SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20024
         (560 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A7TZA3 Cluster: DNA-directed RNA polymerase II large su...    37   0.37 
UniRef50_Q9VVP0 Cluster: CG13699-PA; n=1; Drosophila melanogaste...    35   1.5  
UniRef50_Q2JC13 Cluster: Radical SAM; n=2; Frankia|Rep: Radical ...    34   2.0  
UniRef50_A2DM84 Cluster: Putative uncharacterized protein; n=1; ...    34   2.0  
UniRef50_A4HF60 Cluster: Putative uncharacterized protein; n=1; ...    34   2.6  
UniRef50_UPI0000E822B9 Cluster: PREDICTED: similar to prolin ric...    33   3.4  
UniRef50_Q5KFQ2 Cluster: Cytochrome c heme lyase (Cchl), putativ...    33   3.4  
UniRef50_Q59T40 Cluster: Questionable orf; n=2; cellular organis...    33   3.4  
UniRef50_Q2GMP5 Cluster: Predicted protein; n=1; Chaetomium glob...    33   3.4  
UniRef50_P11129 Cluster: Protein P3; n=18; Pseudomonas phage phi...    33   4.6  
UniRef50_O64496 Cluster: F20D22.14 protein; n=17; Magnoliophyta|...    32   8.0  
UniRef50_A2ZV86 Cluster: Putative uncharacterized protein; n=4; ...    32   8.0  
UniRef50_Q54KM1 Cluster: Putative uncharacterized protein; n=1; ...    32   8.0  
UniRef50_Q4UA64 Cluster: Putative uncharacterized protein; n=1; ...    32   8.0  
UniRef50_P16252 Cluster: Cuticle collagen 2C; n=3; Rhabditida|Re...    32   8.0  

>UniRef50_A7TZA3 Cluster: DNA-directed RNA polymerase II large
           subunit; n=2; Lepeophtheirus salmonis|Rep: DNA-directed
           RNA polymerase II large subunit - Lepeophtheirus
           salmonis (salmon louse)
          Length = 196

 Score = 36.7 bits (81), Expect = 0.37
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = +3

Query: 297 SFQPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSY 449
           S+ P YS G  P+A SY G  P         +   ++GY +YPYV P+  Y
Sbjct: 146 SYTPSYSYGY-PSAHSY-GYAPRVYKREAEASYTTSYGYSAYPYVRPSYGY 194


>UniRef50_Q9VVP0 Cluster: CG13699-PA; n=1; Drosophila
           melanogaster|Rep: CG13699-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 1051

 Score = 34.7 bits (76), Expect = 1.5
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = +3

Query: 303 QPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           +PGY   + PA        P P+ P    T      Y S+ Y  P+ + + T  +VP  P
Sbjct: 206 RPGYVFDESPAPSYRRPTRPPPSLPPPPTTAAHKISYDSHDYPPPSYAAEQTSNFVPQQP 265

Query: 483 Q 485
           +
Sbjct: 266 K 266


>UniRef50_Q2JC13 Cluster: Radical SAM; n=2; Frankia|Rep: Radical SAM
           - Frankia sp. (strain CcI3)
          Length = 714

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = -3

Query: 234 SICRIVERWVNWSLGWGIIWVSVWISRHFLFR*IYY*NFKTLEILI*SRPR 82
           S+ R+  R+ +W +G    W   W+ RHF    + Y  FK+LE ++   PR
Sbjct: 566 SMGRVEARYADWRIGVAASWAQRWVDRHFA---LDY-TFKSLEKVLDGAPR 612


>UniRef50_A2DM84 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 640

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 1/52 (1%)
 Frame = +3

Query: 291 QHSFQPGYSLGQQPAAMSYPGITPAPT-APRGHVTPHGAFGYQSYPYVTPTQ 443
           Q S+ P     QQP     P   P P  AP     P+GA   Q YPY  PTQ
Sbjct: 548 QPSYVPPAQQQQQPTPYGAPPEQPYPYGAPTQQPYPYGAPTQQPYPYGAPTQ 599


>UniRef50_A4HF60 Cluster: Putative uncharacterized protein; n=1;
            Leishmania braziliensis|Rep: Putative uncharacterized
            protein - Leishmania braziliensis
          Length = 2320

 Score = 33.9 bits (74), Expect = 2.6
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = +3

Query: 345  YPGITPAP--TAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTPQNASILSE 506
            YP   P+P  TAP     PHGA+   ++PY  P+ S  + +     TP+ ++  +E
Sbjct: 922  YPTYVPSPPRTAPAAPSPPHGAYMPVAHPYFDPSSSMGSYMPDFAPTPRFSAHTTE 977


>UniRef50_UPI0000E822B9 Cluster: PREDICTED: similar to prolin rich
           protein; n=1; Gallus gallus|Rep: PREDICTED: similar to
           prolin rich protein - Gallus gallus
          Length = 195

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 5/69 (7%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGA-FGYQSYPYVTPTQSYDTTIE----WVPTTPQNAS 494
           PA M  P     P  P    TP  A F    +P+V PT +  T++     WVP TP   +
Sbjct: 118 PAPMGAPNTQQCPQHPWVPPTPINATFMCPQHPWVPPTPNGVTSMRPQHPWVPPTPNGVA 177

Query: 495 ILSEKQWWL 521
            +  +  W+
Sbjct: 178 FMCPQHPWV 186


>UniRef50_Q5KFQ2 Cluster: Cytochrome c heme lyase (Cchl), putative;
           n=1; Filobasidiella neoformans|Rep: Cytochrome c heme
           lyase (Cchl), putative - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 281

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 11/93 (11%)
 Frame = +3

Query: 315 SLGQQP-AAMSYPGITPAPTAPRGHVTPHG-AFGY-QSYPYVTPTQSYDTTIEWVPTTPQ 485
           SL +QP   +  P    A T PR    P G A+G   ++ Y +P Q Y+  +     TP+
Sbjct: 81  SLSRQPDQKLDLPTERTASTIPRPSSAPGGEAYGTGNTWDYPSPQQFYNALVRKGWETPE 140

Query: 486 NA--------SILSEKQWWLVMKVTMVVPLGDQ 560
           ++        + L+E+ W  VMK    +P GDQ
Sbjct: 141 DSVEVMVAIHNFLNERAWDEVMKWEKRLPGGDQ 173


>UniRef50_Q59T40 Cluster: Questionable orf; n=2; cellular
           organisms|Rep: Questionable orf - Candida albicans
           (Yeast)
          Length = 190

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 13/48 (27%), Positives = 25/48 (52%)
 Frame = -3

Query: 240 RWSICRIVERWVNWSLGWGIIWVSVWISRHFLFR*IYY*NFKTLEILI 97
           RW +   + R + W +GW + W   W  R F++R  ++  F  L +++
Sbjct: 59  RWFMRWFMWRMMRWFVGWFMRWFMRWFVRWFMWRMFWFFGFSILILVM 106


>UniRef50_Q2GMP5 Cluster: Predicted protein; n=1; Chaetomium
            globosum|Rep: Predicted protein - Chaetomium globosum
            (Soil fungus)
          Length = 1096

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 23/62 (37%), Positives = 27/62 (43%), Gaps = 5/62 (8%)
 Frame = +3

Query: 312  YSLGQ--QPAAMSY---PGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPT 476
            Y+ GQ  QP    Y   PG +PA  AP G + P G    Q YPY        T   W P 
Sbjct: 851  YTYGQHSQPQPSGYANPPGPSPATPAPGGMIQPVGGQPPQQYPYPANVPQQHT---WNPG 907

Query: 477  TP 482
            +P
Sbjct: 908  SP 909


>UniRef50_P11129 Cluster: Protein P3; n=18; Pseudomonas phage
           phi6|Rep: Protein P3 - Bacteriophage phi-6
          Length = 648

 Score = 33.1 bits (72), Expect = 4.6
 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 3/50 (6%)
 Frame = +3

Query: 348 PGITPAPTAPRGHVTPHGAFGYQSYPYVT---PTQSYDTTIEWVPTTPQN 488
           P   P P AP G     GA G+Q YP  T   P    D TIE   T   N
Sbjct: 333 PATIPVPLAPLGGAGGPGAQGFQVYPVFTWGLPEFMTDVTIEGTVTADSN 382


>UniRef50_O64496 Cluster: F20D22.14 protein; n=17;
           Magnoliophyta|Rep: F20D22.14 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 1345

 Score = 32.3 bits (70), Expect = 8.0
 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +3

Query: 300 FQPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVT-PTQSY 449
           + P Y  GQQ A  +Y G     TAP+       A  Y +YP  T PTQSY
Sbjct: 689 WNPAY--GQQAAYGAYGGYPAGYTAPQAPTPVPQAAAYGAYPAQTYPTQSY 737


>UniRef50_A2ZV86 Cluster: Putative uncharacterized protein; n=4;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 471

 Score = 32.3 bits (70), Expect = 8.0
 Identities = 16/41 (39%), Positives = 19/41 (46%)
 Frame = +3

Query: 360 PAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           P PT P  +  P  A  Y  YPY  P+Q       W P+TP
Sbjct: 75  PPPTTP-AYSFPPPAQPYGQYPYPYPSQGQAGAAYWPPSTP 114


>UniRef50_Q54KM1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 358

 Score = 32.3 bits (70), Expect = 8.0
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 5/52 (9%)
 Frame = +3

Query: 303 QPGYSLGQQP-AAMSYPGITPAP--TAPRGHVTPHGAFGYQS--YPYVTPTQ 443
           QP   + QQP   MS  G+ P P    P+G + PH  F  QS  YPY+   Q
Sbjct: 160 QPPQQMQQQPPGTMSPQGMIPPPGFIIPQGGIPPHPQFMPQSHVYPYMMQPQ 211


>UniRef50_Q4UA64 Cluster: Putative uncharacterized protein; n=1;
           Theileria annulata|Rep: Putative uncharacterized protein
           - Theileria annulata
          Length = 1165

 Score = 32.3 bits (70), Expect = 8.0
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 1/49 (2%)
 Frame = +3

Query: 306 PGYSLGQQ-PAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSY 449
           PGY +  Q P    +   T   T P G V P+  + Y  Y Y   TQ+Y
Sbjct: 73  PGYRISHQDPYVPMWISQTYPMTVPYGQVYPNSPYEYIPYDYTRQTQNY 121


>UniRef50_P16252 Cluster: Cuticle collagen 2C; n=3; Rhabditida|Rep:
           Cuticle collagen 2C - Haemonchus contortus (Barber pole
           worm)
          Length = 210

 Score = 32.3 bits (70), Expect = 8.0
 Identities = 16/41 (39%), Positives = 20/41 (48%)
 Frame = +3

Query: 303 QPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYP 425
           QPG +   +P     PG  P PT P G   P+GA G+   P
Sbjct: 114 QPGANAPSEPLVPGPPG-PPGPTGPEGPPGPNGAPGHPGAP 153


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 594,523,315
Number of Sequences: 1657284
Number of extensions: 12305943
Number of successful extensions: 39551
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 37164
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39437
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 37488397230
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -