SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20025
         (696 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A2A246 Cluster: Y-box protein; n=2; Bombyx mori|Rep: Y-...    70   5e-11
UniRef50_Q5MGM1 Cluster: Putative uncharacterized protein; n=4; ...    37   0.41 
UniRef50_A3TJK2 Cluster: Modification methylase; n=1; Janibacter...    36   0.95 
UniRef50_Q9LSI6 Cluster: Prolyl 4-hydroxylase alpha subunit-like...    35   2.2  
UniRef50_Q54JF6 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_A2ZM55 Cluster: Putative uncharacterized protein; n=3; ...    33   6.7  
UniRef50_A1WZL9 Cluster: Peptidase S8 and S53, subtilisin, kexin...    33   8.8  
UniRef50_Q22G20 Cluster: GRASP55/65 family protein; n=1; Tetrahy...    33   8.8  
UniRef50_A6SIE9 Cluster: Predicted protein; n=1; Botryotinia fuc...    33   8.8  

>UniRef50_A2A246 Cluster: Y-box protein; n=2; Bombyx mori|Rep: Y-box
           protein - Bombyx mori (Silk moth)
          Length = 272

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 48/158 (30%), Positives = 56/158 (35%)
 Frame = +2

Query: 11  SPYAADKRRGYHRQYFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVPSQ 190
           SPYAADKRRGYHRQYF                                       IVPSQ
Sbjct: 115 SPYAADKRRGYHRQYFPRQGGGRGGEGAPRRGGLGRRGPPPNQGGAQGDEGQEGGIVPSQ 174

Query: 191 XXXXXXXXXXXXXXXXXXPMNKEGSAECVRAISRRGREDKIRLSAKMARMEMPQLQHQTN 370
                             PMN+ G         + G+  + +   +  +           
Sbjct: 175 RSFFRRNFRGGRRGGGPGPMNRGGFRRVRPRNFQPGQGGQNQAQRQNGQDGDASATTSNQ 234

Query: 371 SRGPSXXXXXXXXXXXXXXPMRARPRHPEAVMCGTSFM 484
            +GPS              PMRARPRHPEAVMCGTSFM
Sbjct: 235 QQGPSLKVTNLLVLLLRQLPMRARPRHPEAVMCGTSFM 272


>UniRef50_Q5MGM1 Cluster: Putative uncharacterized protein; n=4;
           cellular organisms|Rep: Putative uncharacterized protein
           - Lonomia obliqua (Moth)
          Length = 254

 Score = 37.1 bits (82), Expect = 0.41
 Identities = 14/16 (87%), Positives = 16/16 (100%)
 Frame = +2

Query: 11  SPYAADKRRGYHRQYF 58
           SPYAADKRRGY+RQY+
Sbjct: 106 SPYAADKRRGYYRQYY 121


>UniRef50_A3TJK2 Cluster: Modification methylase; n=1; Janibacter
           sp. HTCC2649|Rep: Modification methylase - Janibacter
           sp. HTCC2649
          Length = 498

 Score = 35.9 bits (79), Expect = 0.95
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -2

Query: 305 PPCPAWKLRGRTRRNPPYSLGQDLPHGVHRENCD 204
           PPC A+ L GR RR    + G D+ H ++RE  D
Sbjct: 127 PPCQAYSLVGRARRTNDATFGDDVKHFLYREYLD 160


>UniRef50_Q9LSI6 Cluster: Prolyl 4-hydroxylase alpha subunit-like
           protein; n=26; Magnoliophyta|Rep: Prolyl 4-hydroxylase
           alpha subunit-like protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 332

 Score = 34.7 bits (76), Expect = 2.2
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = -2

Query: 299 CPAWKLRGRTRRNPPYSLGQDLPHGVHRENC 207
           C  W   G  ++NP Y +G D  HG  R++C
Sbjct: 297 CEKWAKAGECQKNPTYMVGSDKDHGYCRKSC 327


>UniRef50_Q54JF6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 929

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 19/53 (35%), Positives = 27/53 (50%)
 Frame = -3

Query: 637 FQIRDPAPYVPIQIKNSQRSQCDTTSKTNTHQLYRQDKLRWSVHN*NQHALHK 479
           +Q     P+  +QI+  Q+SQ D  SK N HQ  +Q +     H  NQH  H+
Sbjct: 622 YQYISQLPHQQVQIQGMQQSQMDHLSKHNDHQHQQQHQ----QHQQNQHHQHQ 670


>UniRef50_A2ZM55 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 215

 Score = 33.1 bits (72), Expect = 6.7
 Identities = 21/54 (38%), Positives = 26/54 (48%)
 Frame = +1

Query: 457 GRYVWHIIYVVHVDSSCAHSTSTCLVCTTDEC*FLMLYRIEIFANSLFVLERKE 618
           GRY W ++    VDSSCA S+   L CT +    L L R   F  +  V E  E
Sbjct: 99  GRY-WELLLYQFVDSSCAKSSFGVLSCTREASGLLTLQRDTTFLQNPRVSEMFE 151


>UniRef50_A1WZL9 Cluster: Peptidase S8 and S53, subtilisin, kexin,
           sedolisin precursor; n=1; Halorhodospira halophila
           SL1|Rep: Peptidase S8 and S53, subtilisin, kexin,
           sedolisin precursor - Halorhodospira halophila (strain
           DSM 244 / SL1) (Ectothiorhodospirahalophila (strain DSM
           244 / SL1))
          Length = 648

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = -3

Query: 325 GAEPDFVLPAPPGNCA-DALGGTLLIHWARTSPTASTAKIATEKTA 191
           GA+PD V P PP + + +   G   + W  +SPTA   +I    TA
Sbjct: 455 GADPDTVPPVPPSHVSIETASGIPELRWLSSSPTARGYRIERFDTA 500


>UniRef50_Q22G20 Cluster: GRASP55/65 family protein; n=1;
           Tetrahymena thermophila SB210|Rep: GRASP55/65 family
           protein - Tetrahymena thermophila SB210
          Length = 474

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 19/59 (32%), Positives = 30/59 (50%)
 Frame = -3

Query: 667 HIFDPMIPMQFQIRDPAPYVPIQIKNSQRSQCDTTSKTNTHQLYRQDKLRWSVHN*NQH 491
           H  DP  P Q    DP P   IQ++  Q+    + SK   HQL++ + LR   ++ ++H
Sbjct: 252 HKSDPPAPKQQLSSDPPP-TNIQVQQEQQQPSQSGSKIVAHQLHQINILRAKKNSHHEH 309


>UniRef50_A6SIE9 Cluster: Predicted protein; n=1; Botryotinia
           fuckeliana B05.10|Rep: Predicted protein - Botryotinia
           fuckeliana B05.10
          Length = 1156

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = +1

Query: 355 TTSNQQQGAKPKSNKPVGTTIETTTNESQA*TSRGRYVWHIIYVVHVD-SSCAHSTSTCL 531
           TTS+   G+ P ++   GTT  + +N S   TS G Y      ++  D SS   ST+T  
Sbjct: 188 TTSSDFNGSPPTTSGAPGTTTPSESNGSSPITSAGTY--EPSGIISSDYSSTTPSTTTTN 245

Query: 532 VCTTDEC 552
            C  D C
Sbjct: 246 HCNHDNC 252


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 635,898,946
Number of Sequences: 1657284
Number of extensions: 12629400
Number of successful extensions: 35375
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 34044
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35356
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54958682807
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -