16/23 (69%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENY 333
           RGIDV  V  V NYDLP + E+Y
Sbjct: 310 RGIDVNNVEAVFNYDLPRDGEDY 332


>UniRef50_Q3AFI3 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=1; Carboxydothermus hydrogenoformans
           Z-2901|Rep: ATP-dependent RNA helicase, DEAD box family
           - Carboxydothermus hydrogenoformans (strain Z-2901 / DSM
           6008)
          Length = 430

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 25/74 (33%), Positives = 45/74 (60%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  K+E L  + ++    QA++FC T+++VD + E ++ R +    +HGDM QRER   +
Sbjct: 223 ETEKIEGLVSILNSELPIQAIVFCRTKKRVDEVVEQLNFRGYAAKGLHGDMSQRERTQTI 282

Query: 212 RQFRTGSSRVLITT 253
           + F+ G + +L+ T
Sbjct: 283 KSFKAGKTELLVAT 296



 Score = 39.5 bits (88), Expect = 0.080
 Identities = 19/57 (33%), Positives = 28/57 (49%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           ARG+D+  VS VIN+D+P N E+Y                   +   +R+ LK IE+
Sbjct: 300 ARGLDIPDVSHVINFDIPQNPESYIHRIGRTGRAGREGKAITLINYRERKLLKAIEE 356


>UniRef50_A4RIF1 Cluster: ATP-dependent RNA helicase DBP5; n=7;
           Ascomycota|Rep: ATP-dependent RNA helicase DBP5 -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 504

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 30/71 (42%), Positives = 41/71 (57%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E LC LY  ++I  +VIF  TR   D +   M      VSA+HG    +ER+ ++  F
Sbjct: 323 KYEVLCKLYGLMTIGSSVIFVKTRESADEIQRRMEADGHKVSALHGAFQGQERDQLLDDF 382

Query: 221 RTGSSRVLITT 253
           R+G S+VLITT
Sbjct: 383 RSGKSKVLITT 393



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 15/20 (75%), Positives = 17/20 (85%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLP 315
           +LARGIDV  VS VINYD+P
Sbjct: 395 VLARGIDVSSVSMVINYDIP 414


>UniRef50_A6NSW7 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 400

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 31/82 (37%), Positives = 46/82 (56%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++ I +E    KLET+  L       +A+ FCNT+   D L+  + +R  T  A+HGD+ 
Sbjct: 228 QYRIDLEGRGDKLETMVALLTHGGYERAIAFCNTKNMTDRLSGLLQMRGITAQAIHGDIQ 287

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR RE  ++ FR G  RVL+ T
Sbjct: 288 QRIREKTLQAFREGKMRVLVAT 309


>UniRef50_Q8SSD2 Cluster: ATP-DEPENDENT RNA HELICASE INVOLVED IN
           mRNA EXPORT FROM THE NUCLEUS; n=1; Encephalitozoon
           cuniculi|Rep: ATP-DEPENDENT RNA HELICASE INVOLVED IN
           mRNA EXPORT FROM THE NUCLEUS - Encephalitozoon cuniculi
          Length = 425

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 32/81 (39%), Positives = 50/81 (61%)
 Frame = +2

Query: 11  FYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQ 190
           FYI  E E  K   L  LY+ LSI+Q +IF +T+  V++L + +     +VS +HGD++ 
Sbjct: 259 FYIEAEGEN-KRRALKSLYEYLSISQMIIFVSTKATVNYLRKKLEDDLHSVSCLHGDLEI 317

Query: 191 REREVIMRQFRTGSSRVLITT 253
            ERE  +  FR+  S++L+TT
Sbjct: 318 EEREKAVGDFRSSKSKILLTT 338


>UniRef50_Q6D2K3 Cluster: ATP-independent RNA helicase; n=6;
           Proteobacteria|Rep: ATP-independent RNA helicase -
           Erwinia carotovora subsp. atroseptica (Pectobacterium
           atrosepticum)
          Length = 460

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 29/82 (35%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           RFY   +  + +L  L  +      A  V+FCNT+R    + E++ +R  +VSA+HGD++
Sbjct: 220 RFYETTK--DQRLPLLIAILSHYQPASCVVFCNTKRDCQSVFEALEMRGISVSALHGDLE 277

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+R+ ++ +F   S RVL+ T
Sbjct: 278 QRDRDQVLVRFSNRSCRVLVAT 299


>UniRef50_Q014T4 Cluster: Chromosome 07 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 07 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 506

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 29/81 (35%), Positives = 45/81 (55%)
 Frame = -1

Query: 253 SGDQDTRRASTKLPHDHFTLTLIHVSMHSRYSKVTQMHRFSEPIHLATGVAENYSLCNRQ 74
           SGDQ T RA  +L HD  T  LIH+++     ++   H   EP++L T V E+  L N +
Sbjct: 118 SGDQHTGRAGAELAHDDVTGVLIHITVRGGDGEIAGTHVVREPVNLTTSVREDNGLRNGE 177

Query: 73  CIIQVTQSFQLPFF*FNCNVK 11
             +Q+ +  QLP F  + +V+
Sbjct: 178 RFVQIAERVQLPLFLVDVDVE 198



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/75 (33%), Positives = 40/75 (53%)
 Frame = -2

Query: 489 ALDEVGHITGHFNDTSVVEVLNILQCSPVSFSHKVDXXXXXXXXXXXXNPVNIIFTVGWQ 310
           ALDE+  + G F D  +VE L++L+ + V   +KVD            + V ++F +  Q
Sbjct: 39  ALDEISDVGGKFLDDRLVETLDVLEEAFVVGGNKVDGDTLTTETAGTTDTVKVVFGLRGQ 98

Query: 309 IIVDDAGNLLYINTT 265
           + VD   NLL ++TT
Sbjct: 99  VKVDHQRNLLDVDTT 113


>UniRef50_Q5L3G9 Cluster: DEAD-box ATP-dependent RNA helicase ydbR;
           n=7; Bacteria|Rep: DEAD-box ATP-dependent RNA helicase
           ydbR - Geobacillus kaustophilus
          Length = 467

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 26/82 (31%), Positives = 51/82 (62%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ +  E+ K + L  L D  +   A++F  T+R+VD L E+++LR +    +HGD+ 
Sbjct: 217 QYYLEVH-EKKKFDILTRLLDIQAPELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLS 275

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +R  ++R+F+ G+  +L+ T
Sbjct: 276 QAKRLSVLRKFKEGAIEILVAT 297


>UniRef50_A6Q8Y9 Cluster: ATP-dependent RNA helicase, DEAD-box
           family; n=6; Bacteria|Rep: ATP-dependent RNA helicase,
           DEAD-box family - Sulfurovum sp. (strain NBC37-1)
          Length = 492

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 27/83 (32%), Positives = 49/83 (59%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T++Y  ++  E + + L  L D  +  + +IFC  +++VD L   +  + F VS +HGDM
Sbjct: 212 TQYYYVVQERE-RDDALVRLIDYKNPEKCIIFCRMKKEVDRLVAHLTAQGFKVSGLHGDM 270

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
           +Q++REV +R F+ G   + + T
Sbjct: 271 EQKQREVTIRAFKQGGIDIFVAT 293


>UniRef50_P19109 Cluster: ATP-dependent RNA helicase p62; n=9;
           Eukaryota|Rep: ATP-dependent RNA helicase p62 -
           Drosophila melanogaster (Fruit fly)
          Length = 719

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLC-DLYDTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E KL+TL  D+YDT  S  + +IF  T+R+VD L   +        A+HGD  Q ER+ 
Sbjct: 512 KEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDF 571

Query: 206 IMRQFRTGSSRVLITT 253
           ++R+FR+G S +L+ T
Sbjct: 572 VLREFRSGKSNILVAT 587



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 20/73 (27%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VIN+D P N E+Y                  F T+ + +  K + D   
Sbjct: 591 ARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 650

Query: 442 TSIVEMPSDVANL 480
            +  E+   + NL
Sbjct: 651 EANQEINPALENL 663


>UniRef50_O83749 Cluster: ATP-dependent RNA helicase; n=2;
           Treponema|Rep: ATP-dependent RNA helicase - Treponema
           pallidum
          Length = 649

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 26/71 (36%), Positives = 43/71 (60%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+E L  L D       ++FC T+   D + +S+  R + V+A+HGD+ Q +RE I+ +F
Sbjct: 272 KIEALVRLIDVSDNFYGLVFCQTKADADTVAKSLDERHYHVAALHGDIPQSQREKILERF 331

Query: 221 RTGSSRVLITT 253
           RT  +R+L+ T
Sbjct: 332 RTKRARILVAT 342


>UniRef50_Q7QNT5 Cluster: GLP_88_2286_3572; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_88_2286_3572 - Giardia lamblia ATCC
           50803
          Length = 428

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 26/76 (34%), Positives = 43/76 (56%)
 Frame = +2

Query: 26  ELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           E+   K+  L  L +++ I Q VIFCN++  VDWL  ++  +      +H D+   +RE 
Sbjct: 284 EIYAEKVRVLSSLLESVPIVQGVIFCNSKHTVDWLHNALRKQKHPCERIHADLPAFDRET 343

Query: 206 IMRQFRTGSSRVLITT 253
            +  FR G +R+LI+T
Sbjct: 344 TVANFRAGKTRLLIST 359



 Score = 36.7 bits (81), Expect = 0.57
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           LLARG DVQQV+ V NYD P +  +Y
Sbjct: 361 LLARGFDVQQVTFVCNYDFPRDPHSY 386


>UniRef50_UPI00005A557C Cluster: PREDICTED: similar to eukaryotic
           translation initiation factor 4A, isoform 1; n=1; Canis
           lupus familiaris|Rep: PREDICTED: similar to eukaryotic
           translation initiation factor 4A, isoform 1 - Canis
           familiaris
          Length = 430

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 32/75 (42%), Positives = 41/75 (54%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFY 438
           LA+G DVQQVS +I Y+LP+  +                   N VTE DRR  +DIE FY
Sbjct: 322 LAKGYDVQQVSFIIIYELPTKGKTISADLVVVKRHGCNSLATNMVTEEDRRTPRDIEAFY 381

Query: 439 HTSIVEMPSDVANLI 483
            T + E P +VA+LI
Sbjct: 382 GTFLEEKPLNVADLI 396



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 25/43 (58%), Positives = 32/43 (74%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMH 145
           I +E E+WKL+  CDLY+TL +A AV F N+R+KVDWL  S H
Sbjct: 267 INMEREKWKLDPSCDLYETLIMAPAVRFINSRKKVDWLIFSFH 309


>UniRef50_Q0RTL3 Cluster: Cold-shock DeaD box ATP-dependent RNA
           helicase; n=2; Bacteria|Rep: Cold-shock DeaD box
           ATP-dependent RNA helicase - Frankia alni (strain
           ACN14a)
          Length = 608

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 25/72 (34%), Positives = 43/72 (59%)
 Frame = +2

Query: 38  WKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           +K   L  + D  S   A++FC TR +VD L +S++ R +   ++HG M Q +RE +M +
Sbjct: 287 YKTAALGRILDVESPRSAIVFCRTREEVDQLADSLNGRGYRAESLHGGMSQEQRERVMER 346

Query: 218 FRTGSSRVLITT 253
            RT ++ +L+ T
Sbjct: 347 LRTATADLLVAT 358



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 1/74 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D +Q++ V+NY +PS  ++Y                       + R LK IE    
Sbjct: 362 ARGLDFEQLTHVVNYSVPSAPDSYVHRIGRVGRAGREGVAITLAEPREHRMLKTIERVTR 421

Query: 442 TSI-VEMPSDVANL 480
             I VE    VA+L
Sbjct: 422 QRIAVEKVPTVADL 435


>UniRef50_A4V6K5 Cluster: DEAD box polypeptide 19 protein; n=3;
           Platyhelminthes|Rep: DEAD box polypeptide 19 protein -
           Dugesia japonica (Planarian)
          Length = 434

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 29/82 (35%), Positives = 46/82 (56%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI ++  E K   L D+Y   S+ Q +IFC +R+   +L +++       S + G++D
Sbjct: 268 QFYIQMKSSEDKYPKLIDIYGMKSMGQCIIFCESRKMACYLQKALERDSHLSSLLTGELD 327

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             ER+  +  FR G SRVLI T
Sbjct: 328 VLERQRQIDDFRNGKSRVLIAT 349


>UniRef50_Q11UP8 Cluster: ATP-dependent RNA helicase; n=1; Cytophaga
           hutchinsonii ATCC 33406|Rep: ATP-dependent RNA helicase
           - Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB
           9469)
          Length = 580

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 26/82 (31%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY  ++  + K E +  + D  ++   +IFCNT+RKV+ +T+ +        ++HGD  
Sbjct: 217 QFYYLVKNSQ-KTEIVTQIIDLNNLQLMLIFCNTKRKVEEVTDELKAYGHNPISLHGDKT 275

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+R  +M +FR G + +L+ T
Sbjct: 276 QRDRTEVMSKFRKGLANILVAT 297



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 23/63 (36%), Positives = 30/63 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGIDV  V  VINYD+P + ENY                   VT  ++  L+DIE +  
Sbjct: 301 ARGIDVTGVDAVINYDVPLDIENYVHRIGRTGRAGQLGKSFTLVTSDEKYKLRDIERYTK 360

Query: 442 TSI 450
            +I
Sbjct: 361 ATI 363


>UniRef50_A0RP33 Cluster: Putative ATP-dependent RNA helicase RhlE;
           n=1; Campylobacter fetus subsp. fetus 82-40|Rep:
           Putative ATP-dependent RNA helicase RhlE - Campylobacter
           fetus subsp. fetus (strain 82-40)
          Length = 624

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 24/71 (33%), Positives = 43/71 (60%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+E L +++   SI QA++F  T+R  D  +  +H   F+V+A+HGD  Q  R   + +F
Sbjct: 231 KMELLNEVFGVESIDQALVFTRTKRSADKCSSYLHTLGFSVAALHGDKSQSVRSKTLEKF 290

Query: 221 RTGSSRVLITT 253
           + G +++L+ T
Sbjct: 291 KNGKTKILVAT 301


>UniRef50_Q6YPL1 Cluster: Superfamily II DNA and RNA helicase; n=3;
           Candidatus Phytoplasma|Rep: Superfamily II DNA and RNA
           helicase - Onion yellows phytoplasma
          Length = 552

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 27/81 (33%), Positives = 47/81 (58%)
 Frame = +2

Query: 11  FYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQ 190
           +++  E+++ KL  L  L D      A++F NT++ VD +T  +  + F   A+HGD+ Q
Sbjct: 221 YFLVKEVDKAKL--LVRLLDLKKDYSAILFANTKKDVDEITAYLQDKGFLADAVHGDLKQ 278

Query: 191 REREVIMRQFRTGSSRVLITT 253
            +R+ +M  FR G  ++LI T
Sbjct: 279 NQRQYVMNNFRKGKIKILIAT 299



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  +  VINYDLP   E Y
Sbjct: 303 ARGLDISDIKMVINYDLPHEDEVY 326


>UniRef50_O26305 Cluster: ATP-dependent RNA helicase, eIF-4A family;
           n=1; Methanothermobacter thermautotrophicus str. Delta
           H|Rep: ATP-dependent RNA helicase, eIF-4A family -
           Methanobacterium thermoautotrophicum
          Length = 425

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 26/74 (35%), Positives = 44/74 (59%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           EE K+E L  +  + +I   +IFCNT+R+V  L   ++   ++   +HGD+ Q +RE +M
Sbjct: 223 EEDKVELLDWILSSNNIRMGLIFCNTKRRVQRLRRQLNRMGYSADEIHGDLSQSKRERVM 282

Query: 212 RQFRTGSSRVLITT 253
            +FR G   +L+ T
Sbjct: 283 ERFRRGDFSLLVAT 296



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 25/80 (31%), Positives = 32/80 (40%), Gaps = 2/80 (2%)
 Frame = +1

Query: 232 FSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRR 411
           FS L    + ARGI V  V  V+NYDLP   E Y                   V  ++  
Sbjct: 290 FSLLVATDVAARGIHVPDVEAVVNYDLPFENEYYVHRIGRTGRAGSSGKSFTLVVGSEVH 349

Query: 412 ALKDIEDFYHTSIVE--MPS 465
            L+ I+ F    I +  MPS
Sbjct: 350 RLRRIQSFTGKRIKQSNMPS 369


>UniRef50_Q67NW1 Cluster: ATP-dependent RNA helicase; n=5;
           Firmicutes|Rep: ATP-dependent RNA helicase -
           Symbiobacterium thermophilum
          Length = 526

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 23/72 (31%), Positives = 42/72 (58%)
 Frame = +2

Query: 38  WKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           +K E L  + D  ++ + + FC T++ VD L E++  R +    +HGDM+Q +R  +M +
Sbjct: 230 FKTEALTRILDIENVERGICFCRTKKGVDELVEALQARGYQAEGIHGDMNQAQRNRVMSR 289

Query: 218 FRTGSSRVLITT 253
           F+ G   +L+ T
Sbjct: 290 FKEGYIELLVAT 301



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V+ V NYD+P + E+Y
Sbjct: 305 ARGLDISDVTHVFNYDIPQDPESY 328


>UniRef50_Q1VPX9 Cluster: ATP-independent RNA helicase; n=9;
           Bacteroidetes|Rep: ATP-independent RNA helicase -
           Psychroflexus torquis ATCC 700755
          Length = 443

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 25/71 (35%), Positives = 45/71 (63%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           KL+TL DL   L  A  ++FCN R  +D ++  ++ ++ + +   G M+Q++RE  + +F
Sbjct: 217 KLKTLVDLVHHLGNAPGIVFCNLRDSIDEVSSYLNRQNISHACFSGVMEQKDRERALIKF 276

Query: 221 RTGSSRVLITT 253
           R GSS++L+ T
Sbjct: 277 RNGSSQILVAT 287


>UniRef50_Q725W5 Cluster: ATP-dependent RNA helicase, DEAD/DEAH
           family; n=2; Desulfovibrio vulgaris subsp. vulgaris|Rep:
           ATP-dependent RNA helicase, DEAD/DEAH family -
           Desulfovibrio vulgaris (strain Hildenborough / ATCC
           29579 / NCIMB8303)
          Length = 532

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 23/71 (32%), Positives = 43/71 (60%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           +++ +C ++D     +A++F  T++ VD L  ++  R     A+HGD++Q +RE +M +F
Sbjct: 231 RVDAVCRIFDAYIPRKAIVFRATKQGVDELAAALQQRGILADALHGDLNQTQRERVMSRF 290

Query: 221 RTGSSRVLITT 253
           R G   VL+ T
Sbjct: 291 RAGGISVLVAT 301



 Score = 36.7 bits (81), Expect = 0.57
 Identities = 19/56 (33%), Positives = 26/56 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARG+DV  V  VIN+DLP++ E Y                 +F    D   L+DI+
Sbjct: 305 ARGLDVDDVDTVINFDLPNDPETYVHRIGRTGRAGRTGRAFSFAAGRDVYKLRDIQ 360


>UniRef50_P20449 Cluster: ATP-dependent RNA helicase DBP5; n=23;
           Dikarya|Rep: ATP-dependent RNA helicase DBP5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 482

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 27/82 (32%), Positives = 47/82 (57%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           + Y+  + E  K + L +LY  ++I  ++IF  T++  + L   +      VS +HGD+ 
Sbjct: 306 QLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQ 365

Query: 188 QREREVIMRQFRTGSSRVLITT 253
            +ER+ ++  FR G S+VLITT
Sbjct: 366 TQERDRLIDDFREGRSKVLITT 387



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 14/21 (66%), Positives = 18/21 (85%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPS 318
           +LARGID+  VS V+NYDLP+
Sbjct: 389 VLARGIDIPTVSMVVNYDLPT 409


>UniRef50_Q6MN67 Cluster: ATP-dependent RNA helicase; n=3;
           Deltaproteobacteria|Rep: ATP-dependent RNA helicase -
           Bdellovibrio bacteriovorus
          Length = 505

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/54 (42%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IFCNT+  V  + E ++        +HGDM+QRER+ +M  FR GS R+L+ T
Sbjct: 288 IIFCNTKNAVAEIAERLNDLGAASGCLHGDMEQRERDRVMAMFRNGSHRILVAT 341


>UniRef50_P39517 Cluster: ATP-dependent RNA helicase DHH1; n=103;
           Eukaryota|Rep: ATP-dependent RNA helicase DHH1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 506

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/81 (34%), Positives = 44/81 (54%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T++Y  +E E  KL  L  L+  L I QA+IFCN+  +V+ L + +    ++    H  M
Sbjct: 259 TQYYAFVE-ERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARM 317

Query: 185 DQREREVIMRQFRTGSSRVLI 247
            Q+ER  +  +FR G  R L+
Sbjct: 318 KQQERNKVFHEFRQGKVRTLV 338



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/72 (33%), Positives = 31/72 (43%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LL RGID+Q V+ VIN+D P   E Y                 N +   DR  L  IE  
Sbjct: 342 LLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQE 401

Query: 436 YHTSIVEMPSDV 471
             T I  +P+ +
Sbjct: 402 LGTEIAAIPATI 413


>UniRef50_Q5CIF9 Cluster: DEAD-box RNA helicase; n=2;
           Cryptosporidium|Rep: DEAD-box RNA helicase -
           Cryptosporidium hominis
          Length = 518

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 7/89 (7%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHG--- 178
           +FY+    +  KL  L DLY  +SI Q++IF NTR+    + E+M      +S + G   
Sbjct: 326 QFYVICNDDADKLSFLSDLYACMSIGQSIIFVNTRKTAFSIAENMRRDGHAISVICGTQT 385

Query: 179 ----DMDQREREVIMRQFRTGSSRVLITT 253
                MD   R+ +M  FR+G S+VLI T
Sbjct: 386 NSGEKMDHEIRDQVMDSFRSGESKVLIAT 414



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 13/20 (65%), Positives = 18/20 (90%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLP 315
           +L+RGIDV QV+ VIN+D+P
Sbjct: 416 VLSRGIDVPQVTLVINFDIP 435


>UniRef50_Q2FKY7 Cluster: DEAD/DEAH box helicase-like; n=1;
           Methanospirillum hungatei JF-1|Rep: DEAD/DEAH box
           helicase-like - Methanospirillum hungatei (strain JF-1 /
           DSM 864)
          Length = 531

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 26/82 (31%), Positives = 44/82 (53%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++YI +  E  K +TL  + +     + +IFCNT+  VD ++ ++    F    +HG M 
Sbjct: 220 QYYIEVR-EPAKADTLIRVLEFYQPQRTIIFCNTQIAVDAVSSALKAEGFLADGLHGGMA 278

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +R+ +M  FR G   +LI T
Sbjct: 279 QAQRDKVMNAFRKGQLEILIAT 300



 Score = 36.7 bits (81), Expect = 0.57
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARGIDV+++  V N+D P + E Y                 +FV+  +R  L+D+
Sbjct: 304 ARGIDVEEIDLVCNFDFPQDDEYYVHRIGRTARAGRTGRAISFVSPRERYRLRDV 358


>UniRef50_Q89M45 Cluster: ATP-dependent RNA helicase; n=29; cellular
           organisms|Rep: ATP-dependent RNA helicase -
           Bradyrhizobium japonicum
          Length = 500

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 24/64 (37%), Positives = 38/64 (59%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           L +   +  A+IFCN +R+V  + +S+    F+V A+HGDMDQ  R   + QFR G   +
Sbjct: 239 LREAKDLKNAIIFCNRKREVAIVHKSLQKHGFSVGALHGDMDQPARMAALEQFRKGELPL 298

Query: 242 LITT 253
           L+ +
Sbjct: 299 LVAS 302



 Score = 36.3 bits (80), Expect = 0.75
 Identities = 19/69 (27%), Positives = 32/69 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+ +VS V N+D+P + ++Y                 + VT  D++++  IE    
Sbjct: 306 ARGLDIPEVSHVFNFDVPHHPDDYVHRVGRTGRAGRSGTAISIVTPLDQKSMVAIEKLIG 365

Query: 442 TSIVEMPSD 468
            SI     D
Sbjct: 366 QSIPRAEGD 374


>UniRef50_Q2J6D3 Cluster: DEAD/DEAH box helicase-like; n=2;
           Frankia|Rep: DEAD/DEAH box helicase-like - Frankia sp.
           (strain CcI3)
          Length = 649

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 26/71 (36%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+E L  +        A++F  TRR  D + E +  R F  +A+HGD+ Q +RE  +R F
Sbjct: 316 KMEVLARVLQAGGRGLAMVFVRTRRTADKVAEDLAKRGFAAAAVHGDLGQGQREQALRAF 375

Query: 221 RTGSSRVLITT 253
           R+G   VL+ T
Sbjct: 376 RSGKVDVLVAT 386


>UniRef50_O66866 Cluster: ATP-dependent RNA helicase DeaD; n=1;
           Aquifex aeolicus|Rep: ATP-dependent RNA helicase DeaD -
           Aquifex aeolicus
          Length = 293

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+E L D+    +  + ++F N +R   +L E +  + F V A+HGD+ QR RE I+++F
Sbjct: 195 KIELLEDVLRDFN--KVIVFVNRKRDAKFLGEKLSTKGFRVGALHGDLPQRRREEILKKF 252

Query: 221 RTGSSRVLITT 253
           R G   VL+ T
Sbjct: 253 RRGFINVLVAT 263


>UniRef50_A6TUK6 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Firmicutes|Rep: DEAD/DEAH box helicase domain
           protein - Alkaliphilus metalliredigens QYMF
          Length = 484

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 23/71 (32%), Positives = 43/71 (60%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K++ L D+    +    +IFCNT+++VD + + +   ++T   +HG M+QR+R  +M +F
Sbjct: 229 KMKLLSDITIVENPDSCIIFCNTKQRVDEVNDELIRLNYTCEKIHGGMEQRDRVRVMNEF 288

Query: 221 RTGSSRVLITT 253
           + G  R L+ T
Sbjct: 289 KQGYFRYLVAT 299



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/58 (36%), Positives = 31/58 (53%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           ARGID+  +S VINYD+P ++E+Y                  FVT+ + + LKDI  +
Sbjct: 303 ARGIDIDNISLVINYDIPQDKESYVHRIGRTGRISREGRAITFVTQYEDKFLKDIHRY 360


>UniRef50_UPI0000499A01 Cluster: DEAD/DEAH box helicase; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: DEAD/DEAH box
           helicase - Entamoeba histolytica HM-1:IMSS
          Length = 684

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/56 (41%), Positives = 36/56 (64%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q V+FC TR +V++L E + + D   S M G  DQ+ERE+ +++FR   + VL+ T
Sbjct: 256 QTVVFCATRHEVEYLNEILKIFDIKTSIMFGKADQQEREINLKKFRKQETHVLLVT 311


>UniRef50_A6TTG0 Cluster: DEAD/DEAH box helicase domain protein;
           n=3; Clostridiaceae|Rep: DEAD/DEAH box helicase domain
           protein - Alkaliphilus metalliredigens QYMF
          Length = 549

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/71 (32%), Positives = 40/71 (56%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + LC L+D  +   A+IFC T+R+   L E++    +    +HGD+ Q +RE +M+ F
Sbjct: 228 KQDLLCQLFDEYNPFMAIIFCRTKRRAIALNEALINLGYNSDELHGDLTQAKREKVMKAF 287

Query: 221 RTGSSRVLITT 253
           +    + L+ T
Sbjct: 288 KKSKIQYLVAT 298



 Score = 39.5 bits (88), Expect = 0.080
 Identities = 19/56 (33%), Positives = 28/56 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARG+D++ V+ + NYD+P + E+Y                  F+T  DR  LK IE
Sbjct: 302 ARGLDIEGVTHIFNYDIPQDGESYIHRIGRTGRAGETGMAITFMTSRDRDELKIIE 357


>UniRef50_Q5CNJ7 Cluster: Similar to RNA-dependent helicase p68;
           n=2; Cryptosporidium|Rep: Similar to RNA-dependent
           helicase p68 - Cryptosporidium hominis
          Length = 406

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/59 (38%), Positives = 36/59 (61%)
 Frame = +2

Query: 77  SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           S  + +IFC T+R  D LT+ + L  +    +HGD  Q ER  ++ +FRTG+S ++I T
Sbjct: 236 SAPKVLIFCETKRGADILTKELRLDGWPALCIHGDKKQEERTWVLNEFRTGASPIMIAT 294


>UniRef50_Q5JKF2 Cluster: DEAD-box ATP-dependent RNA helicase 40;
           n=8; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 40 - Oryza sativa subsp. japonica (Rice)
          Length = 792

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 24/57 (42%), Positives = 36/57 (63%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC T+R  D L  ++  R F  SA+HGD  Q ERE ++  FR+G S +L+ T
Sbjct: 396 SKVLIFCTTKRMCDQLARTL-TRQFGASAIHGDKSQSEREKVLSHFRSGRSPILVAT 451



 Score = 37.1 bits (82), Expect = 0.43
 Identities = 18/73 (24%), Positives = 32/73 (43%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D++ +  VINYD P+  E+Y                  F  + D +   D+     
Sbjct: 455 ARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGVAYTFFCDQDSKYAADLIKILE 514

Query: 442 TSIVEMPSDVANL 480
            +   +P D+A++
Sbjct: 515 GANQRVPRDLADM 527


>UniRef50_UPI0000E495C3 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 209

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 24/26 (92%), Positives = 25/26 (96%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           LLARGIDVQQVS VINYDLP+NRENY
Sbjct: 130 LLARGIDVQQVSLVINYDLPTNRENY 155



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 21/27 (77%), Positives = 25/27 (92%)
 Frame = +2

Query: 173 HGDMDQREREVIMRQFRTGSSRVLITT 253
           HGDMDQ+ER+ IM++FRTGSSRVLI T
Sbjct: 102 HGDMDQKERDKIMKEFRTGSSRVLICT 128


>UniRef50_Q7MT81 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=9; Bacteroidales|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Porphyromonas
           gingivalis (Bacteroides gingivalis)
          Length = 427

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 26/74 (35%), Positives = 42/74 (56%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  KL  L  L++  +  + +IF + + KV  LT ++    F V+ MH D++Q +RE +M
Sbjct: 228 EAQKLPILRKLFEQSAPKRTIIFASAKLKVRELTSTLRKMGFNVADMHSDLEQSQREQVM 287

Query: 212 RQFRTGSSRVLITT 253
           R F+ G   VL+ T
Sbjct: 288 RDFKNGYVDVLVAT 301



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY-XXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           ++ARGID+  +  VINYD+P + E+Y                   FV+E ++     IE 
Sbjct: 303 IVARGIDIDNIRVVINYDIPHDPEDYVHRIGRTARGTNGEGLAITFVSEEEQSDFHKIET 362

Query: 433 FYHTSIVEMPSDV 471
           F   S+ ++P D+
Sbjct: 363 FLGKSVYKLPVDL 375


>UniRef50_Q5QWG1 Cluster: ATP-dependent RNA helicase; n=1;
           Idiomarina loihiensis|Rep: ATP-dependent RNA helicase -
           Idiomarina loihiensis
          Length = 474

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 21/54 (38%), Positives = 38/54 (70%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++FCNT+ +V  +  ++    F+V A+HG+++Q++R+  + QF  GS+RVLI T
Sbjct: 263 LVFCNTKNEVKDIFNTLRANKFSVLALHGELEQKDRDQAIIQFSNGSARVLIAT 316


>UniRef50_A3J7I3 Cluster: ATP-independent RNA helicase; n=5;
           Bacteroidetes|Rep: ATP-independent RNA helicase -
           Flavobacteria bacterium BAL38
          Length = 463

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 28/71 (39%), Positives = 41/71 (57%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+E+L  L  +L+   A+IFCN R  V+ + + +  +    +  HG +DQ ERE  + QF
Sbjct: 217 KIESLFQLICSLNSEAAIIFCNHREAVERIHDMLTEKGIISTFYHGGLDQDERERALIQF 276

Query: 221 RTGSSRVLITT 253
           R GS   LITT
Sbjct: 277 RNGSVSYLITT 287


>UniRef50_A0RUV7 Cluster: Superfamily II helicase; n=3;
           Thermoprotei|Rep: Superfamily II helicase - Cenarchaeum
           symbiosum
          Length = 434

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 25/80 (31%), Positives = 43/80 (53%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           Y+ I   E K++ L D        Q ++FC+T+ +   +   +H R++   A+ GDM Q 
Sbjct: 218 YLVIRDRE-KMDYLVDFIKENGKGQTIVFCSTKYRTRDVARMLHKRNYGAVAIEGDMSQH 276

Query: 194 EREVIMRQFRTGSSRVLITT 253
            RE  M +FRT  +++L+ T
Sbjct: 277 RREQSMSRFRTAKAQILVAT 296


>UniRef50_Q8A8L3 Cluster: ATP-independent RNA helicase; n=7;
           Bacteroidales|Rep: ATP-independent RNA helicase -
           Bacteroides thetaiotaomicron
          Length = 444

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 25/71 (35%), Positives = 42/71 (59%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K++TL +L  +L  + +++FCN R  VD + + +  +       HG M+Q +RE  + +F
Sbjct: 221 KIDTLYNLLCSLGSSSSIVFCNHRDAVDRVHKLLEDKKLLAERFHGGMEQPDRERALYKF 280

Query: 221 RTGSSRVLITT 253
           R GS  VLI+T
Sbjct: 281 RNGSCHVLIST 291


>UniRef50_Q5GZA1 Cluster: ATP-dependent RNA helicase; n=6;
           Xanthomonas|Rep: ATP-dependent RNA helicase -
           Xanthomonas oryzae pv. oryzae
          Length = 482

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 22/55 (40%), Positives = 38/55 (69%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +V+FCNTR++VD +  S+    F+  A+HGDM+QR+R+ ++ +F   S  VL+ +
Sbjct: 268 SVVFCNTRKEVDEVAGSLQEFGFSALALHGDMEQRDRDEVLVRFVNRSCNVLVAS 322



 Score = 36.3 bits (80), Expect = 0.75
 Identities = 13/24 (54%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV+ +S V+NY+LP++ E Y
Sbjct: 326 ARGLDVEDLSAVVNYELPTDTETY 349


>UniRef50_Q0M1B5 Cluster: Helicase-like:DEAD/DEAH box helicase-like;
           n=11; Alphaproteobacteria|Rep: Helicase-like:DEAD/DEAH
           box helicase-like - Caulobacter sp. K31
          Length = 678

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 21/64 (32%), Positives = 38/64 (59%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           L +   I   ++FCN + +VD + +S+    F  +A+HGD+DQ +R   +  FR GS ++
Sbjct: 240 LIEKAQIETGIVFCNRKTEVDVVAKSLKSHGFDAAAIHGDLDQSQRTKTLAAFRDGSLKI 299

Query: 242 LITT 253
           L+ +
Sbjct: 300 LVAS 303


>UniRef50_A0BDT5 Cluster: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1238

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 27/72 (37%), Positives = 45/72 (62%), Gaps = 1/72 (1%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAV-IFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           KL+ L D+ DTL I+  V IF   +++ + L+ +M  + +   A+HGD  Q +R+ IM+ 
Sbjct: 332 KLQKLLDILDTLKISDKVLIFSEQKQRCEQLSINMADKGYYTIALHGDKTQPQRDEIMKA 391

Query: 218 FRTGSSRVLITT 253
           FR+G +R+L  T
Sbjct: 392 FRSGYTRLLCAT 403


>UniRef50_Q9LYJ9 Cluster: DEAD-box ATP-dependent RNA helicase 46;
           n=16; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           46 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 645

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 23/57 (40%), Positives = 38/57 (66%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC+T+R  D L  ++  R F  +A+HGD  Q ER+ ++ QFR+G + VL+ T
Sbjct: 407 SKIIIFCSTKRMCDQLARNL-TRTFGAAAIHGDKSQAERDDVLNQFRSGRTPVLVAT 462



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 17/73 (23%), Positives = 30/73 (41%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+ +  V+NYD P+  E+Y                  F  + D +   D+     
Sbjct: 466 ARGLDVKDIRVVVNYDFPNGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKHASDLIKILE 525

Query: 442 TSIVEMPSDVANL 480
            +  ++P  V  +
Sbjct: 526 GANQKVPPQVREM 538


>UniRef50_Q8D563 Cluster: Superfamily II DNA and RNA helicase; n=13;
           Gammaproteobacteria|Rep: Superfamily II DNA and RNA
           helicase - Vibrio vulnificus
          Length = 412

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 23/71 (32%), Positives = 40/71 (56%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + L +L    +  QA++F   +   D L + ++    + +A+HGD  Q ERE  + QF
Sbjct: 223 KTKALIELIQKNAWTQALVFIGAKENADGLAKKLNKAGISTNALHGDKSQAEREAALAQF 282

Query: 221 RTGSSRVLITT 253
           ++G ++VLI T
Sbjct: 283 KSGQTQVLIAT 293



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 14/26 (53%), Positives = 20/26 (76%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           LLARGI ++Q+  VIN++LP + E Y
Sbjct: 295 LLARGIHIEQLPVVINFELPMHAETY 320


>UniRef50_Q6A841 Cluster: Putative ATP-dependent RNA helicase; n=1;
           Propionibacterium acnes|Rep: Putative ATP-dependent RNA
           helicase - Propionibacterium acnes
          Length = 561

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+E +  +     + + +IFC T+R    L++ +  R F   A+HGD+ Q  RE  +++F
Sbjct: 290 KIEIIGRILQANDVEKVIIFCRTKRACQRLSDDLDDRGFKTRAIHGDLTQVAREKALKKF 349

Query: 221 RTGSSRVLITT 253
           R G + +L+ T
Sbjct: 350 RHGDATILVAT 360


>UniRef50_A1KUM8 Cluster: Putative ATP-dependent RNA helicase; n=4;
           Neisseria|Rep: Putative ATP-dependent RNA helicase -
           Neisseria meningitidis serogroup C / serotype 2a (strain
           ATCC 700532 /FAM18)
          Length = 483

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/60 (36%), Positives = 36/60 (60%)
 Frame = +2

Query: 74  LSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           L + Q ++FC T++ VD +T  +  R+ +  A+HGD  Q+ R   +  F+ GS RVL+ T
Sbjct: 273 LHMNQVIVFCKTKQSVDRVTRELVRRNLSAQAIHGDRSQQSRLETLNAFKDGSLRVLVAT 332



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 13/59 (22%), Positives = 31/59 (52%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           + ARG+D+ ++  VINY++P+  E+Y                 + + E++++  + I++
Sbjct: 334 IAARGLDIAELPFVINYEMPAQPEDYVHRIGRTGRAGADGVAISLMDESEQKMFESIKE 392


>UniRef50_Q6MN50 Cluster: ATP-dependent RNA helicase; n=1;
           Bdellovibrio bacteriovorus|Rep: ATP-dependent RNA
           helicase - Bdellovibrio bacteriovorus
          Length = 656

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 23/72 (31%), Positives = 40/72 (55%)
 Frame = +2

Query: 38  WKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           +K E +  L  TL     +IFC T+ +V  L + +  R F   ++HGD  Q+ERE  +++
Sbjct: 277 YKTEVIGRLLQTLPEFYGIIFCQTKMEVAELADVLTQRGFPADSLHGDKSQQEREATLKK 336

Query: 218 FRTGSSRVLITT 253
           F+    +V++ T
Sbjct: 337 FKQRQVKVIVAT 348


>UniRef50_A7HKQ8 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Fervidobacterium nodosum Rt17-B1|Rep: DEAD/DEAH box
           helicase domain protein - Fervidobacterium nodosum
           Rt17-B1
          Length = 571

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/82 (29%), Positives = 45/82 (54%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           + Y  ++ E+ KL  LC + D       ++FC T+ +VD +++ +    +    +HGD  
Sbjct: 235 QLYFEVD-EKDKLPLLCRIIDMNPDFYGIVFCQTKLEVDEISKKLLDLGYNADGLHGDYS 293

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +RE ++ +FR    R+L+TT
Sbjct: 294 QYQRERVLDKFRKKQLRILVTT 315


>UniRef50_A6GPV2 Cluster: Helicase; n=1; Limnobacter sp. MED105|Rep:
           Helicase - Limnobacter sp. MED105
          Length = 539

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/56 (42%), Positives = 31/56 (55%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARG+D+  + CVINYDLP+  E+Y                 +FV + D RALKDIE
Sbjct: 328 ARGLDIADLPCVINYDLPTTPEDYVHRIGRTGRAGAKGTAYSFVVKRDERALKDIE 383



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%)
 Frame = +2

Query: 20  AIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRER 199
           A++ EE K   +C L  + +++Q ++F NT+     L   +     + +A+HGD  Q ER
Sbjct: 247 ALDSEEDKRMAVCHLIQSKALSQVIVFSNTKLGTARLARHLEKEGVSSTAIHGDKTQIER 306

Query: 200 EVIMRQFRTGSSRVLITT 253
              +  F+ G   VL+ T
Sbjct: 307 TKSLEAFKAGEVTVLVAT 324


>UniRef50_A1XCP2 Cluster: Vasa-like protein; n=2; Coelomata|Rep:
           Vasa-like protein - Macrobrachium rosenbergii (Giant
           fresh water prawn)
          Length = 710

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L D   T+   + ++F  T+R+ D++   +   +   +++HGD +QRERE  +  F
Sbjct: 517 KREQLLDFLKTIGNERTMVFVETKRQADFIATFLCQEELPTTSIHGDREQREREQALADF 576

Query: 221 RTGSSRVLITT 253
           + G   +L+ T
Sbjct: 577 KAGKCPILVAT 587



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+ +V  V+N+DLP N + Y
Sbjct: 591 ARGLDIPEVQHVVNFDLPKNIDEY 614


>UniRef50_Q9SQV1 Cluster: Probable DEAD-box ATP-dependent RNA
           helicase 40; n=2; core eudicotyledons|Rep: Probable
           DEAD-box ATP-dependent RNA helicase 40 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 1088

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/57 (43%), Positives = 36/57 (63%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC+T+R  D L  S+  R F    +HGD  Q ER+ ++ QFR+G S VLI T
Sbjct: 681 SKVIIFCSTKRLCDHLARSVG-RHFGAVVIHGDKTQGERDWVLNQFRSGKSCVLIAT 736



 Score = 37.1 bits (82), Expect = 0.43
 Identities = 19/73 (26%), Positives = 32/73 (43%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D++ +  VINYD P+  E+Y                  F TE D +   D+     
Sbjct: 740 ARGLDIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAFTFFTEQDWKYAPDLIKVLE 799

Query: 442 TSIVEMPSDVANL 480
            +  ++P  V ++
Sbjct: 800 GANQQVPPQVRDI 812


>UniRef50_Q9NXZ2 Cluster: Probable ATP-dependent RNA helicase DDX43;
           n=24; Coelomata|Rep: Probable ATP-dependent RNA helicase
           DDX43 - Homo sapiens (Human)
          Length = 648

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/80 (31%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query: 17  IAIELEEWK-LETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           +  E E+W  ++T   L    S  + ++F + +   D L+  + L + +V ++HGD +QR
Sbjct: 467 VTTEEEKWSHMQTF--LQSMSSTDKVIVFVSRKAVADHLSSDLILGNISVESLHGDREQR 524

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +RE  +  F+TG  R+LI T
Sbjct: 525 DREKALENFKTGKVRILIAT 544


>UniRef50_P42305 Cluster: ATP-dependent RNA helicase dbpA; n=9;
           Firmicutes|Rep: ATP-dependent RNA helicase dbpA -
           Bacillus subtilis
          Length = 479

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 27/70 (38%), Positives = 38/70 (54%), Gaps = 2/70 (2%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGID++ +S VINYDLP  +E+Y                 +FVT  ++R L DIE++  
Sbjct: 301 ARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIG 360

Query: 442 TSI--VEMPS 465
             I  +E PS
Sbjct: 361 FEIPKIEAPS 370



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           EE K   L D+  T +    +IFC T+  V+ LT+ +    +    +HG M Q +R  +M
Sbjct: 224 EENKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVM 283

Query: 212 RQFRTGSSRVLITT 253
            +F+ G  R L+ T
Sbjct: 284 NEFKRGEYRYLVAT 297


>UniRef50_Q5VQL1-2 Cluster: Isoform 2 of Q5VQL1 ; n=2;
           Magnoliophyta|Rep: Isoform 2 of Q5VQL1 - Oryza sativa
           subsp. japonica (Rice)
          Length = 759

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 21/57 (36%), Positives = 37/57 (64%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC+T+R  D L  ++  R +  SA+HGD  Q ER+ ++ +FR+G   +L+ T
Sbjct: 477 SKIIIFCSTKRMCDQLARNL-ARQYGASAIHGDKSQAERDSVLSEFRSGRCPILVAT 532



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D++ +  V+NYD P+  E+Y
Sbjct: 536 ARGLDIKDIRVVVNYDFPTGVEDY 559


>UniRef50_UPI0000E87E35 Cluster: putative ATP-dependent RNA helicase
           protein; n=1; Methylophilales bacterium HTCC2181|Rep:
           putative ATP-dependent RNA helicase protein -
           Methylophilales bacterium HTCC2181
          Length = 427

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = +2

Query: 80  IAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + QA+IF  T+R  D L++ ++  D   SA+HGDM Q  R   + +F+   +++L+ T
Sbjct: 243 VTQAIIFTATKRMADQLSDQLYHSDIKTSALHGDMSQGSRTKTINRFKRNETKILVAT 300



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 22/65 (33%), Positives = 31/65 (47%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L +RGIDV+ +S V NYD+P   E+Y                 + V+  DR  L+ IE F
Sbjct: 302 LASRGIDVKNISHVFNYDMPRFAEDYIHRIGRTGRANNKGIAISLVSPTDREFLRKIERF 361

Query: 436 YHTSI 450
            +  I
Sbjct: 362 TNLKI 366


>UniRef50_Q5NN72 Cluster: DNA and RNA helicase; n=3;
           Sphingomonadales|Rep: DNA and RNA helicase - Zymomonas
           mobilis
          Length = 492

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 24/71 (33%), Positives = 38/71 (53%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + LCD+        A+IFCN +  V  L  ++  + F+V  +HGDM Q ER   + +F
Sbjct: 229 KKKKLCDMLRAEKDHTAIIFCNRKTTVRQLATTLEQQGFSVGQIHGDMSQPERGSELERF 288

Query: 221 RTGSSRVLITT 253
           + G   VL+ +
Sbjct: 289 KNGQISVLVAS 299



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           + ARG+DV+ +S V N+D+P++ ++Y                  FVT AD  A+  IE
Sbjct: 301 IAARGLDVKGISHVFNFDVPTHPDDYIHRIGRTGRGGASGEALTFVTPADEEAITAIE 358


>UniRef50_Q2BIX8 Cluster: Probable ATP-dependent RNA helicase; n=1;
           Neptuniibacter caesariensis|Rep: Probable ATP-dependent
           RNA helicase - Neptuniibacter caesariensis
          Length = 410

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 23/71 (32%), Positives = 41/71 (57%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + LC L +  S  +AV+FCN++ +   L   +    F  + +HGD+ Q+ R   +  F
Sbjct: 228 KDKQLCWLLENESYDKAVVFCNSKTEARRLDGFIRYHKFKAALLHGDVQQKGRFATIEGF 287

Query: 221 RTGSSRVLITT 253
           R G++++L+TT
Sbjct: 288 RKGTTKILVTT 298


>UniRef50_A4C0F9 Cluster: ATP-dependent RNA helicase; n=6;
           Bacteroidetes|Rep: ATP-dependent RNA helicase -
           Polaribacter irgensii 23-P
          Length = 447

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 24/71 (33%), Positives = 42/71 (59%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           KLE L    ++ +  + +IFC T+  V+ L++++ +  F+  A+HG + Q  R+ IM QF
Sbjct: 230 KLEVLLHFLNSKAGQRGIIFCKTKAAVNKLSKNLAINKFSSGAIHGSLTQGIRDRIMGQF 289

Query: 221 RTGSSRVLITT 253
           R G   +L+ T
Sbjct: 290 RDGYIDILVAT 300



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 21/60 (35%), Positives = 27/60 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L ARGIDV+ +S V+NY LP   + Y                   +T   +  LKDI DF
Sbjct: 302 LAARGIDVKDLSYVVNYHLP---DTYGAYVHRSGRTARAGASGLSLTIIQQEELKDISDF 358


>UniRef50_A4S107 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 478

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 24/72 (33%), Positives = 38/72 (52%)
 Frame = +2

Query: 38  WKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           W  E L D  D     QA++F N +  V+ L   +  R     A+HGD+DQ +R+  M+ 
Sbjct: 293 WLFENLGDAVDE---GQAIVFVNHKSSVEELVNELATRGIKAVALHGDLDQAQRQFAMKA 349

Query: 218 FRTGSSRVLITT 253
           F++  + VL+ T
Sbjct: 350 FKSEHAHVLVAT 361


>UniRef50_A5K071 Cluster: ATP-dependent RNA helicase, putative; n=6;
           Plasmodium|Rep: ATP-dependent RNA helicase, putative -
           Plasmodium vivax
          Length = 717

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/78 (32%), Positives = 45/78 (57%)
 Frame = +2

Query: 20  AIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRER 199
           +I+L++  L+ L   Y+   I   +IFC+T+R  D L + +    +   A+HGD +QRER
Sbjct: 557 SIDLKKKLLDWLKQNYEGNKI---LIFCDTKRNCDSLCKELRYHQYNALAIHGDKEQRER 613

Query: 200 EVIMRQFRTGSSRVLITT 253
           + I+  +R+    +L+ T
Sbjct: 614 DRILSNYRSDRCNILVAT 631



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 12/24 (50%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D++ +S V+NYDLP+  E+Y
Sbjct: 635 SRGLDIKNISVVVNYDLPNTIEDY 658


>UniRef50_Q2S6I0 Cluster: ATP-dependent RNA helicase; n=1;
           Salinibacter ruber DSM 13855|Rep: ATP-dependent RNA
           helicase - Salinibacter ruber (strain DSM 13855)
          Length = 478

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/82 (29%), Positives = 45/82 (54%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           R+Y+   ++  K   +  L +      A+IF NT+R+V +L + +  + + +  M GD+ 
Sbjct: 261 RYYLVNPMD--KDRVMAQLLELEEPESALIFANTKREVSYLNKFLSNKGYDIDEMSGDLS 318

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+RE  + + R G  R+L+ T
Sbjct: 319 QRDREEALDRLREGKLRLLVAT 340


>UniRef50_O07897 Cluster: Heat resistant RNA dependent ATPase; n=3;
           Thermus thermophilus|Rep: Heat resistant RNA dependent
           ATPase - Thermus thermophilus
          Length = 510

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/71 (33%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           +LE L DL    S  +A++F  T+ + + + + +        A+HGD+ Q ERE ++  F
Sbjct: 225 RLEVLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHLAQALHGDLSQGERERVLGAF 284

Query: 221 RTGSSRVLITT 253
           R G  RVL+ T
Sbjct: 285 RQGEVRVLVAT 295


>UniRef50_A1G315 Cluster: DEAD/DEAH box helicase-like; n=2;
           Salinispora|Rep: DEAD/DEAH box helicase-like -
           Salinispora arenicola CNS205
          Length = 633

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/71 (33%), Positives = 36/71 (50%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+E +  +         +IF  T+R  D +   +  R F V+A+HGD+ Q  RE  +R F
Sbjct: 341 KIEIVARILQARGRGLTMIFTRTKRAADRVAADLDFRGFAVAAVHGDLGQGARERALRAF 400

Query: 221 RTGSSRVLITT 253
           RTG    L+ T
Sbjct: 401 RTGKIDTLVAT 411



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGIDV  V+ V+NYD P +++ Y
Sbjct: 415 ARGIDVSGVTHVLNYDCPEDQDTY 438


>UniRef50_Q4T821 Cluster: Chromosome undetermined SCAF7914, whole
           genome shotgun sequence; n=3; Tetraodontidae|Rep:
           Chromosome undetermined SCAF7914, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 502

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 26/72 (36%), Positives = 33/72 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P N E Y                 N +T  DR  LK IE+ 
Sbjct: 413 LFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITSDDRFNLKTIEEQ 472

Query: 436 YHTSIVEMPSDV 471
             T I  +P  +
Sbjct: 473 LITDIKPIPGSI 484



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/84 (30%), Positives = 41/84 (48%)
 Frame = +2

Query: 2   GTRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGD 181
           G   Y A   E  K+  L  L+  L I Q++IFCN+ ++V+ L + +    ++   +H  
Sbjct: 328 GITQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAK 387

Query: 182 MDQREREVIMRQFRTGSSRVLITT 253
           M Q  R  +   FR G  R L+ T
Sbjct: 388 MMQEYRNRVFHDFRNGLCRNLVCT 411


>UniRef50_Q92GV2 Cluster: ATP-dependent RNA helicase RhlE; n=10;
           Rickettsia|Rep: ATP-dependent RNA helicase RhlE -
           Rickettsia conorii
          Length = 414

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 19/54 (35%), Positives = 33/54 (61%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF  T+R  D L + +   + T  A+HGD+ QR+RE ++  FR  + R+++ T
Sbjct: 242 IIFVKTKRSADQLAKMLKYENHTAEAIHGDLSQRQRERVILSFRKSNHRIMVAT 295


>UniRef50_Q1MYS3 Cluster: Probable ATP-dependent RNA helicase; n=1;
           Oceanobacter sp. RED65|Rep: Probable ATP-dependent RNA
           helicase - Oceanobacter sp. RED65
          Length = 449

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 26/80 (32%), Positives = 39/80 (48%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           Y+  + ++ K   L  L       QA+IF NT+ K +     +   +  V  +HGDM Q 
Sbjct: 223 YMLADDDKHKQRILTWLLSNEEYRQAIIFTNTKEKTEQTYHFLSYHNVEVGYLHGDMTQD 282

Query: 194 EREVIMRQFRTGSSRVLITT 253
           ER  +M Q R G  +VL+ T
Sbjct: 283 ERNHVMTQMRNGRFKVLVAT 302


>UniRef50_A6QC93 Cluster: ATP-independent RNA helicase DbpA; n=1;
           Sulfurovum sp. NBC37-1|Rep: ATP-independent RNA helicase
           DbpA - Sulfurovum sp. (strain NBC37-1)
          Length = 453

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 25/71 (35%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K +TL  L  +      +IFCNT+ +V  L + +  R  +V  +HGD+DQRER   +  F
Sbjct: 226 KFKTLNALIGSYKPDSLLIFCNTKAEVISLADRLQQRGHSVIDIHGDLDQRERNEAVILF 285

Query: 221 RTGSSRVLITT 253
              S R+++ T
Sbjct: 286 SNRSKRIMVAT 296



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 13/24 (54%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D++ +S VINYDLP ++E Y
Sbjct: 300 SRGLDIKDISLVINYDLPFDKEVY 323


>UniRef50_Q9GV13 Cluster: Vasa-related protein CnVAS1; n=3;
           Eumetazoa|Rep: Vasa-related protein CnVAS1 - Hydra
           magnipapillata (Hydra)
          Length = 797

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +2

Query: 23  IELEEW-KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRER 199
           +E+EE  K + L ++ DT    + ++F  T+R  D+L   +    F  +++HGD  Q++R
Sbjct: 585 MEVEESAKRDKLIEILDTEGTNRNLVFVQTKRLADFLASYLCQNGFHTTSIHGDRLQQQR 644

Query: 200 EVIMRQFRTGSSRVLITT 253
           E  + +F+ G+  VLI T
Sbjct: 645 EEALAEFKAGTQHVLIAT 662



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V  VINYDLP   E Y
Sbjct: 666 ARGLDIADVKQVINYDLPDEIEEY 689


>UniRef50_Q4JF01 Cluster: Vasa homlogue; n=2; Eukaryota|Rep: Vasa
           homlogue - Platynereis dumerilii (Dumeril's clam worm)
          Length = 712

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 22/71 (30%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L ++ +     + ++F  T+R  D+L   +    +  +++HGD  QRERE  +  F
Sbjct: 510 KREKLVEILNQAGTDRTLVFLETKRSADFLAAYLSQEQYPATSIHGDRLQREREEALLDF 569

Query: 221 RTGSSRVLITT 253
           +TG + +LI T
Sbjct: 570 KTGRAPILIAT 580



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 14/24 (58%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V  VINYDLPS  + Y
Sbjct: 584 ARGLDIPGVKHVINYDLPSGIDEY 607


>UniRef50_Q2H4C0 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 602

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 25/71 (35%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + L DL  +L   + +IF N++R  + + + +       ++MHGD +Q ERE  MR F
Sbjct: 348 KKQALIDLIKSLPPTRTIIFVNSKRAAEEVDDFLFNLGMPCTSMHGDRNQLEREAAMRGF 407

Query: 221 RTGSSRVLITT 253
           R G   +LI T
Sbjct: 408 RGGKWPILIAT 418



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPS 318
           ARGIDV+ V  VINYDLPS
Sbjct: 422 ARGIDVRNVMHVINYDLPS 440


>UniRef50_Q10RI7 Cluster: DEAD-box ATP-dependent RNA helicase 38;
           n=4; Oryza sativa|Rep: DEAD-box ATP-dependent RNA
           helicase 38 - Oryza sativa subsp. japonica (Rice)
          Length = 505

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 20/58 (34%), Positives = 38/58 (65%)
 Frame = +2

Query: 80  IAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + Q +IF  T++    +  ++ L D+  S++ G +DQ ERE I+++F+ G ++VLI+T
Sbjct: 350 VGQVIIFVRTKQSTKDVHNALTLEDYVCSSIQGSLDQSEREKIIQEFKNGYTKVLIST 407


>UniRef50_Q5KJI2 Cluster: ATP-dependent RNA helicase DHH1; n=4;
           Dikarya|Rep: ATP-dependent RNA helicase DHH1 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 625

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 25/81 (30%), Positives = 42/81 (51%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T++Y  +E E  K+  L  L+  L I Q++IFCN+  +V+ L + +    ++    H  M
Sbjct: 250 TQYYAYVE-ESQKVHCLNTLFSKLQINQSIIFCNSTNRVELLAKKVTELGYSCFYSHAKM 308

Query: 185 DQREREVIMRQFRTGSSRVLI 247
            Q  R  +   FR G +R L+
Sbjct: 309 QQAHRNRVFHDFRNGMTRNLV 329



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 24/70 (34%), Positives = 32/70 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LL RGID+Q V+ VIN+D P   E+Y                 + +T  DR  L  IE  
Sbjct: 333 LLTRGIDIQAVNVVINFDFPRTAESYLHRIGRSGRFGHLGLAISLLTLEDRHNLYRIESE 392

Query: 436 YHTSIVEMPS 465
             T I  +P+
Sbjct: 393 LGTEIAPIPA 402


>UniRef50_Q26CN9 Cluster: ATP-dependent RNA helicase; n=1;
           Flavobacteria bacterium BBFL7|Rep: ATP-dependent RNA
           helicase - Flavobacteria bacterium BBFL7
          Length = 644

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/71 (30%), Positives = 38/71 (53%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+E L    D       V+FC T+R    + + ++   +   A+HGDM Q +R+  M++F
Sbjct: 240 KIEALRRFLDYDEDMFGVVFCRTKRDTQNVADQLNNNGYATEALHGDMSQAQRDAAMKRF 299

Query: 221 RTGSSRVLITT 253
           R  + ++LI T
Sbjct: 300 RNKNLKLLIAT 310


>UniRef50_Q1J0S9 Cluster: DEAD/DEAH box helicase-like protein; n=2;
           Deinococcus|Rep: DEAD/DEAH box helicase-like protein -
           Deinococcus geothermalis (strain DSM 11300)
          Length = 591

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/80 (28%), Positives = 42/80 (52%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           ++ +++   +   L DL    +  +A++F  T+R+ D L   +  R     A+HGD+ Q 
Sbjct: 223 HLKVKVGRTRTRVLADLLTVYNPEKAIVFTRTKREADELANELIHRGIESEALHGDLAQS 282

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +RE  +  FR+G   VL+ T
Sbjct: 283 QRERALGAFRSGRVGVLVAT 302


>UniRef50_Q7RNB9 Cluster: Helicase conserved C-terminal domain,
           putative; n=4; Plasmodium (Vinckeia)|Rep: Helicase
           conserved C-terminal domain, putative - Plasmodium
           yoelii yoelii
          Length = 212

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D++T+++ L       +HGD  Q ER  ++  F+TG S +LI T
Sbjct: 36  IVFVETKRSADFITKALRLEGMPALCIHGDKKQDERRWVLNDFKTGKSPILIAT 89



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 18/73 (24%), Positives = 30/73 (41%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D++ V  VINYD P+  E+Y                  F+T    R  K++     
Sbjct: 93  SRGLDIKNVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKILR 152

Query: 442 TSIVEMPSDVANL 480
            S   +P  +  +
Sbjct: 153 ESEQPIPPQLEKI 165


>UniRef50_Q66WQ1 Cluster: DEAD box DNA helicase; n=2; Plasmodium
           falciparum|Rep: DEAD box DNA helicase - Plasmodium
           falciparum
          Length = 516

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 45/78 (57%)
 Frame = +2

Query: 20  AIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRER 199
           +I++++  L+ L + Y+   I   +IFC+T+R  D L + +    +   ++HGD  QRER
Sbjct: 357 SIDMKKKLLDWLKENYENNKI---LIFCDTKRNCDNLGKELRYHQYNALSIHGDKQQRER 413

Query: 200 EVIMRQFRTGSSRVLITT 253
           + I+  ++T    +L+ T
Sbjct: 414 DRILNNYKTDRCNILVAT 431



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 12/24 (50%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D++ +S VINYD+P+  E+Y
Sbjct: 435 SRGLDIKNISVVINYDIPNTIEDY 458


>UniRef50_Q8SQM5 Cluster: ATP-dependent RNA helicase eIF4A; n=1;
           Encephalitozoon cuniculi|Rep: ATP-dependent RNA helicase
           eIF4A - Encephalitozoon cuniculi
          Length = 425

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 2/79 (2%)
 Frame = +1

Query: 238 CLDHHCLLARGIDVQQVSCVINYDLPS--NRENYXXXXXXXXXXXXXXXXXNFVTEADRR 411
           CL    LL+RGID+Q +S V   D+PS   +  Y                 N V E + +
Sbjct: 343 CLISSGLLSRGIDIQNLSVVFCLDVPSFERKSTYIHRIGRSGRYGRKGIAINIVYEHELK 402

Query: 412 ALKDIEDFYHTSIVEMPSD 468
            LK IE FY+T+I E+P+D
Sbjct: 403 NLKAIERFYNTTIKELPAD 421



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/71 (25%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           KL TL D++    + Q+++F N++     + + +   ++    +  ++ Q ERE  + +F
Sbjct: 277 KLVTLYDIFRKQRLGQSIVFINSKEDARIVYDWLIRHEWECELISAELTQAERERTLNRF 336

Query: 221 RTGSSRVLITT 253
           R G+ R LI++
Sbjct: 337 RGGTGRCLISS 347


>UniRef50_Q7UNV7 Cluster: ATP-dependent RNA helicase; n=2;
           Planctomycetaceae|Rep: ATP-dependent RNA helicase -
           Rhodopirellula baltica
          Length = 452

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESM-HLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           QA+IFC T+R  D L   + H       A+HGD+ QRER+ ++++ R G+ + L+ T
Sbjct: 286 QAIIFCRTKRGTDRLHRKLSHEYGSACGAIHGDLQQRERDRVLQKLRDGNLKFLVAT 342


>UniRef50_Q4PNH7 Cluster: Putative cold-shock dead-box protein A;
           n=1; uncultured marine bacterium 66A03|Rep: Putative
           cold-shock dead-box protein A - uncultured marine
           bacterium 66A03
          Length = 659

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +2

Query: 80  IAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ A++FCNTR  V  L   +  R F+V A+ G++ Q+ER   ++  R G + V + T
Sbjct: 244 VSGAIVFCNTRAAVTHLASRLTNRGFSVVALSGELSQKERNFALQSMRAGKANVCVAT 301


>UniRef50_Q0BSI7 Cluster: ATP-dependent RNA helicase; n=12;
           Alphaproteobacteria|Rep: ATP-dependent RNA helicase -
           Granulobacter bethesdensis (strain ATCC BAA-1260 /
           CGDNIH1)
          Length = 763

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/77 (33%), Positives = 42/77 (54%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           +A+  E  K + L  L     +  A+IFCN +R VD LT+S+    F    +HGD+ Q  
Sbjct: 443 LALVGEMDKRKALRHLLRQEKVQNALIFCNRKRDVDILTKSLVKHGFAAGPLHGDLAQSL 502

Query: 197 REVIMRQFRTGSSRVLI 247
           R   + +F+ GS ++L+
Sbjct: 503 RFSTLEKFKAGSLQLLV 519


>UniRef50_Q8MZI3 Cluster: GH10652p; n=2; Drosophila
           melanogaster|Rep: GH10652p - Drosophila melanogaster
           (Fruit fly)
          Length = 818

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSI---AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRERE 202
           E  KL  L  L   +S     + +IF  T+++VD +T ++  + +   A+HGD  Q+ER+
Sbjct: 385 ENEKLMKLIKLLTDISAENETKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERD 444

Query: 203 VIMRQFRTGSSRVLITT 253
            ++  FR G   +L+ T
Sbjct: 445 FVLSSFRNGRHSILVAT 461



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 16/24 (66%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV  V  VINYD PSN E+Y
Sbjct: 465 ARGLDVDDVKFVINYDYPSNSEDY 488


>UniRef50_Q5CWY8 Cluster: Rok1p, eIF4A-1-family RNA SFII helicase;
           n=3; Cryptosporidium|Rep: Rok1p, eIF4A-1-family RNA SFII
           helicase - Cryptosporidium parvum Iowa II
          Length = 480

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/80 (32%), Positives = 36/80 (45%)
 Frame = +1

Query: 226 WLFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEAD 405
           W+  C D   L+ARG+D + VSCV+NYD P +  NY                  F T  D
Sbjct: 385 WILICTD---LMARGVDFKNVSCVVNYDFPHSPSNYIHRVGRCGRAGRTGYAITFFTLRD 441

Query: 406 RRALKDIEDFYHTSIVEMPS 465
              +K I     +S  ++PS
Sbjct: 442 IPKIKSIAKVIKSSGADVPS 461



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIA-QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           + +  ++ K+E+L  L     I    ++F N++     L + +   +  V A+H DM + 
Sbjct: 311 VCVTKDDAKIESLRQLIKQGKIMLPTLVFTNSKDDAQRLFKKLMYDNLIVEAIHSDMPKV 370

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +R+ I+++FRTG   +LI T
Sbjct: 371 KRDNIIQRFRTGKIWILICT 390


>UniRef50_A2DES1 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 640

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 28/86 (32%), Positives = 40/86 (46%)
 Frame = +1

Query: 232 FSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRR 411
           FS L    + ARGID+  + CVINYD P +  +Y                  FVT+ D+ 
Sbjct: 395 FSVLVLTSVGARGIDIASIICVINYDAPDHEADYVHRVGRTGRAGKKGYAFTFVTDKDKT 454

Query: 412 ALKDIEDFYHTSIVEMPSDVANLI*G 489
           A   I++    S  E+P D+ +L  G
Sbjct: 455 AAAGIKNAMKKSGCEIPKDLEDLCQG 480



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLY-DTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           I +  E+ K  +L  +  D  +  QA++F NT+ + + L   ++   ++V  +HG MD  
Sbjct: 322 ILVTNEDNKFNSLLKILGDYTTQGQALVFTNTQDRAEDLFGKLNKSGYSVGLLHGSMDSP 381

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +R  I+  FR G   VL+ T
Sbjct: 382 DRNSILHDFREGRFSVLVLT 401


>UniRef50_Q7A4G0 Cluster: Probable DEAD-box ATP-dependent RNA
           helicase SA1885; n=13; Staphylococcus|Rep: Probable
           DEAD-box ATP-dependent RNA helicase SA1885 -
           Staphylococcus aureus (strain N315)
          Length = 506

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  FYIAI-ELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           FY  + ELE  K +T  +  D      A++F  T+R+VD LT ++  + +    +HGD+ 
Sbjct: 218 FYTIVKELE--KFDTFTNFLDVHQPELAIVFGRTKRRVDELTSALISKGYKAEGLHGDIT 275

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +R  ++++F+     +L+ T
Sbjct: 276 QAKRLEVLKKFKNDQINILVAT 297



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 17/57 (29%), Positives = 26/57 (45%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           ARG+D+  VS V N+D+P + E+Y                  FV   +   ++ IED
Sbjct: 301 ARGLDISGVSHVYNFDIPQDTESYTHRIGRTGRAGKEGIAVTFVNPIEMDYIRQIED 357


>UniRef50_P09052 Cluster: ATP-dependent RNA helicase vasa; n=5;
           Eukaryota|Rep: ATP-dependent RNA helicase vasa -
           Drosophila melanogaster (Fruit fly)
          Length = 661

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D+L   +  ++F  +++HGD  Q +RE  +R F+ GS +VLI T
Sbjct: 493 IVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIAT 546



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 11/24 (45%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D++ +  VINYD+PS  ++Y
Sbjct: 550 SRGLDIKNIKHVINYDMPSKIDDY 573


>UniRef50_A7JLA3 Cluster: ATP-dependent RNA helicase; n=20;
           Francisella|Rep: ATP-dependent RNA helicase -
           Francisella tularensis subsp. novicida GA99-3548
          Length = 569

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/71 (32%), Positives = 41/71 (57%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K++ L  L +T      +IF  T+     +T+++    + V+A++GDM Q +RE I+ QF
Sbjct: 235 KIDALDRLLETEETDGVIIFVKTKTSTIEVTDNLKALGYKVAAINGDMQQSQREYIVDQF 294

Query: 221 RTGSSRVLITT 253
           R+  S +L+ T
Sbjct: 295 RSAKSDILVAT 305



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 2/72 (2%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           ++ARGID++++S VINYD+P++ + Y                 + V   + R L+ +E F
Sbjct: 307 VVARGIDLERISHVINYDMPNDTDTYVHRIGRTGRAGREGTSISLVPLKEMRFLRTLERF 366

Query: 436 YHTSIVE--MPS 465
             + + E  MPS
Sbjct: 367 TGSPMQEVFMPS 378


>UniRef50_A2TP65 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family protein; n=13; Bacteroidetes|Rep: ATP-dependent
           RNA helicase, DEAD/DEAH box family protein - Dokdonia
           donghaensis MED134
          Length = 638

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 18/55 (32%), Positives = 33/55 (60%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +VIFC T+R    + E +    +   A+HGD+ Q +R+++M+ FR    ++L+ T
Sbjct: 244 SVIFCRTKRDTQKVAEQLIEDGYNAGALHGDLSQNQRDLVMKSFRNNQIQMLVAT 298



 Score = 36.7 bits (81), Expect = 0.57
 Identities = 19/56 (33%), Positives = 26/56 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARGIDV  ++ VINY LP   E Y                   VT+++ R +K +E
Sbjct: 302 ARGIDVDDITHVINYQLPDEIETYTHRSGRTGRAGKTGTSMVIVTKSEMRKIKQLE 357


>UniRef50_Q5CHB7 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium hominis
          Length = 868

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/76 (35%), Positives = 45/76 (59%), Gaps = 2/76 (2%)
 Frame = +2

Query: 32  EEWKLETLCDLY-DTL-SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           E+ KL +L  L  +T+ S  +A+IFC T+  VD++ + +   +  VS ++G+MDQ  R +
Sbjct: 229 EDEKLASLLYLLRNTIPSHERAIIFCATKHHVDYIVKILESNNIIVSYIYGNMDQEARTM 288

Query: 206 IMRQFRTGSSRVLITT 253
            +  FR   SR L+ T
Sbjct: 289 HLSTFRKNKSRALVVT 304


>UniRef50_O97031 Cluster: DjVLGA; n=1; Dugesia japonica|Rep: DjVLGA
           - Dugesia japonica (Planarian)
          Length = 726

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCD-LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E  K + L D L D  S +  ++F  T+R  D L   +H     V+++HGD  Q +RE+ 
Sbjct: 449 ENEKRDHLLDILTDIDSDSLILVFVETKRGADALEGFLHTEGSCVASIHGDRSQSDRELA 508

Query: 209 MRQFRTGSSRVLITT 253
           ++ FR GS+ +L+ T
Sbjct: 509 LQSFREGSTPILVAT 523



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 18/57 (31%), Positives = 27/57 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           ARG+D+  V  VINYDLP++ E Y                 +F T+ +    K++ D
Sbjct: 527 ARGLDIPNVKFVINYDLPTDIEEYVHRIGRTGRVGNLGEAISFYTDKNNNVAKELVD 583


>UniRef50_A7U5W6 Cluster: DEAD-box helicase 1; n=8;
           Aconoidasida|Rep: DEAD-box helicase 1 - Plasmodium
           falciparum
          Length = 457

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFV-TEADRRALKDIED 432
           L  RGID+++V+ VINYD+P N ++Y                  FV ++ D  AL +++ 
Sbjct: 377 LFGRGIDIERVNIVINYDMPENSDSYLHRVGRAGRFGTKGLAVTFVSSQEDTLALNEVQT 436

Query: 433 FYHTSIVEMPSDV 471
            +  +I EMP+ +
Sbjct: 437 RFEVAISEMPNKI 449



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 21/80 (26%), Positives = 43/80 (53%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           Y+ ++ E+ K   L ++ D L   Q +IF  +  +   L + +   +F   A+HG ++Q+
Sbjct: 297 YVKLQ-EKDKTRKLIEILDALEFNQVIIFVKSVTRAITLDKLLTECNFPSIAIHGGLEQQ 355

Query: 194 EREVIMRQFRTGSSRVLITT 253
           ER     +F+   +R+L++T
Sbjct: 356 ERIERYDKFKKFENRILVST 375


>UniRef50_Q9M2F9 Cluster: DEAD-box ATP-dependent RNA helicase 52;
           n=22; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           52 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 646

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 20/57 (35%), Positives = 34/57 (59%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A  ++F  T++  D L   + +  F  + +HGD  Q+EREV +R F+TG + +L+ T
Sbjct: 406 ALTLVFVETKKGADSLENWLCINGFPATTIHGDRSQQEREVALRSFKTGRTPILVAT 462


>UniRef50_Q9NQI0 Cluster: Probable ATP-dependent RNA helicase DDX4;
           n=49; Euteleostomi|Rep: Probable ATP-dependent RNA
           helicase DDX4 - Homo sapiens (Human)
          Length = 724

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L ++   +   + ++F  T++K D++   +     + +++HGD +QRERE  +  F
Sbjct: 527 KREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDF 586

Query: 221 RTGSSRVLITT 253
           R G   VL+ T
Sbjct: 587 RFGKCPVLVAT 597



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D++ V  VIN+DLPS  + Y
Sbjct: 601 ARGLDIENVQHVINFDLPSTIDEY 624


>UniRef50_Q7VFA9 Cluster: ATP-dependent RNA helicase DeaD; n=6;
           Helicobacteraceae|Rep: ATP-dependent RNA helicase DeaD -
           Helicobacter hepaticus
          Length = 530

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/82 (30%), Positives = 45/82 (54%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++YI  E E  + E +  L +T +  +++IF   +++ D L   +  R F   A+HGDM+
Sbjct: 260 QYYIINEGE--RDEAIVRLIETQNPTKSIIFTRMKKEADALAIRLANRGFKAIALHGDME 317

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           QR+R   ++ FR     +L+ T
Sbjct: 318 QRDRREAIKAFRENKIEILVAT 339


>UniRef50_Q5FUQ9 Cluster: ATP-dependent RNA helicase; n=11; cellular
           organisms|Rep: ATP-dependent RNA helicase -
           Gluconobacter oxydans (Gluconobacter suboxydans)
          Length = 793

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/77 (29%), Positives = 40/77 (51%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           + I  E+ K  TL  L    ++  A++FCN +R VD + + +   D     +HGD+ Q  
Sbjct: 511 LVIVPEDEKRRTLKKLLRRENVQSAIVFCNRKRDVDMIQQYLTKHDIEAGHLHGDLAQSL 570

Query: 197 REVIMRQFRTGSSRVLI 247
           R   + +FR+G  + L+
Sbjct: 571 RFSTLERFRSGELKFLV 587



 Score = 40.3 bits (90), Expect = 0.046
 Identities = 22/56 (39%), Positives = 27/56 (48%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARGID+  +S V NYDLP N E+Y                 +  T  DRR L+ IE
Sbjct: 593 ARGIDIGGLSHVFNYDLPFNAEDYVHRIGRTGRAGNEGHAFSLATPRDRRLLEAIE 648


>UniRef50_Q3SF48 Cluster: DEAD/DEAH box helicase; n=6; cellular
           organisms|Rep: DEAD/DEAH box helicase - Thiobacillus
           denitrificans (strain ATCC 25259)
          Length = 533

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 19/60 (31%), Positives = 37/60 (61%)
 Frame = +2

Query: 74  LSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + + QA++F +T+R  + +++ +    F   A+HGDM Q +R   +++ R G +RVL+ T
Sbjct: 243 VEMVQAIVFASTKRSTEEISDLLAESGFASDALHGDMQQGQRNRALQRLREGRTRVLVAT 302



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 15/24 (62%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGIDV  +S VIN+DLP   E+Y
Sbjct: 306 ARGIDVASISHVINFDLPRQAEDY 329


>UniRef50_A1FEC3 Cluster: DEAD/DEAH box helicase-like; n=21;
           Gammaproteobacteria|Rep: DEAD/DEAH box helicase-like -
           Pseudomonas putida W619
          Length = 621

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 20/56 (35%), Positives = 36/56 (64%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +A+IF NTR   D +   +  +D     +HG+ DQ++R++ + +F+ GSS+VL+ T
Sbjct: 427 KAIIFTNTRVLADRIYGHLVAKDVKAFVLHGEKDQKDRKLAIERFKQGSSKVLVAT 482


>UniRef50_Q17JB5 Cluster: DEAD box ATP-dependent RNA helicase; n=4;
           Eukaryota|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 699

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 18/56 (32%), Positives = 35/56 (62%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  T+R+VD +T +++   +   ++HGD  Q+ER+ ++  FR G   +L+ T
Sbjct: 371 KTIIFVETKRRVDDITRNINRNGWRAVSIHGDKSQQERDYVLNAFRNGRQGILVAT 426



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 16/24 (66%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV+ V  VINYD PSN E+Y
Sbjct: 430 ARGLDVEDVKFVINYDYPSNSEDY 453


>UniRef50_A0CUL6 Cluster: Chromosome undetermined scaffold_28, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_28,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 604

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = +2

Query: 44  LETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFR 223
           +  L  L   ++  + +IFC+T++  D L +++        A+HGD  Q ER+ +M  FR
Sbjct: 382 ISLLLYLLKDIAHKKILIFCSTKKGCDQLQKTLDREGIRCLALHGDKKQTERDYVMSHFR 441

Query: 224 TGSSRVLITT 253
            G S  LI T
Sbjct: 442 NGRSTALIAT 451



 Score = 37.5 bits (83), Expect = 0.32
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXN-FVTEADRRALKDIEDFY 438
           +RG+D++ +  V+NYD+P   E+Y                 + F ++ D R  KD+ +  
Sbjct: 455 SRGLDIKDIEVVVNYDMPKVIEDYVHRIGRTGRAGAIGQSISFFASDEDVRMAKDLVEIL 514

Query: 439 HTSIVEMPSDVANLI 483
             S  ++P ++ +LI
Sbjct: 515 RESQNDIPYELRSLI 529


>UniRef50_Q58083 Cluster: Probable ATP-dependent RNA helicase
           MJ0669; n=11; cellular organisms|Rep: Probable
           ATP-dependent RNA helicase MJ0669 - Methanococcus
           jannaschii
          Length = 367

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/80 (31%), Positives = 39/80 (48%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           Y+ +   E + E LC L         ++FC T+R    L   +    F   A+HGD+ Q 
Sbjct: 218 YVEVNENE-RFEALCRLLKNKEF-YGLVFCKTKRDTKELASMLRDIGFKAGAIHGDLSQS 275

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +RE ++R F+    R+LI T
Sbjct: 276 QREKVIRLFKQKKIRILIAT 295



 Score = 39.5 bits (88), Expect = 0.080
 Identities = 15/26 (57%), Positives = 21/26 (80%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           +++RGIDV  ++CVINY LP N E+Y
Sbjct: 297 VMSRGIDVNDLNCVINYHLPQNPESY 322


>UniRef50_O00148 Cluster: ATP-dependent RNA helicase DDX39; n=27;
           Eukaryota|Rep: ATP-dependent RNA helicase DDX39 - Homo
           sapiens (Human)
          Length = 427

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 345 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 404

Query: 433 FYHTSIVEMPSDV 471
            +  ++ E+P ++
Sbjct: 405 RFEVNVAELPEEI 417



 Score = 40.3 bits (90), Expect = 0.046
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q +IF  + ++   L + +  ++F   A+H  M 
Sbjct: 263 QYYVKLKDSE-KNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMA 321

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 322 QEERLSRYQQFKDFQRRILVAT 343


>UniRef50_A5CVQ6 Cluster: ATP-dependent RNA helicase DeaD; n=2;
           sulfur-oxidizing symbionts|Rep: ATP-dependent RNA
           helicase DeaD - Vesicomyosocius okutanii subsp.
           Calyptogena okutanii (strain HA)
          Length = 608

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/71 (32%), Positives = 37/71 (52%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           KLE L  + +       +IF  T+     LTE +  R F+  A++GD+ Q +RE I+  +
Sbjct: 239 KLEALTRILEVTVFDAMIIFVRTKTLTTELTEKLSARGFSADAINGDIQQNQRERIINDY 298

Query: 221 RTGSSRVLITT 253
           + G   +LI T
Sbjct: 299 KQGKIDILIAT 309



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 2/72 (2%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           + ARG+DV+++S V+NYD+P + E+Y                  FV+  +RR L  IE  
Sbjct: 311 IAARGLDVERISHVVNYDIPQDAESYVHRIGRTGRAGRKGEAILFVSNRERRMLNTIEHV 370

Query: 436 YHTSI--VEMPS 465
               I  +E+PS
Sbjct: 371 TRQKITPIELPS 382


>UniRef50_Q17II7 Cluster: DEAD box ATP-dependent RNA helicase; n=1;
           Aedes aegypti|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 639

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRD-FTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  T+++VD +T  + LRD +    +HGD  QRERE  +  FR+G + +LI T
Sbjct: 336 KTIIFIETKKRVDDITRKV-LRDGWPAMCIHGDKSQREREYTLNSFRSGKNPILIAT 391



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV  V  VIN+D P+  E+Y
Sbjct: 395 ARGLDVDDVKFVINFDYPTTSEDY 418


>UniRef50_O00571 Cluster: ATP-dependent RNA helicase DDX3X; n=74;
           Metazoa|Rep: ATP-dependent RNA helicase DDX3X - Homo
           sapiens (Human)
          Length = 662

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E  K   L DL + T   +  ++F  T++  D L + ++   +  +++HGD  QR+RE  
Sbjct: 424 ESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEA 483

Query: 209 MRQFRTGSSRVLITT 253
           + QFR+G S +L+ T
Sbjct: 484 LHQFRSGKSPILVAT 498



 Score = 41.1 bits (92), Expect = 0.026
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 502 ARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLV 561

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 562 EAKQEVPSWLENM 574


>UniRef50_P21693 Cluster: ATP-independent RNA helicase dbpA; n=195;
           cellular organisms|Rep: ATP-independent RNA helicase
           dbpA - Escherichia coli (strain K12)
          Length = 457

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 18/57 (31%), Positives = 38/57 (66%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +  V+FCNT++    + ++++    +  ++HGD++QR+R+  + +F  GS+RVL+ T
Sbjct: 242 SSCVVFCNTKKDCQAVCDALNEVGQSALSLHGDLEQRDRDQTLVRFANGSARVLVAT 298


>UniRef50_A4LYS0 Cluster: DEAD/DEAH box helicase domain protein;
           n=4; Desulfuromonadales|Rep: DEAD/DEAH box helicase
           domain protein - Geobacter bemidjiensis Bem
          Length = 482

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/71 (28%), Positives = 41/71 (57%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K   L  L   + + + +IF NT+R+ ++L + ++  +F    + GD++QR+R  I+  F
Sbjct: 233 KFPLLLGLLRKMGMERTMIFVNTKREAEYLQDRLNANEFPGKVISGDVEQRKRMKILADF 292

Query: 221 RTGSSRVLITT 253
           + G+  ++I T
Sbjct: 293 KDGTLPIMIAT 303



 Score = 36.7 bits (81), Expect = 0.57
 Identities = 21/63 (33%), Positives = 29/63 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RGI ++ VS VINYDLP + E+Y                 +F  E     ++ IEDF  
Sbjct: 307 SRGIHIEGVSHVINYDLPQDCEDYVHRIGRTARAGAEGMAISFADEDGAFYIEPIEDFIK 366

Query: 442 TSI 450
             I
Sbjct: 367 QKI 369


>UniRef50_Q7QDB7 Cluster: ENSANGP00000017541; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000017541 - Anopheles gambiae
           str. PEST
          Length = 771

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF  T++  D L E ++  +F V+++HGD  Q ERE  +R FR G   +L+ T
Sbjct: 569 LIFVETKKAADSLEEFLYNHNFPVTSIHGDRTQAEREEALRLFRCGRCPILVAT 622


>UniRef50_Q3ZDP1 Cluster: Vasa-like protein; n=7; Neoptera|Rep:
           Vasa-like protein - Anopheles gambiae (African malaria
           mosquito)
          Length = 596

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D+L   M    F  +++HGD  QRERE+ +  F++G   VLI T
Sbjct: 427 LVFVETKRNADYLASLMSETQFPTTSIHGDRLQREREMALYDFKSGRMDVLIAT 480



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFV-TEADRRALKDI 426
           ARG+D++ V+ V+NYDLP + ++Y                 +F   EADR    D+
Sbjct: 484 ARGLDIKNVNHVVNYDLPKSIDDYVHRIGRTGRVGNKGRATSFYDPEADRAMASDL 539


>UniRef50_A0EA02 Cluster: Chromosome undetermined scaffold_85, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_85,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 957

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 22/72 (30%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAV-IFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           KL  L ++ D L     V IF  T+++ + L++S+  + +   ++HGD  Q +R+ IM+Q
Sbjct: 302 KLHVLMNVLDDLIYTDKVLIFAETKKRCEDLSQSLTKQGYFCISLHGDKSQDQRDAIMKQ 361

Query: 218 FRTGSSRVLITT 253
           F+  ++R++  T
Sbjct: 362 FKDSNTRLICAT 373


>UniRef50_A0D361 Cluster: Chromosome undetermined scaffold_36, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_36,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 813

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/73 (32%), Positives = 37/73 (50%)
 Frame = +2

Query: 35  EWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMR 214
           E K E   +L D L   + +IFC  +     L   + +       +HGD+ Q ER+ IM 
Sbjct: 661 ENKFEKFAELTDRLKGQKLLIFCQKKLDTQKLEYRLSIHGLKARYLHGDLKQAERDQIMV 720

Query: 215 QFRTGSSRVLITT 253
           +F++G+   LITT
Sbjct: 721 EFKSGAINCLITT 733



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/33 (48%), Positives = 20/33 (60%)
 Frame = +1

Query: 235 SCLDHHCLLARGIDVQQVSCVINYDLPSNRENY 333
           +CL    L +RG+DV  V  VINYD P   E+Y
Sbjct: 728 NCLITTNLASRGLDVSDVDVVINYDFPDTIEDY 760


>UniRef50_O22907 Cluster: DEAD-box ATP-dependent RNA helicase 24;
           n=7; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 24 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 760

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/72 (33%), Positives = 38/72 (52%)
 Frame = +2

Query: 38  WKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           W LE L  + D       ++F + +  VD +   + L  F V+A+HGD DQ  R   +++
Sbjct: 462 WLLEKLPGMIDE---GDVLVFASKKATVDEIEAQLTLNSFKVAALHGDKDQASRMETLQK 518

Query: 218 FRTGSSRVLITT 253
           F++G   VLI T
Sbjct: 519 FKSGVHHVLIAT 530


>UniRef50_P24784 Cluster: ATP-dependent RNA helicase DBP1; n=103;
           Eukaryota|Rep: ATP-dependent RNA helicase DBP1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 617

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/71 (32%), Positives = 37/71 (52%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K   L DL         +IF  T+R  D LT+ + +++F  +A+HGD  Q ERE  +  F
Sbjct: 398 KKSALLDLLSAEHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAF 457

Query: 221 RTGSSRVLITT 253
           +   + +L+ T
Sbjct: 458 KANVADILVAT 468



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 19/73 (26%), Positives = 38/73 (52%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V+ VINYDLPS+ ++Y                 +F    ++  +K + +  +
Sbjct: 472 ARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNNQNIVKGLMEILN 531

Query: 442 TSIVEMPSDVANL 480
            +  E+P+ +++L
Sbjct: 532 EANQEVPTFLSDL 544


>UniRef50_UPI0000F1F65D Cluster: PREDICTED: hypothetical protein;
           n=2; Euteleostomi|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 645

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 19/59 (32%), Positives = 38/59 (64%)
 Frame = +2

Query: 77  SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           S  + ++FC T+++   L+ +  ++  +  ++HGD+ Q++REV ++ FR GS  VL+ T
Sbjct: 405 SHGRTIVFCETKKEATELSLNTSIKQ-SAQSLHGDIPQKQREVTLKGFRNGSFEVLVAT 462


>UniRef50_Q9KKW0 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=19; Vibrio cholerae|Rep: ATP-dependent RNA
           helicase, DEAD box family - Vibrio cholerae
          Length = 428

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + L  L       Q ++F   +   D LT+ ++      + +HGD  Q ERE  + +F
Sbjct: 245 KTQALVALLKQHQWPQVLVFIGAKENADSLTKKLNKAGIVATVLHGDKSQSEREAALAEF 304

Query: 221 RTGSSRVLITT 253
           + G+++VLI T
Sbjct: 305 KNGTTQVLIAT 315


>UniRef50_A6DK15 Cluster: ATP-dependent RNA helicase, specific for
           23S rRNA; n=1; Lentisphaera araneosa HTCC2155|Rep:
           ATP-dependent RNA helicase, specific for 23S rRNA -
           Lentisphaera araneosa HTCC2155
          Length = 462

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 23/80 (28%), Positives = 43/80 (53%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           +  +  E  +L  L  L D      AV+FCNT+++   + + +    F+  A+HGD++Q+
Sbjct: 222 FYKVTSESQRLLGLQLLLDKFKSESAVVFCNTKQEAKDICKDLSKVGFSTLALHGDLEQK 281

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +R+  + +F   S  VL+ T
Sbjct: 282 DRQENLVRFANKSVAVLVAT 301


>UniRef50_A2U1Q9 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family protein; n=4; Flavobacteriaceae|Rep:
           ATP-dependent RNA helicase, DEAD/DEAH box family protein
           - Polaribacter dokdonensis MED152
          Length = 373

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 3/72 (4%)
 Frame = +2

Query: 47  ETLCDLYDTLSIAQA---VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           E + D+   L   QA   +IFC T+     L + +    F+ +A+ GDM Q+ER+ +MR 
Sbjct: 231 EKVADIVTFLEKRQAQRGIIFCRTKAGAQNLAKQLVDEGFSAAALEGDMQQKERDKVMRA 290

Query: 218 FRTGSSRVLITT 253
           F+  S + LI+T
Sbjct: 291 FKNESLQYLIST 302


>UniRef50_A1UCR5 Cluster: DEAD/DEAH box helicase domain protein;
           n=31; Actinobacteria (class)|Rep: DEAD/DEAH box helicase
           domain protein - Mycobacterium sp. (strain KMS)
          Length = 507

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 23/71 (32%), Positives = 36/71 (50%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+E +  +         +IF  T+R    + + +  R F V A+HGD+ Q  RE  ++ F
Sbjct: 247 KVEMVSRILQAEGRGATMIFTRTKRTAQKVADELAERGFKVGAVHGDLGQGAREKALKSF 306

Query: 221 RTGSSRVLITT 253
           RTG   VL+ T
Sbjct: 307 RTGEVDVLVAT 317


>UniRef50_Q012T2 Cluster: DEAD-box protein abstrakt; n=3;
           Ostreococcus|Rep: DEAD-box protein abstrakt -
           Ostreococcus tauri
          Length = 1025

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 24/76 (31%), Positives = 42/76 (55%)
 Frame = +2

Query: 26  ELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           E +E     +C+L D    ++ VIF NT+R+V+ L ++     F V ++HGD  Q +RE 
Sbjct: 282 EKDEHLYNLICELPDD---SRVVIFANTKRRVENLAKTFSAEGFGVVSVHGDKSQADREA 338

Query: 206 IMRQFRTGSSRVLITT 253
            +R+F      +++ T
Sbjct: 339 SLRKFIDNKCPLMMAT 354


>UniRef50_A5K9H3 Cluster: Pre-mRNA splicing factor RNA helicase PRP28,
            putative; n=2; Eukaryota|Rep: Pre-mRNA splicing factor
            RNA helicase PRP28, putative - Plasmodium vivax
          Length = 1006

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/71 (35%), Positives = 36/71 (50%)
 Frame = +1

Query: 265  RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHT 444
            RGIDVQ V  VIN+D+P + E+Y                 +FVTE D     D++ F  +
Sbjct: 912  RGIDVQGVKLVINFDMPKDIESYTHRIGRTGRAGMKGMAISFVTEQDSHLFYDLKQFLIS 971

Query: 445  SIVEMPSDVAN 477
            S   +P ++AN
Sbjct: 972  SNNIVPMELAN 982



 Score = 37.5 bits (83), Expect = 0.32
 Identities = 19/71 (26%), Positives = 35/71 (49%)
 Frame = +2

Query: 41   KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
            KL+ + + Y+    A  ++F N ++  D + +S+    F   A+HG   Q  RE  +  F
Sbjct: 841  KLQEILEEYE----APIIVFVNQKKVADIIAKSISKMKFRAVALHGGKAQELREQTLNSF 896

Query: 221  RTGSSRVLITT 253
            + G   +L+ T
Sbjct: 897  KNGDFDILVAT 907


>UniRef50_Q9NR30 Cluster: Nucleolar RNA helicase 2; n=51;
           Euteleostomi|Rep: Nucleolar RNA helicase 2 - Homo
           sapiens (Human)
          Length = 783

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 18/56 (32%), Positives = 37/56 (66%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IFC T+++   L+++  ++     ++HGD+ Q++RE+ ++ FR GS  VL+ T
Sbjct: 440 RTIIFCETKKEAQELSQNSAIKQ-DAQSLHGDIPQKQREITLKGFRNGSFGVLVAT 494


>UniRef50_Q5BFU7 Cluster: ATP-dependent RNA helicase dbp10; n=14;
           Pezizomycotina|Rep: ATP-dependent RNA helicase dbp10 -
           Emericella nidulans (Aspergillus nidulans)
          Length = 936

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 20/71 (28%), Positives = 41/71 (57%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           ++E   ++ ++ +    ++F  T+  VD+L   +    F VS ++G +DQ  R++ ++ F
Sbjct: 360 EMERAVNMKESPTKHSTIVFAATKHHVDYLYSLLREAGFAVSYVYGSLDQTARKIQVQNF 419

Query: 221 RTGSSRVLITT 253
           RTG S +L+ T
Sbjct: 420 RTGISNILVVT 430


>UniRef50_Q2LY23 Cluster: Superfamily II DNA and RNA helicases; n=2;
           Bacteria|Rep: Superfamily II DNA and RNA helicases -
           Syntrophus aciditrophicus (strain SB)
          Length = 572

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 18/55 (32%), Positives = 35/55 (63%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A+IFC TR +   + + +    ++  A+HGD+ Q +R+ +M +FR+ + R+L+ T
Sbjct: 245 AIIFCRTRLETREIVDKLIEDGYSADALHGDLSQSQRDHVMHKFRSRNIRMLVAT 299


>UniRef50_Q1QYG3 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Chromohalobacter salexigens DSM 3043|Rep: DEAD/DEAH box
           helicase-like protein - Chromohalobacter salexigens
           (strain DSM 3043 / ATCC BAA-138 / NCIMB13768)
          Length = 568

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 25/71 (35%), Positives = 36/71 (50%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           KLE L  L +   +  A++F  TR     L E + LR    +A+ GD+DQ  RE  + + 
Sbjct: 235 KLEALSRLLEVEPVDAAIVFVRTRAACTTLVEQLLLRGVNAAALSGDLDQSLRERTVERL 294

Query: 221 RTGSSRVLITT 253
           + G   VLI T
Sbjct: 295 KRGKVDVLIAT 305



 Score = 35.9 bits (79), Expect = 0.99
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 2/73 (2%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV +++ V NYDLP + E Y                  F    ++R ++D+E    
Sbjct: 309 ARGLDVPRITHVFNYDLPQDAEAYTHRIGRTGRAGRTGVAITFAGGREQRRVRDMERVTG 368

Query: 442 TSI--VEMPSDVA 474
             +  VE+P + A
Sbjct: 369 QQMQEVELPDEDA 381


>UniRef50_Q0C4R1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=1; Hyphomonas neptunium ATCC 15444|Rep:
           ATP-dependent RNA helicase, DEAD/DEAH box family -
           Hyphomonas neptunium (strain ATCC 15444)
          Length = 708

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A++FC+TR  V+ L   +  R F+V A+ G+  Q+ER   +   R+G +RV I T
Sbjct: 248 AIVFCSTRASVNHLVARLGNRGFSVVALSGEFSQKERANALSSLRSGRARVCIAT 302


>UniRef50_A5G1U8 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Acidiphilium cryptum JF-5|Rep: DEAD/DEAH box
           helicase domain protein - Acidiphilium cryptum (strain
           JF-5)
          Length = 525

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = +2

Query: 35  EWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMR 214
           E K + L  L   +++ +A++F  T+   D +T  +       +A+HG+  Q +RE  + 
Sbjct: 285 EEKKDKLAWLLADVAVERAIVFTRTKHGADKVTRHLEDAGIGAAAIHGNKSQGQRERALD 344

Query: 215 QFRTGSSRVLITT 253
           QFR+G  RVL+ T
Sbjct: 345 QFRSGRIRVLVAT 357



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           + ARGIDV  VS V+N++LP+  E+Y                 + V  ++   L+DIE
Sbjct: 359 IAARGIDVDNVSHVVNFELPNVPESYVHRIGRTARAGAEGVAISLVEPSELPYLRDIE 416


>UniRef50_Q16XX4 Cluster: DEAD box ATP-dependent RNA helicase; n=5;
           Neoptera|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 911

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 22/74 (29%), Positives = 44/74 (59%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           +E KL +L     +   ++ +IF  T++KV+ L +++    +  +++HGD  Q ER+ ++
Sbjct: 462 KEGKLLSLLKEISSDVNSKIIIFVETKKKVEDLLKNIVRDGYGATSIHGDKSQSERDYVL 521

Query: 212 RQFRTGSSRVLITT 253
           + FR G S +L+ T
Sbjct: 522 QDFRHGKSTILVAT 535



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV+ V  VIN+D P++ E+Y
Sbjct: 539 ARGLDVEDVKYVINFDYPNSSEDY 562


>UniRef50_A4RBW7 Cluster: Putative uncharacterized protein; n=4;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 619

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLR-DFTVSAMHGDMDQREREVIMRQ 217
           K   L DL +++   + +IF N +   D L + ++       ++MH D  QRERE  +R 
Sbjct: 373 KKRALNDLINSMPPQRTIIFVNNKWTADELDDYLYNECKLPCTSMHADRTQREREDALRA 432

Query: 218 FRTGSSRVLITT 253
           FR G++ +L+TT
Sbjct: 433 FRAGTAPILVTT 444



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 14/19 (73%), Positives = 17/19 (89%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPS 318
           ARGIDV+ V+ V+NYDLPS
Sbjct: 448 ARGIDVRNVAHVVNYDLPS 466


>UniRef50_P93008 Cluster: DEAD-box ATP-dependent RNA helicase 21;
           n=8; Viridiplantae|Rep: DEAD-box ATP-dependent RNA
           helicase 21 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 733

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 22/80 (27%), Positives = 40/80 (50%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           ++ +  E  K   L  L D L    A++F NT++  D + +++    + V+ +HG   Q 
Sbjct: 554 HVIMMKESEKFFRLQKLLDELGEKTAIVFVNTKKNCDSIAKNLDKAGYRVTTLHGGKSQE 613

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +RE+ +  FR     VL+ T
Sbjct: 614 QREISLEGFRAKRYNVLVAT 633



 Score = 36.7 bits (81), Expect = 0.57
 Identities = 20/73 (27%), Positives = 33/73 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           ++ RGID+  V+ VINYD+P + E Y                 +F+T  D     D++  
Sbjct: 635 VVGRGIDIPDVAHVINYDMPKHIEMYTHRIGRTGRAGKSGVATSFLTLHDTEVFYDLKQM 694

Query: 436 YHTSIVEMPSDVA 474
              S   +P ++A
Sbjct: 695 LVQSNSAVPPELA 707


>UniRef50_UPI0000E48294 Cluster: PREDICTED: similar to DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 21a; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           DEAD (Asp-Glu-Ala-Asp) box polypeptide 21a -
           Strongylocentrotus purpuratus
          Length = 657

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/56 (37%), Positives = 34/56 (60%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++FC T+R  + L  S  ++  T   MHGD+ Q +REV ++ FR G  + L+TT
Sbjct: 355 RCMVFCETKRDANELAMSSDVKQET-QVMHGDIPQTQREVTLKGFREGKFQCLVTT 409


>UniRef50_Q9DF36 Cluster: RNA helicase II/Gu; n=9; Tetrapoda|Rep:
           RNA helicase II/Gu - Xenopus laevis (African clawed
           frog)
          Length = 800

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/59 (33%), Positives = 36/59 (61%)
 Frame = +2

Query: 77  SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           S  + +IFC+++ +   L+ +      +   +HGD+ Q+EREV+++ FR G+  VLI T
Sbjct: 472 SHGKTIIFCDSKLQAHELSTNCGSLKQSAKPLHGDLQQKEREVVLKGFRQGTFEVLIAT 530


>UniRef50_Q9PGP6 Cluster: ATP-dependent RNA helicase; n=10; cellular
           organisms|Rep: ATP-dependent RNA helicase - Xylella
           fastidiosa
          Length = 614

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           KL+ L  + +  +    +IF  T+   + L E +  R  T +A++GDM Q +RE  + Q 
Sbjct: 241 KLDALTRILEVETFDAMIIFVRTKAATEELAEKLQARGLTAAAINGDMQQAQRERTIHQL 300

Query: 221 RTGSSRVLITT 253
           + G   +L+ T
Sbjct: 301 KDGKLDILVAT 311



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+++S V+NYD+P + E+Y                  FVT  ++  L+ IE   H
Sbjct: 315 ARGLDVERISHVLNYDIPYDVESYVHRIGRTGRAGRSGEAILFVTPREKGMLRQIERATH 374

Query: 442 TSI--VEMPS-DVAN 477
             I  +++PS D  N
Sbjct: 375 QPIEAMQLPSVDAVN 389


>UniRef50_Q98RE0 Cluster: ATP-DEPENDENT RNA HELICASE; n=1;
           Mycoplasma pulmonis|Rep: ATP-DEPENDENT RNA HELICASE -
           Mycoplasma pulmonis
          Length = 480

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/74 (31%), Positives = 39/74 (52%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           EE KL TL    D      +VIF  T+R+VD L  ++    F+   + GDM Q++R  ++
Sbjct: 223 EEEKLITLVKFLDFKKPTASVIFGRTKRRVDELASALQELGFSAVGIQGDMVQKDRTSVL 282

Query: 212 RQFRTGSSRVLITT 253
            +F+     +++ T
Sbjct: 283 NRFKDQKVNIIVAT 296



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           ++ARGIDV  V  V N+DLP   E Y
Sbjct: 298 VMARGIDVSHVDLVFNFDLPEEIEYY 323


>UniRef50_Q8D3Y6 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=8; Gammaproteobacteria|Rep: ATP-dependent RNA
           helicase, DEAD box family - Vibrio vulnificus
          Length = 447

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 26/82 (31%), Positives = 40/82 (48%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           RFY+   L+  K   L  +       Q +IF  TR   D LTE ++ +     A+ G ++
Sbjct: 227 RFYLCDHLDH-KEALLERVLSEAEYRQVIIFTATRSDTDRLTEKLNEKKLKAIALSGSLN 285

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +R  IM QF     ++L+TT
Sbjct: 286 QNQRNTIMSQFERTVFKILVTT 307


>UniRef50_A3ZWP8 Cluster: ATP-dependent RNA helicase; n=1;
           Blastopirellula marina DSM 3645|Rep: ATP-dependent RNA
           helicase - Blastopirellula marina DSM 3645
          Length = 428

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + L +L       +A++FC T+R  + +T+ +  +   V  +HGDM Q  R   +  F
Sbjct: 231 KFDMLVELLKREQPQKAIVFCRTKRGTERITQRLSKKTKLVHCIHGDMQQGARNRALSDF 290

Query: 221 RTGSSRVLITT 253
           +    RVL+ T
Sbjct: 291 KASKFRVLVAT 301



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 22/76 (28%), Positives = 33/76 (43%)
 Frame = +1

Query: 202 SDHEAVSYWLFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXX 381
           SD +A  + +    D   ++ RGID+  VS +INYD+P   ++Y                
Sbjct: 288 SDFKASKFRVLVATD---VVGRGIDISDVSHIINYDIPEFSDDYVHRVGRTGRMGKEGIA 344

Query: 382 XNFVTEADRRALKDIE 429
             FVT  +   L  IE
Sbjct: 345 YTFVTPEEGNELTRIE 360


>UniRef50_A3I1F5 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Algoriphagus sp. PR1|Rep: DEAD/DEAH box helicase-like
           protein - Algoriphagus sp. PR1
          Length = 399

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/71 (28%), Positives = 38/71 (53%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K   L DL+   ++ + ++F  T+R  D L++ ++        +HG+  Q  R   + QF
Sbjct: 281 KFGMLADLFQNRAMDKVIVFTETKRLADRLSKKLNQAGVKSGLIHGNKSQNFRNKTIEQF 340

Query: 221 RTGSSRVLITT 253
           ++G +RVL+ T
Sbjct: 341 KSGETRVLVAT 351



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 15/24 (62%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGIDV  VS VINY LP   ++Y
Sbjct: 355 ARGIDVADVSHVINYQLPMTMDSY 378


>UniRef50_A4V6M8 Cluster: Nucleolar RNA helicase II/Gu protein; n=2;
           Dugesia japonica|Rep: Nucleolar RNA helicase II/Gu
           protein - Dugesia japonica (Planarian)
          Length = 627

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITTVYW 262
           A+ +IFC  ++  D L     ++      +HGD+ Q +RE+++++FR G   VL+TT   
Sbjct: 301 ARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTT--- 356

Query: 263 HVVLMYSKFPASSTMI-CHP 319
           +V       P    +I CHP
Sbjct: 357 NVAARGLDVPDIDLVIQCHP 376


>UniRef50_Q2H6N4 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 512

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A+IFCN     D+L   + L D  V+A+H  + QR+R   + +FR  ++R+L+ T
Sbjct: 339 AIIFCNRTSTADYLHHLLRLLDHRVTALHSRLPQRQRIDNLGRFRASAARILVAT 393



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+ +V  VINYD+P + ++Y
Sbjct: 397 ARGLDIPEVKLVINYDIPRDPDDY 420


>UniRef50_Q13838 Cluster: Spliceosome RNA helicase BAT1; n=55;
           Eukaryota|Rep: Spliceosome RNA helicase BAT1 - Homo
           sapiens (Human)
          Length = 428

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.026
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>UniRef50_Q9CL21 Cluster: ATP-dependent DNA helicase recQ; n=71;
           Proteobacteria|Rep: ATP-dependent DNA helicase recQ -
           Pasteurella multocida
          Length = 632

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 1/77 (1%)
 Frame = +2

Query: 29  LEEWK-LETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREV 205
           +E++K +E LC           +I+CN+R KV+ + ES+  +  +  A H  ++  +RE 
Sbjct: 231 VEKFKPMEQLCRFVLGQKGKSGIIYCNSRSKVERIAESLRNKGVSAQAYHAGLETSQREQ 290

Query: 206 IMRQFRTGSSRVLITTV 256
           + R F+  + +V++ T+
Sbjct: 291 VQRAFQRDNVQVVVATI 307


>UniRef50_Q8SRB2 Cluster: ATP-dependent RNA helicase DBP2; n=103;
           Eukaryota|Rep: ATP-dependent RNA helicase DBP2 -
           Encephalitozoon cuniculi
          Length = 495

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + L  + D     + ++FCN +R  D L   ++   +  +A+HGD  Q  R+ ++  F
Sbjct: 318 KEDKLIGVLDNFKGDKVIVFCNMKRTCDDLEYVLNRSGYGAAALHGDKSQNIRDKVLDDF 377

Query: 221 RTGSSRVLITT 253
           R+G   +LI T
Sbjct: 378 RSGRRPILIAT 388


>UniRef50_Q81RE0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=9; Bacillus cereus group|Rep: ATP-dependent
           RNA helicase, DEAD/DEAH box family - Bacillus anthracis
          Length = 389

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +AV F N   ++D +TE +  R    +A+H +  ++ERE  MR FR G   +L+ T
Sbjct: 236 KAVAFLNDPFRLDEITEKLKFRKMKAAALHAEASKQEREATMRAFRGGKLEILLAT 291


>UniRef50_A6H0L1 Cluster: Probable ATP-dependent RNA helicase,
           DEAD/DEAH box family; n=1; Flavobacterium psychrophilum
           JIP02/86|Rep: Probable ATP-dependent RNA helicase,
           DEAD/DEAH box family - Flavobacterium psychrophilum
           (strain JIP02/86 / ATCC 49511)
          Length = 644

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           + E L  L D      +V+FC T+R    + E +    ++ +A+HGD+ Q +R+ +M+ F
Sbjct: 229 RYEALKRLADANPDIFSVVFCRTKRDTQAVAEKLVEDGYSAAALHGDLSQAQRDGVMKAF 288

Query: 221 RTGSSRVLITT 253
           R    ++L+ T
Sbjct: 289 RGRQIQMLVAT 299



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 19/56 (33%), Positives = 25/56 (44%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARGIDV  V+ V+NY LP   E Y                   VT+++ R +  IE
Sbjct: 303 ARGIDVDNVTHVVNYQLPDEIETYNHRSGRTGRAGKLGTSIVIVTKSEIRKISSIE 358


>UniRef50_A3N1C2 Cluster: ATP-dependent DNA helicase RecQ; n=2;
           Actinobacillus pleuropneumoniae|Rep: ATP-dependent DNA
           helicase RecQ - Actinobacillus pleuropneumoniae serotype
           5b (strain L20)
          Length = 602

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 16/55 (29%), Positives = 34/55 (61%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITTV 256
           +++CN+R+KV+ +TE +  R  +V   H  M  ++RE +   F+  + +V++ T+
Sbjct: 235 IVYCNSRKKVEEITEKLASRKISVMGYHAGMSVQQRETVQNAFQRDNIQVVVATI 289


>UniRef50_Q1AG34 Cluster: Ded1-like DEAD-box RNA helicase; n=1;
           Chironomus tentans|Rep: Ded1-like DEAD-box RNA helicase
           - Chironomus tentans (Midge)
          Length = 776

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/54 (37%), Positives = 33/54 (61%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF  T++  D L E ++     V+++HGD  QRERE  ++ FR+G   +L+ T
Sbjct: 536 LIFVETKKGADALEEFLYQNKHPVTSIHGDRSQREREDALKCFRSGDCPILVAT 589



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 22/68 (32%), Positives = 32/68 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VINYDLPS+ E Y                 +F  E +R  + D+ +   
Sbjct: 593 ARGLDIPHVKHVINYDLPSDVEEYVHRIGRTGRMGNLGIATSFFNEKNRNIVSDLVELLI 652

Query: 442 TSIVEMPS 465
            +  E+PS
Sbjct: 653 ETNQELPS 660


>UniRef50_Q17KA8 Cluster: DEAD box ATP-dependent RNA helicase; n=1;
           Aedes aegypti|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 718

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = +2

Query: 32  EEWKLET-LCDLYDTLSI---AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRER 199
           EE++ ET L  L   LS    ++++IF  T+RKVD +T  +    +    +HGD  Q++R
Sbjct: 328 EEYEKETRLFKLLTELSQQGDSKSIIFVETKRKVDQITNVIKRNGWRCDGIHGDKTQKDR 387

Query: 200 EVIMRQFRTGSSRVLITT 253
           + ++  FR   S +L+ T
Sbjct: 388 DYVLNTFRRLRSGILVAT 405



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV  V  VIN+D P+N E+Y
Sbjct: 409 SRGLDVDDVKYVINFDFPNNTEDY 432


>UniRef50_A2EVI2 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 598

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/80 (26%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query: 17  IAIELEEW-KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           +  + EE+ KL    ++ +     + +IF  T+R  D L E+++++ F   ++HGD  Q 
Sbjct: 347 VITKCEEFEKLSKCLEVLNEHKDDKIIIFTKTKRTTDDLQENLNMKGFQAYSLHGDKAQN 406

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +R+ ++ +FR+    +L+ T
Sbjct: 407 QRDFVLGKFRSCKKGILVAT 426



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 17/67 (25%), Positives = 27/67 (40%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  +  VINYD P + E Y                  F T+ ++   + +     
Sbjct: 430 ARGLDVNDIDIVINYDFPGDIETYVHRIGRTARGNKEGLAVTFFTDENKNMSRKLAKIMT 489

Query: 442 TSIVEMP 462
            +  E+P
Sbjct: 490 QAKQELP 496


>UniRef50_Q27268 Cluster: ATP-dependent RNA helicase WM6; n=82;
           Eukaryota|Rep: ATP-dependent RNA helicase WM6 -
           Drosophila melanogaster (Fruit fly)
          Length = 424

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L +++D
Sbjct: 343 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNEVQD 402

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 403 RFDVNISELPEEI 415



 Score = 37.5 bits (83), Expect = 0.32
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  K + L +L D L   Q VIF  + ++   L++ +  ++F    +H  M Q ER    
Sbjct: 268 ENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLNRY 327

Query: 212 RQFRTGSSRVLITT 253
           +QF+    R+L+ T
Sbjct: 328 QQFKDFQKRILVAT 341


>UniRef50_P0A9P8 Cluster: Cold-shock DEAD box protein A; n=54;
           Gammaproteobacteria|Rep: Cold-shock DEAD box protein A -
           Shigella flexneri
          Length = 629

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+++S V+NYD+P + E+Y                  FV   +RR L++IE    
Sbjct: 306 ARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLRNIERTMK 365

Query: 442 TSIVEMPSDVANLI 483
            +I E+    A L+
Sbjct: 366 LTIPEVELPNAELL 379



 Score = 36.3 bits (80), Expect = 0.75
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L    +      A+IF  T+     + E++    +  +A++GDM+Q  RE  + + 
Sbjct: 232 KNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERL 291

Query: 221 RTGSSRVLITT 253
           + G   +LI T
Sbjct: 292 KDGRLDILIAT 302


>UniRef50_P44586 Cluster: Cold-shock DEAD box protein A homolog;
           n=20; Pasteurellaceae|Rep: Cold-shock DEAD box protein A
           homolog - Haemophilus influenzae
          Length = 613

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGID++++S V+NYD+P + E+Y                  FV   +RR L++IE    
Sbjct: 305 ARGIDIERISLVVNYDIPLDAESYVHRIGRTGRAGRSGRALLFVEPRERRLLRNIEHLMK 364

Query: 442 TSI--VEMPS 465
             I  VE+P+
Sbjct: 365 KGINEVELPN 374



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 21/71 (29%), Positives = 35/71 (49%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L    +      A+IF  T+     +TE +    F  +A++GDM Q+ RE  + + 
Sbjct: 231 KNEALLRFLEVEDFDAAIIFARTKTGTLDITELLEKNGFRSAALNGDMTQQLREQTLDRL 290

Query: 221 RTGSSRVLITT 253
           R GS  +++ T
Sbjct: 291 RNGSLDIVVAT 301


>UniRef50_Q8A2K2 Cluster: ATP-dependent RNA helicase; n=10; cellular
           organisms|Rep: ATP-dependent RNA helicase - Bacteroides
           thetaiotaomicron
          Length = 647

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 17/70 (24%), Positives = 40/70 (57%)
 Frame = +2

Query: 44  LETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFR 223
           L+ + D Y  +     +IFC TR++   + + +    +   ++HG++ Q +R+ +M++FR
Sbjct: 233 LKRIVDYYPQI---YGIIFCRTRKETQEIADKLMQEGYNADSLHGELSQAQRDAVMQKFR 289

Query: 224 TGSSRVLITT 253
             + ++L+ T
Sbjct: 290 IRNLQLLVAT 299


>UniRef50_Q835K0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=55; Lactobacillales|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Enterococcus faecalis
           (Streptococcus faecalis)
          Length = 449

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/67 (31%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +2

Query: 62  LYDTLSIAQ---AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGS 232
           +Y  L+I     A++F NT+++VD +T+ +  +   V+ +HGD+  RER+ +MRQ +   
Sbjct: 234 IYQLLTIGHPYLAIVFANTKQRVDEITDYLKDQGLKVAKIHGDITPRERKRVMRQVQNLD 293

Query: 233 SRVLITT 253
            + ++ T
Sbjct: 294 YQYVVAT 300


>UniRef50_Q81JK1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=30; Firmicutes|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Bacillus anthracis
          Length = 481

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/74 (32%), Positives = 36/74 (48%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           EE KL  L D+    +    +IFC T+  VD +   +   ++    +HG M Q +R  +M
Sbjct: 226 EEEKLSLLKDVTTIENPDSCIIFCRTQENVDHVYRQLDRVNYPCDKIHGGMVQEDRFGVM 285

Query: 212 RQFRTGSSRVLITT 253
             FR G  R L+ T
Sbjct: 286 DDFRKGKFRYLVAT 299



 Score = 41.1 bits (92), Expect = 0.026
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           ARGID+  ++ VINYD+P  +E+Y                  F+T  + R L++IE +
Sbjct: 303 ARGIDIDNITHVINYDIPLEKESYVHRTGRTGRAGNSGKAITFITPYEDRFLEEIEAY 360


>UniRef50_Q5FLW7 Cluster: RNA helicase; n=9; Lactobacillus|Rep: RNA
           helicase - Lactobacillus acidophilus
          Length = 453

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +2

Query: 62  LYDTLSIAQ---AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGS 232
           LY  L++ Q   A++F NT++KVD LT+ +  +   V+ +HG + +RER+  +RQ   G 
Sbjct: 235 LYKVLTMGQPYLALVFANTKQKVDELTKFLQDQGLKVAKIHGGVTERERKRTLRQVEQGQ 294

Query: 233 SRVLITT 253
            + ++ +
Sbjct: 295 YQYVVAS 301



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 1/69 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L ARG+D+  VS V+NY++P + E                     + E +   ++D+E  
Sbjct: 303 LAARGLDIDGVSLVVNYEIPRDIEFVIHRIGRTGRNGLSGHAVTLIREEEMNRIEDLEKM 362

Query: 436 -YHTSIVEM 459
             H   VE+
Sbjct: 363 GVHFDFVEI 371


>UniRef50_Q185X0 Cluster: ATP-dependent RNA helicase; n=3;
           Clostridium difficile|Rep: ATP-dependent RNA helicase -
           Clostridium difficile (strain 630)
          Length = 497

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/76 (30%), Positives = 37/76 (48%)
 Frame = +1

Query: 232 FSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRR 411
           F+ L    + +RGI +  +S VINYD+P ++ENY                   VTE D +
Sbjct: 296 FNILVSSDVASRGIHIDDISLVINYDVPQDKENYIHRIGRTGRKGNSGKAITIVTEKDEK 355

Query: 412 ALKDIEDFYHTSIVEM 459
            +++IE +    I E+
Sbjct: 356 YIENIETYIGYKINEL 371



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IFCNT+ KV  L   M    F +  +H D+ Q  R  +++ F+     +L+++
Sbjct: 249 IIFCNTKEKVSKLYNKMSKEGFLIRELHADLSQERRIFVIKDFKNQKFNILVSS 302


>UniRef50_A3PFY9 Cluster: DEAD/DEAH box helicase domain protein;
           n=10; Alphaproteobacteria|Rep: DEAD/DEAH box helicase
           domain protein - Rhodobacter sphaeroides (strain ATCC
           17029 / ATH 2.4.9)
          Length = 793

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/55 (40%), Positives = 32/55 (58%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A++FC TR  V+ L   M  R F V A+ G++ Q+ER   ++  R G +RV I T
Sbjct: 262 AIVFCKTRLAVNHLLARMGNRGFQVVALSGELSQQERTHALQALRDGRARVCIAT 316


>UniRef50_A0JYP4 Cluster: DEAD/DEAH box helicase domain protein;
           n=7; Actinomycetales|Rep: DEAD/DEAH box helicase domain
           protein - Arthrobacter sp. (strain FB24)
          Length = 585

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/71 (30%), Positives = 35/71 (49%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+E +  +       + +IF  T+R    + E +  R F  +A+HGD+ Q  RE  +R F
Sbjct: 275 KIEVVARILQARGRGRTIIFTKTKRTAAKVAEELVDRGFAAAAIHGDLGQGAREQALRAF 334

Query: 221 RTGSSRVLITT 253
           R     VL+ T
Sbjct: 335 RNNKVDVLVAT 345


>UniRef50_Q00T47 Cluster: Putative RNA helicase, DRH1; n=1;
           Ostreococcus tauri|Rep: Putative RNA helicase, DRH1 -
           Ostreococcus tauri
          Length = 1118

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFT-VSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R+ D+L   +    F+   ++HGD DQ ERE+++  FR G   +L+ T
Sbjct: 356 IMFAGTKRRCDFLDRRLKQVGFSSAGSIHGDKDQYEREMVLDNFRRGRGNILVAT 410


>UniRef50_A5BHG9 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 757

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/57 (33%), Positives = 35/57 (61%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A  ++F  T+R VD L + + +     +A+HGD  Q ERE  M+ F++G++ +++ T
Sbjct: 533 ALTLVFVETKRGVDALEQWLCMNGLAATAIHGDKVQMERERAMKSFKSGATPIMVAT 589



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 18/68 (26%), Positives = 29/68 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V+ VIN+DLP   ++Y                  F  + +    K + +   
Sbjct: 593 ARGLDIPHVAHVINFDLPKAIDDYVHRIGRTGRAGKSGLATAFFNDGNLSLAKSLVELMQ 652

Query: 442 TSIVEMPS 465
            S  E+PS
Sbjct: 653 ESNQEVPS 660


>UniRef50_A2WLP5 Cluster: Putative uncharacterized protein; n=3;
           Magnoliophyta|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 523

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/81 (25%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLY-DTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQ 190
           ++ I  E  K   L +L  D +  ++ +IF +T++  D +T  + +  +   ++HGD  Q
Sbjct: 289 HVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQ 348

Query: 191 REREVIMRQFRTGSSRVLITT 253
            ER+ ++ +F++G S ++  T
Sbjct: 349 AERDWVLSEFKSGKSPIMTAT 369



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 20/55 (36%), Positives = 26/55 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+DV+ V  VINYD P + E+Y                  F T A+ R  KD+
Sbjct: 373 ARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDL 427


>UniRef50_Q24I45 Cluster: DEAD/DEAH box helicase family protein;
           n=2; Tetrahymena thermophila|Rep: DEAD/DEAH box helicase
           family protein - Tetrahymena thermophila SB210
          Length = 713

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAV-IFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           K+  L    D L+    V IF  T++  + ++  ++   F   A+HGD  Q++R+ +M +
Sbjct: 333 KINQLIKQLDCLTQKDKVLIFAQTKKGCESMSRILNKEGFKCLAIHGDKAQKDRDYVMNK 392

Query: 218 FRTGSSRVLITT 253
           F++G  R+LI T
Sbjct: 393 FKSGECRILIAT 404



 Score = 39.9 bits (89), Expect = 0.061
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 1/74 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIEDFY 438
           +RG+DV+ VS V NYD P   E+Y                 +F+T E D++  ++     
Sbjct: 408 SRGLDVKDVSHVFNYDFPKVMEDYVHRIGRTGRAGAYGCAVSFLTFEDDKKISREYVQML 467

Query: 439 HTSIVEMPSDVANL 480
           H +  E+P D+ +L
Sbjct: 468 HDAKQEIPIDLLDL 481


>UniRef50_Q0W8H7 Cluster: ATP-dependent RNA helicase; n=1;
           uncultured methanogenic archaeon RC-I|Rep: ATP-dependent
           RNA helicase - Uncultured methanogenic archaeon RC-I
          Length = 497

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/82 (30%), Positives = 44/82 (53%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++YI +  E+ K E L  L D      A++F  TR +V  L +++  R +    +HGD+ 
Sbjct: 217 QYYIEMP-EKQKFEALTRLLDQEKPELAIVFVATRIRVGELAKALVERGYHALGLHGDLL 275

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +RE  + +F+ G   +L+ T
Sbjct: 276 QYQRENTLDKFKAGEVSILVAT 297



 Score = 40.3 bits (90), Expect = 0.046
 Identities = 21/68 (30%), Positives = 32/68 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+Q V+ V N+D+P + ++Y                  FVT  D+ AL+ IE    
Sbjct: 301 ARGLDIQGVTHVYNFDIPRDPDSYVHRIGRTGRAGNAGTATTFVTPKDKTALEAIEQAID 360

Query: 442 TSIVEMPS 465
             I   P+
Sbjct: 361 HQITSKPA 368


>UniRef50_A4FZ46 Cluster: DEAD/DEAH box helicase domain protein;
           n=4; Euryarchaeota|Rep: DEAD/DEAH box helicase domain
           protein - Methanococcus maripaludis
          Length = 541

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L  + D       +IFC T+  VD ++  ++ + +    +HGDM Q +RE  + +F
Sbjct: 228 KFELLSRIIDLEKEFYGLIFCKTKADVDEVSSRLNEKGYAAEGLHGDMTQAQREKTLDKF 287

Query: 221 RTGSSRVLITT 253
           +     VL+ T
Sbjct: 288 KGRKINVLVAT 298



 Score = 40.3 bits (90), Expect = 0.046
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGID+  ++ V+NYD+P N E+Y                  FV  ++ R  K I+    
Sbjct: 302 ARGIDINDLTHVVNYDIPQNPESYVHRIGRTGRAGKQGYAVTFVEPSEFRKFKYIQKIAK 361

Query: 442 TSI-VEMPSDVANLI 483
           T I  E   DV ++I
Sbjct: 362 TEIRKEEVPDVKDII 376


>UniRef50_Q56XG6 Cluster: DEAD-box ATP-dependent RNA helicase 15;
           n=27; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           15 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 427

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIED 432
           L+ RGID+++V+ VINYD+P + + Y                  FV  A D   L  +++
Sbjct: 347 LVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQE 406

Query: 433 FYHTSIVEMPSDV 471
            +   I E+P  +
Sbjct: 407 RFEVDIKELPEQI 419


>UniRef50_Q9VHP0 Cluster: ATP-dependent RNA helicase bel; n=4;
           Protostomia|Rep: ATP-dependent RNA helicase bel -
           Drosophila melanogaster (Fruit fly)
          Length = 798

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF  T++  D L E ++  +  V+++HGD  Q+ERE  +R FR+G   +L+ T
Sbjct: 563 LIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVAT 616



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 21/68 (30%), Positives = 31/68 (45%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +R    D+ +   
Sbjct: 620 ARGLDIPHVKHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNEKNRNICSDLLELLI 679

Query: 442 TSIVEMPS 465
            +  E+PS
Sbjct: 680 ETKQEIPS 687


>UniRef50_Q9KNA4 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=48; Gammaproteobacteria|Rep: ATP-dependent RNA
           helicase, DEAD box family - Vibrio cholerae
          Length = 452

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  FYIAIELEEWKLETLCD-LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           FY+   L+    E L D +       Q +IF  TR   D LTE ++  +    A+ G+++
Sbjct: 228 FYLCDHLDH--KEALLDRILADAEYRQVIIFTATRADTDRLTEKLNQNNLKAVALSGNLN 285

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +R  IM QF     ++L+TT
Sbjct: 286 QTQRNTIMGQFERAVFKILVTT 307



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 17/63 (26%), Positives = 27/63 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V+ VIN+D+P + E Y                 + V   D  + K +E F  
Sbjct: 311 SRGLDIPAVTHVINFDMPKHTEEYVHRVGRTGRAGNKGDAMSLVGPKDWESFKRVEAFLQ 370

Query: 442 TSI 450
             I
Sbjct: 371 QEI 373


>UniRef50_Q2BP56 Cluster: Putative ATP-dependent RNA helicase; n=1;
           Neptuniibacter caesariensis|Rep: Putative ATP-dependent
           RNA helicase - Neptuniibacter caesariensis
          Length = 427

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/56 (33%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q ++F  T+++VD LT+ +       +A+HG+  QRER  ++ +F  G   VL+ T
Sbjct: 248 QTLVFVRTKKRVDELTQYLCKEGINAAAIHGEKSQRERVRMLNEFIAGDLHVLVAT 303



 Score = 36.7 bits (81), Expect = 0.57
 Identities = 20/67 (29%), Positives = 29/67 (43%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D++ +  V+NYDLP+  E Y                 + V  A+R  L+ IE    
Sbjct: 307 ARGLDIESLPYVVNYDLPNQPEAYVHRIGRTGRAGETGEAVSLVAPAEREFLQRIEKLIK 366

Query: 442 TSIVEMP 462
             I   P
Sbjct: 367 QKIKLRP 373


>UniRef50_A7CUH7 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Opitutaceae bacterium TAV2|Rep: DEAD/DEAH box
           helicase domain protein - Opitutaceae bacterium TAV2
          Length = 536

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/71 (29%), Positives = 32/71 (45%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + L DL         +IF  T+   D +   +     TV  +H D +QRER   +  F
Sbjct: 358 KFDLLIDLLSRTEFKSVIIFTRTKMGADRIAHRLQREGHTVGVIHSDRNQRERVEALEGF 417

Query: 221 RTGSSRVLITT 253
           ++G   VL+ T
Sbjct: 418 KSGKFEVLVAT 428



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/65 (35%), Positives = 31/65 (47%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           + ARG+D+  VS VINYD+P N E+Y                   VTE D R  + IE +
Sbjct: 430 IAARGLDIAGVSHVINYDVPENPEDYVHRIGRTGRANASGDAFTLVTEDDVRDARSIERY 489

Query: 436 YHTSI 450
            +  I
Sbjct: 490 INAEI 494


>UniRef50_A6DIU5 Cluster: Probable ATP dependent RNA helicase; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Probable ATP
           dependent RNA helicase - Lentisphaera araneosa HTCC2155
          Length = 537

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/73 (28%), Positives = 38/73 (52%)
 Frame = +2

Query: 35  EWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMR 214
           E K   LC + D       +IFC T+ +V+ ++  +    +    +HGD+ Q  RE +++
Sbjct: 226 ENKFAALCRIMDLEKDFYGIIFCRTKVEVEKVSAGLANEGYAADYIHGDVAQESRERLLK 285

Query: 215 QFRTGSSRVLITT 253
           +FR  +  +LI T
Sbjct: 286 RFRNRNISLLIAT 298


>UniRef50_A0M3C7 Cluster: RhlE-like DEAD box family ATP-dependent
           RNA helicase; n=4; Bacteroidetes|Rep: RhlE-like DEAD box
           family ATP-dependent RNA helicase - Gramella forsetii
           (strain KT0803)
          Length = 455

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           ++ARG+D++ VS V+N+D P   ENY                  F TEA++  L  IE+ 
Sbjct: 310 VMARGLDIENVSHVVNFDTPQYPENYMHRIGRTGRAEKKGQSLLFTTEAEQEYLDAIEEL 369

Query: 436 YHTSI--VEMPSDV 471
             T +   ++P +V
Sbjct: 370 MQTEVPKYDLPEEV 383


>UniRef50_Q016I5 Cluster: Predicted ATP-dependent RNA helicase FAL1,
           involved in rRNA maturation, DEAD-box superfamily; n=2;
           Ostreococcus|Rep: Predicted ATP-dependent RNA helicase
           FAL1, involved in rRNA maturation, DEAD-box superfamily
           - Ostreococcus tauri
          Length = 1222

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q V+F +TR  V+WL   +      VS+++G MD   R++ + +FR   + VL+ T
Sbjct: 687 QTVVFASTRHHVEWLHNLLEFEGVRVSSIYGSMDMMARKMALSKFRAKKADVLMVT 742


>UniRef50_A2ZD51 Cluster: Putative uncharacterized protein; n=7;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 370

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/71 (25%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + L  +  ++   + ++FCN +R  D + + ++   F  +++HGD  Q  R+ ++  F
Sbjct: 70  KNDKLLSVLKSVHNDKVIVFCNQKRTCDRIEDFLYDNRFNGASIHGDKSQAARDAVIAGF 129

Query: 221 RTGSSRVLITT 253
           ++G   +LI T
Sbjct: 130 KSGRKNILIAT 140


>UniRef50_Q61JF4 Cluster: Putative uncharacterized protein CBG09816;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG09816 - Caenorhabditis
           briggsae
          Length = 628

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E+ K   L DL D T   +  ++F  T+R    L   ++ +++ V  +HGD+ Q ERE  
Sbjct: 403 EDEKRSYLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYQVVTIHGDLKQFEREKH 462

Query: 209 MRQFRTGSSRVLITT 253
           +  FRTG++ +L+ T
Sbjct: 463 LDLFRTGTAPILVAT 477



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VINYDLPS+ + Y                 +F  + +R   +++ D   
Sbjct: 481 ARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFNDKNRNIARELMDLIV 540

Query: 442 TSIVEMP 462
            +  E+P
Sbjct: 541 EANQELP 547


>UniRef50_Q54TF8 Cluster: DEAD-box RNA helicase; n=2; Dictyostelium
           discoideum|Rep: DEAD-box RNA helicase - Dictyostelium
           discoideum AX4
          Length = 465

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/83 (30%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHG-DM 184
           +++I    E+ K   L D+Y  +S+ Q+++F +T      + + M     +VS ++G D+
Sbjct: 283 QYFIDCGSEDNKALILSDIYGFISVGQSIVFVHTIATAKSVHQKMVDEGHSVSLLYGKDL 342

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
              ER   ++ F+ G S+VLITT
Sbjct: 343 TTEERFKQIKDFKDGKSKVLITT 365



 Score = 35.9 bits (79), Expect = 0.99
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLP 315
           +LARGID+ QVS VINYD+P
Sbjct: 367 VLARGIDIPQVSLVINYDVP 386


>UniRef50_O97032 Cluster: DjVLGB; n=2; Dugesia|Rep: DjVLGB - Dugesia
           japonica (Planarian)
          Length = 781

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAV-IFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           KL  L ++++T +    + IF  T++  D L   +  + + VS++HGD  Q ERE  +  
Sbjct: 422 KLNYLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRSQVEREAALSM 481

Query: 218 FRTGSSRVLITT 253
           FR G   +L+ T
Sbjct: 482 FRNGQCPILVAT 493



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 15/24 (62%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V  VINYDLPS+ E Y
Sbjct: 497 ARGLDIPNVKHVINYDLPSDIEEY 520


>UniRef50_UPI0001509D93 Cluster: DEAD/DEAH box helicase family
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           DEAD/DEAH box helicase family protein - Tetrahymena
           thermophila SB210
          Length = 476

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/82 (29%), Positives = 47/82 (57%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +++I IE E+ K+  L  L D  +  Q +IF N + +  +L++ +  +    + ++ ++D
Sbjct: 258 QYHIKIE-EKQKISVLRQLLDQGNYNQVIIFVNKQDRAKYLSKYLTDKGHDNAFIYRNLD 316

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER  I  +F+ G +RVL+ T
Sbjct: 317 QSERTKIYSEFKEGKNRVLVAT 338



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFV-TEADRRALKDIED 432
           L+ RGID+++V+ VIN+D+P   E+Y                 +F+ T+ D + L +I+ 
Sbjct: 340 LVGRGIDIERVNLVINFDMPQITEDYMHRVGRAGRFETKGQAISFISTKEDEKVLAEIQS 399

Query: 433 FYHTSIVE 456
            + T I E
Sbjct: 400 TFSTQIKE 407


>UniRef50_Q17CR5 Cluster: DEAD box ATP-dependent RNA helicase; n=2;
           Aedes aegypti|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 625

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF  T++  D L E ++  +  V+++HGD  Q+ERE  ++ FR+G   VL+ T
Sbjct: 431 LIFVETKKSADSLEEFLYHYNHPVTSIHGDRTQKEREDALKCFRSGRCPVLVAT 484



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 18/68 (26%), Positives = 28/68 (41%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLP+  E Y                 +F  + +R     +     
Sbjct: 488 ARGLDIPNVKHVINFDLPAEIEEYVHRIGRTGRMGNLGIATSFFNDKNRNVANGLVRLLQ 547

Query: 442 TSIVEMPS 465
            +  E+PS
Sbjct: 548 ETQQEIPS 555


>UniRef50_Q8W4E1 Cluster: DEAD-box ATP-dependent RNA helicase 47;
           n=10; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 47 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 551

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/81 (24%), Positives = 39/81 (48%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           + Y  I   + K++TL      L     + F N  R++  +   +  R    + MHGD+ 
Sbjct: 383 KHYYCISKHQHKVDTLRRCVHALDAQSVIAFMNHSRQLKDVVYKLEARGMNSAEMHGDLG 442

Query: 188 QREREVIMRQFRTGSSRVLIT 250
           +  R  ++++F+ G  +VL+T
Sbjct: 443 KLGRSTVLKKFKNGEIKVLVT 463


>UniRef50_Q4IP34 Cluster: Pre-mRNA-processing ATP-dependent RNA
            helicase PRP5; n=15; Pezizomycotina|Rep:
            Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
            Gibberella zeae (Fusarium graminearum)
          Length = 1227

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/70 (31%), Positives = 38/70 (54%)
 Frame = +2

Query: 44   LETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFR 223
            LE L +LYD    A+ +IF   + K D L + + ++ +   ++HG  DQ +R+  +  F+
Sbjct: 835  LELLGELYDRDEDARTLIFVERQEKADDLLKELMMKGYPCMSIHGGKDQIDRDSTISDFK 894

Query: 224  TGSSRVLITT 253
             G   +LI T
Sbjct: 895  KGVVPILIAT 904



 Score = 35.9 bits (79), Expect = 0.99
 Identities = 14/24 (58%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV+Q+  VINYD P++ E+Y
Sbjct: 908 ARGLDVKQLKLVINYDAPNHLEDY 931


>UniRef50_A4RK80 Cluster: Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28; n=1; Magnaporthe grisea|Rep:
           Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 674

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/71 (28%), Positives = 37/71 (52%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           KL  + + Y T  +   ++F NT+   D + + +    F+   +HG+  Q +RE  ++ F
Sbjct: 520 KLRAMLNTYGTGKLV--IVFVNTKSNCDAVAKDLKSSSFSAVTLHGNKTQDQREAALQSF 577

Query: 221 RTGSSRVLITT 253
           R G + VL+ T
Sbjct: 578 RDGRTNVLVAT 588


>UniRef50_Q6FM43 Cluster: Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28; n=1; Candida glabrata|Rep:
           Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 582

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A+IF N +   DWLT  +  R F +  +HG   Q +RE  +++ ++G++ VLI T
Sbjct: 435 AIIFINYKETADWLTLRLSDR-FNIVTLHGSKSQSQRESAIQKLKSGTANVLIAT 488


>UniRef50_Q8SQK9 Cluster: ATP-dependent RNA helicase DHH1; n=1;
           Encephalitozoon cuniculi|Rep: ATP-dependent RNA helicase
           DHH1 - Encephalitozoon cuniculi
          Length = 489

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 26/82 (31%), Positives = 40/82 (48%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY  ++  E KL  L  L   LSI Q VIFCN+ + V+ L   +         +H  M 
Sbjct: 322 QFYTYVKPSE-KLLCLKSLLLRLSINQCVIFCNSIKTVELLAMKITEMGLPSYFIHSKMA 380

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +R ++   F  G  ++L+ T
Sbjct: 381 QEDRNIVFHNFLKGKCKILVAT 402



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 16/58 (27%), Positives = 26/58 (44%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           L+ RG+D    + VIN+D+  + E+Y                 + VT  ++  L DIE
Sbjct: 404 LITRGVDAPNTNYVINFDISKSPESYLHRIGRAGRFGAPGVAISLVTTEEKEMLMDIE 461


>UniRef50_Q4IF76 Cluster: ATP-dependent RNA helicase DBP2; n=4;
           Fungi/Metazoa group|Rep: ATP-dependent RNA helicase DBP2
           - Gibberella zeae (Fusarium graminearum)
          Length = 555

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF  T+R  D +T  +    +   ++HGD  Q ER+ ++ QF+TG S +++ T
Sbjct: 385 LIFVGTKRVADEITRFLRQDGWPALSIHGDKQQNERDWVLDQFKTGKSPIMVAT 438



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 13/24 (54%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RGIDV+ ++ V+NYD P+N E+Y
Sbjct: 442 SRGIDVRNITHVLNYDYPNNSEDY 465


>UniRef50_Q6C7X8 Cluster: ATP-dependent RNA helicase DBP10; n=3;
           Saccharomycetales|Rep: ATP-dependent RNA helicase DBP10
           - Yarrowia lipolytica (Candida lipolytica)
          Length = 926

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/73 (27%), Positives = 40/73 (54%)
 Frame = +2

Query: 35  EWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMR 214
           ++K E L   +   S    ++FC T+  V+++   +    + VS ++G +DQ  R+  + 
Sbjct: 377 KFKKERLPPAHQLPSEKSTIVFCPTKHHVEYVIVLLQTLGYAVSYIYGTLDQHARKNQLY 436

Query: 215 QFRTGSSRVLITT 253
           +FRTG + +L+ T
Sbjct: 437 RFRTGKTSILVVT 449


>UniRef50_UPI00015BD198 Cluster: UPI00015BD198 related cluster; n=1;
           unknown|Rep: UPI00015BD198 UniRef100 entry - unknown
          Length = 364

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/71 (29%), Positives = 38/71 (53%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K+  L  + DT  + + +IF  T++    L   +  +     A+HGD+ QR+RE  +  F
Sbjct: 227 KIHELMHIIDTHPMEKMLIFVKTKKDAKDLFFLLTKKGIRAQALHGDLTQRQREKALSAF 286

Query: 221 RTGSSRVLITT 253
           ++G+  +LI T
Sbjct: 287 KSGAVSILIAT 297


>UniRef50_UPI00006CEB85 Cluster: DEAD/DEAH box helicase family
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           DEAD/DEAH box helicase family protein - Tetrahymena
           thermophila SB210
          Length = 630

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/77 (24%), Positives = 42/77 (54%)
 Frame = +2

Query: 23  IELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRERE 202
           + + + K+  L  +   +   QA+IF N + K + +   +  ++++V  +HGD  Q +R 
Sbjct: 328 VSVTKQKINILTSVLKQIKFNQAIIFYNDKIKGENIFSELKAQNYSVIFIHGDQTQADRI 387

Query: 203 VIMRQFRTGSSRVLITT 253
            +M Q R   ++++I+T
Sbjct: 388 KVMNQIRRNKTQIIIST 404



 Score = 37.5 bits (83), Expect = 0.32
 Identities = 15/26 (57%), Positives = 20/26 (76%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           LL+RGID+  +  VINYD+PS+ E Y
Sbjct: 406 LLSRGIDITTIDLVINYDIPSSVETY 431


>UniRef50_A4BBH5 Cluster: Probable ATP-dependent RNA helicase; n=1;
           Reinekea sp. MED297|Rep: Probable ATP-dependent RNA
           helicase - Reinekea sp. MED297
          Length = 448

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/56 (33%), Positives = 34/56 (60%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +A++F  TR + + L  ++ L    V+ +HG+++Q ER  IM +FR G   V++ T
Sbjct: 244 KAIVFTKTRVQAEELANNLRLHQKRVATLHGEIEQDERNRIMTRFRDGVVDVIVAT 299


>UniRef50_A4B5L7 Cluster: ATP-dependent RNA helicase DbpA; n=3;
           Proteobacteria|Rep: ATP-dependent RNA helicase DbpA -
           Alteromonas macleodii 'Deep ecotype'
          Length = 459

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 17/55 (30%), Positives = 34/55 (61%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A++FCN + +V+ + + +    F+   + GDM+Q +R  ++ QF + S +VL+ T
Sbjct: 245 AIVFCNRKTQVNDVVDELIEDGFSAKGLQGDMEQHQRTSVLMQFASDSLQVLVAT 299



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 17/63 (26%), Positives = 26/63 (41%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V+CVINY +    E +                   V+E +   L+ IE    
Sbjct: 303 ARGLDIDDVACVINYTVSEEPETHIHRIGRTARAGAKGMAITLVSEEEEHFLRKIEVLQE 362

Query: 442 TSI 450
           + I
Sbjct: 363 SDI 365


>UniRef50_A1U3D6 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Marinobacter aquaeolei VT8|Rep: DEAD/DEAH box
           helicase domain protein - Marinobacter aquaeolei (strain
           ATCC 700491 / DSM 11845 / VT8)(Marinobacter
           hydrocarbonoclasticus (strain DSM 11845))
          Length = 528

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/73 (27%), Positives = 37/73 (50%)
 Frame = +2

Query: 35  EWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMR 214
           E KL+ L  + +      ++IF  T+ +   L E +  R   V+ + GD++QR+RE  + 
Sbjct: 248 ERKLDALTRILEVEPFDASIIFVRTKAETTMLAEKLSARGHAVAPLSGDLNQRQREQTVE 307

Query: 215 QFRTGSSRVLITT 253
             + G   ++I T
Sbjct: 308 DLKRGKKDIIIAT 320



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 18/56 (32%), Positives = 27/56 (48%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARG+DV +++ VINYD+P + E Y                   VT  +R  L+ +E
Sbjct: 324 ARGLDVPRITHVINYDVPYDTEAYIHRVGRTGRAGRTGKAILLVTPRERSWLRTLE 379


>UniRef50_A0Z0M4 Cluster: ATP-dependent RNA helicase; n=1; marine
           gamma proteobacterium HTCC2080|Rep: ATP-dependent RNA
           helicase - marine gamma proteobacterium HTCC2080
          Length = 582

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 2/73 (2%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV++++ VINYD+P + E Y                  FV   +RR L++IE    
Sbjct: 309 ARGLDVERITHVINYDVPFDEEAYVHRIGRTGRAGRKGKAILFVVPRERRMLRNIERLTR 368

Query: 442 TSI--VEMPSDVA 474
            SI  +++PS +A
Sbjct: 369 QSIPEIKLPSVLA 381



 Score = 36.3 bits (80), Expect = 0.75
 Identities = 20/71 (28%), Positives = 32/71 (45%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           KLE L  L         ++F  TR     + E +       S ++GDMDQ+ R   +   
Sbjct: 235 KLEALKRLLAFEDTEGVIVFTRTRESTTVIAEQLRQTGLKASPLNGDMDQKMRLRTVSDL 294

Query: 221 RTGSSRVLITT 253
           ++G+  VL+ T
Sbjct: 295 KSGALDVLVAT 305


>UniRef50_A0VLH7 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Rhodobacteraceae|Rep: DEAD/DEAH box helicase domain
           protein - Dinoroseobacter shibae DFL 12
          Length = 508

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + L DL        A++F  T+   D L   +    F  +A+HG+  Q +RE  ++ F
Sbjct: 301 KTQLLIDLLGNHRDELALVFSRTKHGADRLARKLSNAGFETAAIHGNRSQGQRERALKAF 360

Query: 221 RTGSSRVLITT 253
           R G+ +VL+ T
Sbjct: 361 REGTLKVLVAT 371


>UniRef50_Q54TJ4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 783

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           +RG+D+  V  VINY++P+N  NY                 +F+T+ DR+ LKDI
Sbjct: 497 SRGLDIIGVKTVINYNMPNNMANYIHRVGRTARAGMDGKSCSFITDNDRKLLKDI 551



 Score = 37.5 bits (83), Expect = 0.32
 Identities = 16/54 (29%), Positives = 30/54 (55%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IFC ++++V  L     L D   + +HG++ Q +R   ++QFR G    L+ +
Sbjct: 440 IIFCRSKKEVHRLRIIFGLSDLKAAELHGNLSQEQRFDSLQQFRDGQVNYLLAS 493


>UniRef50_Q4W7T8 Cluster: VASA RNA helicase; n=1; Artemia
           franciscana|Rep: VASA RNA helicase - Artemia
           sanfranciscana (Brine shrimp) (Artemia franciscana)
          Length = 726

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 15/71 (21%), Positives = 41/71 (57%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           +++ L ++       + ++F ++++  D+L   +  ++   +++HGD  Q +RE ++R F
Sbjct: 542 RIDRLLEILTEKEGVKTLVFASSKKTADFLAALLSTKNLPATSIHGDRFQYQREEVLRDF 601

Query: 221 RTGSSRVLITT 253
           ++G   +L+ T
Sbjct: 602 KSGHRNILVAT 612


>UniRef50_Q4W7T7 Cluster: VASA RNA helicase; n=3; Daphniidae|Rep:
           VASA RNA helicase - Moina macrocopa
          Length = 843

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 17/71 (23%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K   L ++   L  ++ ++F  +++  D++   +    F  +++HGD  Q +RE  +R+F
Sbjct: 647 KRNKLVEILRDLGNSRVIVFVESKKTADFIAAFLANTQFQATSIHGDRLQSQREQALREF 706

Query: 221 RTGSSRVLITT 253
           ++G   +L+ T
Sbjct: 707 KSGQRNILVAT 717



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 14/24 (58%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V  VINYDLP++ E Y
Sbjct: 721 ARGLDIAGVEYVINYDLPADIEEY 744


>UniRef50_Q16T16 Cluster: DEAD box ATP-dependent RNA helicase; n=7;
           Bilateria|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 741

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IFC  + + D L+    L     +++HGD +Q +RE  +   ++G  RVLI T
Sbjct: 571 KVIIFCGRKTRADDLSSEFVLSGINCTSLHGDREQADREQALEDIKSGDVRVLIAT 626



 Score = 39.5 bits (88), Expect = 0.080
 Identities = 18/73 (24%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D++ +S V+NYD P N E Y                 +F T  D     D+     
Sbjct: 630 SRGLDIEDISHVVNYDFPRNIEEYVHRVGRTGRAGRSGVSLSFFTRGDWAVASDLIKILE 689

Query: 442 TSIVEMPSDVANL 480
            +  E+P ++  +
Sbjct: 690 EADQEVPEEIRQM 702


>UniRef50_Q0E3X4 Cluster: DEAD-box ATP-dependent RNA helicase 35A;
           n=50; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           35A - Oryza sativa subsp. japonica (Rice)
          Length = 627

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/54 (35%), Positives = 30/54 (55%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++FC  +  VD++ E + L+     A+HG  DQ ERE  +  F+ G   VL+ T
Sbjct: 437 LVFCENKADVDYIHEYLLLKGVEAVAIHGGKDQEERENAIEFFKNGKKDVLVAT 490


>UniRef50_Q89UH0 Cluster: Dead-box ATP-dependent RNA helicase; n=23;
           Alphaproteobacteria|Rep: Dead-box ATP-dependent RNA
           helicase - Bradyrhizobium japonicum
          Length = 530

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +2

Query: 80  IAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           I +A++F  T+   D + +++       SA+HG+  Q  RE  + QFR+G  R L+ T
Sbjct: 259 INRALVFTRTKHGADKVVKTLEKAGIAASAIHGNKSQNHRERTLAQFRSGDIRTLVAT 316



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 14/26 (53%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           + ARGIDV  ++ VIN+DLP+  E Y
Sbjct: 318 IAARGIDVDGITHVINFDLPNVPETY 343


>UniRef50_Q5GRS8 Cluster: Superfamily II DNA/RNA helicase; n=4;
           Wolbachia|Rep: Superfamily II DNA/RNA helicase -
           Wolbachia sp. subsp. Brugia malayi (strain TRS)
          Length = 408

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 15/54 (27%), Positives = 34/54 (62%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+++ D L   +   + +  A+HGD+ QR+R+ ++  FR G +++++ T
Sbjct: 244 IVFVRTKQRADQLAYKLRKDNHSALAIHGDLKQRKRKRVINSFRRGHNQIMVAT 297



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 16/57 (28%), Positives = 27/57 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           +RG+D+  +  VINYD P ++ NY                 +F+T  D++ L  + D
Sbjct: 301 SRGLDIPHIQHVINYDAPESQANYIHRTGRTARAGAEGYALSFITSQDKKRLPTLTD 357


>UniRef50_Q28T45 Cluster: DEAD/DEAH box helicase-like protein; n=18;
           Alphaproteobacteria|Rep: DEAD/DEAH box helicase-like
           protein - Jannaschia sp. (strain CCS1)
          Length = 644

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/55 (34%), Positives = 31/55 (56%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A+IFCN +  VD + +S+   +     +HGD+DQ  R   +  FR GS  +L+ +
Sbjct: 264 AIIFCNRKVDVDIVAKSLKKHNLNAEPIHGDLDQSHRMRTLAGFRDGSITLLVAS 318



 Score = 37.1 bits (82), Expect = 0.43
 Identities = 15/24 (62%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  VS VINYD+PS+ E+Y
Sbjct: 322 ARGLDIPNVSHVINYDVPSHAEDY 345


>UniRef50_A7HDE9 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Anaeromyxobacter sp. Fw109-5|Rep: DEAD/DEAH box
           helicase domain protein - Anaeromyxobacter sp. Fw109-5
          Length = 680

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 16/55 (29%), Positives = 31/55 (56%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A++FCNTR     +   ++   +    ++GD+ Q+ERE +M + + G  R ++ T
Sbjct: 262 AIVFCNTRNDTSLVAAVLNRNGYDAELLNGDLPQKERERVMAKVKRGEVRFMVAT 316


>UniRef50_A6T3R2 Cluster: ATP-dependent RNA helicase; n=52; cellular
           organisms|Rep: ATP-dependent RNA helicase -
           Janthinobacterium sp. (strain Marseille) (Minibacterium
           massiliensis)
          Length = 778

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/71 (26%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           KL+ L  + +  +    +IF  T+   + L   +  R F+ +A++GD+ Q++RE  ++Q 
Sbjct: 233 KLDALTRILEAENFDGMIIFARTKLGTEELASKLQARGFSAAAINGDIQQQQRERTIQQL 292

Query: 221 RTGSSRVLITT 253
           + G   +L+ T
Sbjct: 293 KDGKIDILVAT 303



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 2/70 (2%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+++S VINYD+P + E+Y                  F+   +R  LK IE    
Sbjct: 307 ARGLDVERISHVINYDVPHDPESYTHRIGRTGRAGRSGEAILFIAPRERNLLKAIERATR 366

Query: 442 --TSIVEMPS 465
              S++E+PS
Sbjct: 367 QPISVLELPS 376


>UniRef50_A1USG3 Cluster: DEAD/DEAH box helicase domain/helicase
           conserved C-terminal domain protein; n=2;
           Rhizobiales|Rep: DEAD/DEAH box helicase domain/helicase
           conserved C-terminal domain protein - Bartonella
           bacilliformis (strain ATCC 35685 / KC583)
          Length = 462

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/58 (29%), Positives = 32/58 (55%)
 Frame = +2

Query: 80  IAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +  A++FCN ++ +  L  S+   +F+V  +HGDMDQ  R   +  F+     +L+ +
Sbjct: 251 LKNAIVFCNRKKDISELFRSLVKYNFSVGVLHGDMDQHSRMNTLADFKENKLTLLVAS 308



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  VS V NYD+P++ E+Y                   VT+ D++ +  IE    
Sbjct: 312 ARGLDIPDVSHVFNYDVPTHAEDYIHRIGRTGRAKRSGKAFTIVTKNDQKYISAIEKISK 371

Query: 442 TSIVEMPSDVANLI 483
            +I  +  D++ LI
Sbjct: 372 ENIEWLDGDLSTLI 385


>UniRef50_A0V009 Cluster: DEAD/DEAH box helicase-like; n=1;
           Clostridium cellulolyticum H10|Rep: DEAD/DEAH box
           helicase-like - Clostridium cellulolyticum H10
          Length = 542

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/54 (33%), Positives = 33/54 (61%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IFCNT+  VD +   +  + ++  A+HGD+ Q +R   ++QF+ G   +L+ T
Sbjct: 245 MIFCNTKAAVDRVQSFLGKKGYSSRALHGDIPQSKRLNTIQQFKQGKFHILVAT 298



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 22/65 (33%), Positives = 35/65 (53%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGI ++ +S VINYD+P++++NY                 + VT  D  +L +IE+   
Sbjct: 302 ARGIHIEDLSLVINYDVPNDKDNYVHRIGRTGRAGHEGRAFSLVTGDDIISLYEIEEHIG 361

Query: 442 TSIVE 456
           T I+E
Sbjct: 362 TLILE 366


>UniRef50_Q015D2 Cluster: DEAD/DEAH box helicase family protein /
           pentatricopeptide; n=2; Ostreococcus|Rep: DEAD/DEAH box
           helicase family protein / pentatricopeptide -
           Ostreococcus tauri
          Length = 518

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/64 (32%), Positives = 35/64 (54%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           +Y T  + +A+IFCN  R++  +   +  R   V  +HG MD+ ER+  +  FR G  R 
Sbjct: 345 IYAT-DVQRALIFCNFGRRLQDVQAKLGARGMRVGILHGGMDKMERQKELAAFRRGDFRA 403

Query: 242 LITT 253
           L+ +
Sbjct: 404 LVVS 407


>UniRef50_Q8I0W7 Cluster: Snrnp protein, putative; n=6;
            Plasmodium|Rep: Snrnp protein, putative - Plasmodium
            falciparum (isolate 3D7)
          Length = 1123

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/71 (32%), Positives = 35/71 (49%)
 Frame = +1

Query: 265  RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHT 444
            RGIDV  V  VIN+D+P + E+Y                 +F+TE D     D++ F  +
Sbjct: 1029 RGIDVHGVKLVINFDMPKDIESYTHRIGRTGRAGMKGLAISFITEHDSHLFYDLKQFLIS 1088

Query: 445  SIVEMPSDVAN 477
            S   +P ++AN
Sbjct: 1089 SNNIVPLELAN 1099



 Score = 33.1 bits (72), Expect = 7.0
 Identities = 16/71 (22%), Positives = 35/71 (49%)
 Frame = +2

Query: 41   KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
            KL+ + ++Y+       ++F N ++  D +++S+    +   A+HG   Q  RE  +  F
Sbjct: 958  KLQEILEMYEP----PIIVFVNQKKVADIISKSITKMKYKAVALHGGKAQEIREQTLSAF 1013

Query: 221  RTGSSRVLITT 253
            +     +L+ T
Sbjct: 1014 KNAEFDILVAT 1024


>UniRef50_Q5CP59 Cluster: DEAD box polypeptide, Y
           chromosome-related; n=3; Apicomplexa|Rep: DEAD box
           polypeptide, Y chromosome-related - Cryptosporidium
           hominis
          Length = 702

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/54 (33%), Positives = 33/54 (61%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           V+F   +R+ D + + +  ++F   ++HGD  Q+ERE  +R FR+G   +L+ T
Sbjct: 463 VVFVEMKRRADQIEDFLIDQNFPAVSIHGDRSQQEREHALRLFRSGQRPILVAT 516



 Score = 36.3 bits (80), Expect = 0.75
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D+  ++ VIN D+P N ++Y                 +FV E+++  L+D+
Sbjct: 520 ARGLDIPNITHVINLDMPCNIDDYVHRIGRTGRAGNTGLATSFVNESNKPILRDL 574


>UniRef50_Q4MYL1 Cluster: ATP-dependent RNA helicase, putative; n=3;
           Piroplasmida|Rep: ATP-dependent RNA helicase, putative -
           Theileria parva
          Length = 707

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/56 (33%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF + +   D LT ++  R F  +++HG+  Q +RE I+  FR+G   VL+ T
Sbjct: 566 KVLIFSDLKSFADQLTSALRYRRFKSASLHGNKTQAQRERILNMFRSGDVNVLVAT 621


>UniRef50_Q9P9G7 Cluster: DEAD-box RNA helicase; n=3;
           Methanosarcinaceae|Rep: DEAD-box RNA helicase -
           Methanococcoides burtonii
          Length = 522

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/74 (25%), Positives = 38/74 (51%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           ++ K   L  L  +      ++FCNTR  VD++ +++   D    A+HG   Q +R+  +
Sbjct: 221 KKMKFSLLVHLLKSEKSGLVMVFCNTRSNVDFVQKNLRKNDIDAIAIHGGHTQAKRKSTL 280

Query: 212 RQFRTGSSRVLITT 253
            +F + ++  L+ T
Sbjct: 281 SKFHSSNAHALVCT 294


>UniRef50_Q9PA24 Cluster: ATP-dependent RNA helicase rhlB; n=87;
           Proteobacteria|Rep: ATP-dependent RNA helicase rhlB -
           Xylella fastidiosa
          Length = 543

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/74 (27%), Positives = 39/74 (52%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           EE K+  L  L       + ++F NT+  V+ +  ++    + V  + GD+ QR+RE ++
Sbjct: 241 EEEKIPLLLGLLSRSEGMRTMVFVNTKVFVEGVARALDEAGYRVGVLSGDVPQRKRETLL 300

Query: 212 RQFRTGSSRVLITT 253
            +F+ G   +L+ T
Sbjct: 301 NRFQKGQLEILVAT 314



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 19/63 (30%), Positives = 27/63 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+ +  V+ V NYDLP + E+Y                 +F  E    +L DIE +  
Sbjct: 318 ARGLHIDGVNYVYNYDLPFDAEDYVHRIGRTARLGADGDAISFACERYAMSLPDIEAYIE 377

Query: 442 TSI 450
             I
Sbjct: 378 QKI 380


>UniRef50_Q0UMB6 Cluster: ATP-dependent RNA helicase DBP10; n=1;
           Phaeosphaeria nodorum|Rep: ATP-dependent RNA helicase
           DBP10 - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 878

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/54 (31%), Positives = 35/54 (64%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF  T+ +V++L+  +    + VS ++G++DQ  R+  ++ FR G +R+L+ T
Sbjct: 360 IIFAATKHRVEYLSTLLKAAGYPVSYVYGNLDQTARQEQVKDFRAGLTRILVVT 413


>UniRef50_Q8EUW5 Cluster: ATP-dependent RNA helicase; n=1;
           Mycoplasma penetrans|Rep: ATP-dependent RNA helicase -
           Mycoplasma penetrans
          Length = 457

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/73 (27%), Positives = 41/73 (56%)
 Frame = +2

Query: 35  EWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMR 214
           E K + L ++   L+    ++FCNT+++VD L + ++     V  +H  ++ R+R+ I R
Sbjct: 226 EDKNKMLLNIIKKLNPFFGIVFCNTKKEVDALYDYIYQNKIPVLKLHSGLENRQRKNIFR 285

Query: 215 QFRTGSSRVLITT 253
           + +  +  +LI T
Sbjct: 286 EIKENNINLLIAT 298


>UniRef50_Q1FMF9 Cluster: Helicase-like:DbpA, RNA-binding:DEAD/DEAH
           box helicase-like; n=1; Clostridium phytofermentans
           ISDg|Rep: Helicase-like:DbpA, RNA-binding:DEAD/DEAH box
           helicase-like - Clostridium phytofermentans ISDg
          Length = 483

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 2/71 (2%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D   ++ VINYDLP ++E Y                 +F+ E +++ L  IE F  
Sbjct: 303 ARGVDFDDITHVINYDLPMSKETYVHRIGRTGRNGKSGKAISFIREEEKKMLSLIEKFTG 362

Query: 442 T--SIVEMPSD 468
           T   IV  PS+
Sbjct: 363 TPIEIVTPPSE 373



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 25/74 (33%), Positives = 35/74 (47%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           EE K E    +    +   A+IFC TR  V+ L   +         +HG +DQ++R   +
Sbjct: 226 EEDKYELFLRMLYKNNPTNAMIFCGTREMVEVLYYKLKKEKVWCGMLHGLIDQKQRIHTI 285

Query: 212 RQFRTGSSRVLITT 253
             FRTG  R LI T
Sbjct: 286 DDFRTGGFRYLIAT 299


>UniRef50_Q11UI8 Cluster: DEAD box-related helicase; n=3;
           Sphingobacteriales|Rep: DEAD box-related helicase -
           Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
          Length = 437

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           EE K + +  +  + +    +IF +T+  V  L   +    F++   H D++Q ERE IM
Sbjct: 226 EEQKNKLIKHILSSGNFNSIIIFSSTKEHVKKLERDLSNMGFSLKGFHSDLEQEEREEIM 285

Query: 212 RQFRTGSSRVLITT 253
           R F++   ++LI T
Sbjct: 286 RAFKSRQLQMLIGT 299



 Score = 35.9 bits (79), Expect = 0.99
 Identities = 17/68 (25%), Positives = 31/68 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           +L+RGID+  +  VIN ++P + ENY                  F+++ D+     IE+ 
Sbjct: 301 ILSRGIDIDGIDLVINAEVPGDAENYIHRIGRTARAATTGTAITFISDTDQYKFLQIENL 360

Query: 436 YHTSIVEM 459
               I ++
Sbjct: 361 IGREIEKL 368


>UniRef50_Q087U7 Cluster: DEAD/DEAH box helicase domain protein;
           n=5; Gammaproteobacteria|Rep: DEAD/DEAH box helicase
           domain protein - Shewanella frigidimarina (strain NCIMB
           400)
          Length = 421

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/71 (30%), Positives = 32/71 (45%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K   LC L    S  Q++IF  T++  D L + M        A H D+ Q  RE ++  F
Sbjct: 240 KCAMLCHLITQESWLQSLIFSRTKQGADALVKQMKQAGVAAEAFHADLSQAVREQVLAAF 299

Query: 221 RTGSSRVLITT 253
           + G    L+ T
Sbjct: 300 KAGEVTALVAT 310


>UniRef50_A6VWX2 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Marinomonas|Rep: DEAD/DEAH box helicase domain
           protein - Marinomonas sp. MWYL1
          Length = 417

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/77 (29%), Positives = 37/77 (48%)
 Frame = +2

Query: 23  IELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRERE 202
           ++ EE K   L  L     + QAV+F + R  VD   + +         +HG+M Q +R 
Sbjct: 244 VDSEEHKEAVLKHLLTQERVQQAVLFVSNREHVDIWVQRIRKMGLMCDGLHGEMKQGDRS 303

Query: 203 VIMRQFRTGSSRVLITT 253
             M+Q + G  +VL+ T
Sbjct: 304 EHMKQMKRGRLQVLVAT 320


>UniRef50_Q388E8 Cluster: ATP-dependent DEAD/H RNA helicase,
           putative; n=3; Trypanosoma|Rep: ATP-dependent DEAD/H RNA
           helicase, putative - Trypanosoma brucei
          Length = 660

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F   +R  D+L   +   +    ++HGD  QRERE  +R F++G+ +VL+ T
Sbjct: 416 LVFVEKKRDADYLERFLRNSELACVSIHGDRVQREREEALRLFKSGACQVLVAT 469



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/55 (29%), Positives = 26/55 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           +RG+D+  V  VI YD+PSN ++Y                 +F  E +R  + D+
Sbjct: 473 SRGLDIPNVGVVIQYDMPSNIDDYVHRIGRTGRAGKVGVAISFFNEKNRNIVDDL 527


>UniRef50_Q22LR2 Cluster: Type III restriction enzyme, res subunit
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           Type III restriction enzyme, res subunit family protein
           - Tetrahymena thermophila SB210
          Length = 668

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 26/92 (28%), Positives = 37/92 (40%)
 Frame = +1

Query: 205 DHEAVSYWLFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXX 384
           D      W   C D   L+ARGID + V+ VINYD P+   NY                 
Sbjct: 503 DFRTGKLWALICTD---LMARGIDFKGVNLVINYDFPTTMINYIHRVGRTGRAGRTGRAI 559

Query: 385 NFVTEADRRALKDIEDFYHTSIVEMPSDVANL 480
            F T  D+  L+ + +    S  ++P  +  L
Sbjct: 560 TFFTNEDKPLLRSLGNMLKVSGCDVPEWIFKL 591


>UniRef50_A7RY08 Cluster: Predicted protein; n=2; Eukaryota|Rep:
           Predicted protein - Nematostella vectensis
          Length = 518

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +2

Query: 35  EWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMR 214
           EW  + L       S    +IF   +   + L  ++   DF V+ +HGDMDQ ER  ++ 
Sbjct: 339 EWLTQNLVSF---ASAGSVLIFVTKKLNSEELATNLRKNDFEVALLHGDMDQFERSKVLG 395

Query: 215 QFRTGSSRVLITT 253
           QF+     +L+ T
Sbjct: 396 QFKKREIPILVAT 408


>UniRef50_A7TRT2 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 605

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWL-TESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           KL+ + +LY        +IF N ++  DWL T+     +F V+ +HG   Q +RE  +  
Sbjct: 437 KLKQVLELYPP----PVIIFINYKKTADWLATKLQEETNFKVTTLHGSKSQDQREYSLNL 492

Query: 218 FRTGSSRVLITT 253
            RTG  +++I T
Sbjct: 493 LRTGRVQIMIAT 504


>UniRef50_Q6CDS6 Cluster: ATP-dependent RNA helicase ROK1; n=1;
           Yarrowia lipolytica|Rep: ATP-dependent RNA helicase ROK1
           - Yarrowia lipolytica (Candida lipolytica)
          Length = 547

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 25/85 (29%), Positives = 40/85 (47%)
 Frame = +1

Query: 226 WLFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEAD 405
           W+  C D   +LARGID + ++ VINYD+P + ++Y                  F T+ D
Sbjct: 416 WVLICTD---VLARGIDFRGINLVINYDVPQSAQSYVHRIGRTGRAGRLGKAVTFFTKED 472

Query: 406 RRALKDIEDFYHTSIVEMPSDVANL 480
              +K + +    S  E+P  + NL
Sbjct: 473 ATNVKVVVNVMKQSGQEVPDWLNNL 497



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +2

Query: 80  IAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +A  +IF  +  +   L + +      V  +HGDM   +R  ++ +FR G   VLI T
Sbjct: 364 VAPVIIFLQSIDRAKALFKELVFDGINVDQIHGDMTAAKRASVIDRFRNGEVWVLICT 421


>UniRef50_Q84TG1 Cluster: DEAD-box ATP-dependent RNA helicase 57;
           n=5; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 57 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 541

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/75 (30%), Positives = 37/75 (49%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           ++ARG+D + ++CVINYD P +   Y                  F TE D   L++I + 
Sbjct: 439 VIARGMDFKGINCVINYDFPDSASAYIHRIGRSGRAGRSGEAITFYTEQDVPFLRNIANT 498

Query: 436 YHTSIVEMPSDVANL 480
             +S  E+PS + +L
Sbjct: 499 MMSSGCEVPSWIMSL 513



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           EE KL  L   +        +IF  ++ +   L + +   +     +H D+   ERE  +
Sbjct: 364 EEGKLLALRQSFAESLNPPVLIFVQSKERAKELYDELKCENIRAGVIHSDLPPGERENAV 423

Query: 212 RQFRTGSSRVLITT 253
            QFR G   VLI T
Sbjct: 424 DQFRAGEKWVLIAT 437


>UniRef50_Q26696 Cluster: Putative DEAD-box RNA helicase HEL64; n=6;
           Trypanosomatidae|Rep: Putative DEAD-box RNA helicase
           HEL64 - Trypanosoma brucei brucei
          Length = 568

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++FC  +R  D L   +    +   A+HGD +QR+RE I+ +FR      L+ T
Sbjct: 347 RVLVFCKMKRTADELERQLRRWGYDAMAIHGDKEQRQREFILARFRKDPRLCLVAT 402



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +1

Query: 238 CLDHHCLLARGIDVQQVSCVINYDLPSNRENY 333
           CL    + ARG+D++Q+  VINYD P   ++Y
Sbjct: 398 CLVATDVAARGLDIKQLETVINYDFPMQIDDY 429


>UniRef50_Q966L9 Cluster: ATP-dependent RNA helicase glh-2; n=4;
            Caenorhabditis|Rep: ATP-dependent RNA helicase glh-2 -
            Caenorhabditis elegans
          Length = 974

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +2

Query: 17   IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
            + I+++ +  E   ++Y      + ++F + R   D L   +         +HG  +QRE
Sbjct: 800  LGIDIDSYTTEKNSEVYTK----KTIVFVSQRAMADTLASILSSAQVPAITIHGAREQRE 855

Query: 197  REVIMRQFRTGSSRVLITT 253
            R   +RQFR GS  VLI T
Sbjct: 856  RSEALRQFRNGSKPVLIAT 874



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENY 333
           RG+D++ V  VINYD+P N ++Y
Sbjct: 879 RGLDIKGVDHVINYDMPDNIDDY 901


>UniRef50_Q81QF0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=25; Firmicutes|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Bacillus anthracis
          Length = 450

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           AVIFC T+ +   L +++    +  + +HGD+ Q +RE +M+ FR    + LI T
Sbjct: 247 AVIFCRTKVRASKLYDNLKGLGYNCAELHGDIPQAKRERVMKSFREAKIQYLIAT 301



 Score = 37.5 bits (83), Expect = 0.32
 Identities = 19/56 (33%), Positives = 27/56 (48%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIE 429
           ARG+DV  V+ V NYD+P + E+Y                  FV   D + L++IE
Sbjct: 305 ARGLDVDGVTHVFNYDIPEDVESYIHRIGRTGRAGGSGLAITFVAAKDEKHLEEIE 360


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 671,250,283
Number of Sequences: 1657284
Number of extensions: 12824469
Number of successful extensions: 28113
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 26644
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28069
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57438021881
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -