SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20021
         (476 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P62913 Cluster: 60S ribosomal protein L11; n=156; Eukar...   177   1e-43
UniRef50_P0C0W9 Cluster: 60S ribosomal protein L11-A; n=25; Euka...   150   2e-35
UniRef50_P42794 Cluster: 60S ribosomal protein L11-2; n=38; Euka...   150   2e-35
UniRef50_UPI000155375A Cluster: PREDICTED: similar to ribosomal ...   118   5e-26
UniRef50_A0DI11 Cluster: Chromosome undetermined scaffold_51, wh...   113   2e-24
UniRef50_Q6LXE0 Cluster: 50S ribosomal protein L5P; n=7; Euryarc...    88   8e-17
UniRef50_A3H987 Cluster: Ribosomal protein L5; n=1; Caldivirga m...    87   1e-16
UniRef50_UPI00015BB1AB Cluster: LSU ribosomal protein L5P; n=1; ...    85   1e-15
UniRef50_Q9YF87 Cluster: 50S ribosomal protein L5P; n=20; Archae...    84   1e-15
UniRef50_Q8PV37 Cluster: 50S ribosomal protein L5P; n=6; Methano...    79   4e-14
UniRef50_Q74N79 Cluster: 50S ribosomal protein L5P; n=1; Nanoarc...    78   1e-13
UniRef50_Q3LWF5 Cluster: Ribosomal protein L11; n=1; Bigelowiell...    77   2e-13
UniRef50_O28367 Cluster: 50S ribosomal protein L5P; n=1; Archaeo...    77   2e-13
UniRef50_Q673R5 Cluster: Ribosomal protein L5/L11; n=2; environm...    76   4e-13
UniRef50_Q46GA8 Cluster: 50S ribosomal protein L5P; n=3; Methano...    75   6e-13
UniRef50_A7DSY1 Cluster: Ribosomal protein L5; n=1; Candidatus N...    74   1e-12
UniRef50_A5UL75 Cluster: Ribosomal protein L5p; n=1; Methanobrev...    74   1e-12
UniRef50_Q6L1B4 Cluster: 50S ribosomal protein L5P; n=4; Thermop...    74   2e-12
UniRef50_A0RVY6 Cluster: Ribosomal protein L5; n=1; Cenarchaeum ...    70   2e-11
UniRef50_P14124 Cluster: 50S ribosomal protein L5P; n=5; Halobac...    69   7e-11
UniRef50_Q6CKT5 Cluster: Similarity; n=1; Kluyveromyces lactis|R...    66   4e-10
UniRef50_Q01C63 Cluster: Chromosome 03 contig 1, DNA sequence; n...    59   4e-08
UniRef50_Q7R5U0 Cluster: GLP_81_173473_174138; n=1; Giardia lamb...    41   0.016
UniRef50_P38517 Cluster: 50S ribosomal protein L5; n=18; cellula...    34   1.9  
UniRef50_A6CBF6 Cluster: Putative uncharacterized protein; n=1; ...    33   2.5  
UniRef50_Q8XMC3 Cluster: Putative uncharacterized protein CPE076...    33   3.3  
UniRef50_Q11UJ1 Cluster: Endoglucanase, glycoside hydrolase fami...    33   3.3  
UniRef50_Q1Q797 Cluster: Similar to cobalamin 5'-phosphate synth...    33   4.3  
UniRef50_A3CXT4 Cluster: Zinc finger, AN1-type; n=1; Methanocull...    32   5.7  
UniRef50_Q30TV2 Cluster: 50S ribosomal protein L5; n=2; Epsilonp...    32   5.7  
UniRef50_Q7WFV5 Cluster: Putative uncharacterized protein; n=3; ...    31   10.0 
UniRef50_Q1PLH5 Cluster: ORF16-like conjugation protein from Tn9...    31   10.0 
UniRef50_A5FG97 Cluster: Glucose-1-phosphate adenylyltransferase...    31   10.0 
UniRef50_Q9M8J7 Cluster: F28L1.15 protein; n=8; core eudicotyled...    31   10.0 
UniRef50_A7P4M8 Cluster: Chromosome chr4 scaffold_6, whole genom...    31   10.0 

>UniRef50_P62913 Cluster: 60S ribosomal protein L11; n=156;
           Eukaryota|Rep: 60S ribosomal protein L11 - Homo sapiens
           (Human)
          Length = 178

 Score =  177 bits (431), Expect = 1e-43
 Identities = 92/142 (64%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVV 234
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTG +  F +            
Sbjct: 5   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 64

Query: 235 MKRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG 408
            +++    + R AKAEEIL +  KVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIG
Sbjct: 65  NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG 124

Query: 409 IYGLDFYVVLCRPGFNVAHRRR 474
           IYGLDFYVVL RPGF++A ++R
Sbjct: 125 IYGLDFYVVLGRPGFSIADKKR 146


>UniRef50_P0C0W9 Cluster: 60S ribosomal protein L11-A; n=25;
           Eukaryota|Rep: 60S ribosomal protein L11-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 174

 Score =  150 bits (363), Expect = 2e-35
 Identities = 81/139 (58%), Positives = 98/139 (70%), Gaps = 2/139 (1%)
 Frame = +1

Query: 64  SKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVMKR 243
           ++N MR+L I KL LNI VGESGDRLTRA+KVLEQL+G +    +             ++
Sbjct: 5   AQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIRRNEK 64

Query: 244 LLSMYSPRA-KAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYG 417
           +    + R  KAEEIL R  KV+EY+LR  NFSATGNFGFGI EHIDLGIKYDPSIGI+G
Sbjct: 65  IAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSIGIFG 124

Query: 418 LDFYVVLCRPGFNVAHRRR 474
           +DFYVV+ RPG  V  R+R
Sbjct: 125 MDFYVVMNRPGARVTRRKR 143


>UniRef50_P42794 Cluster: 60S ribosomal protein L11-2; n=38;
           Eukaryota|Rep: 60S ribosomal protein L11-2 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 182

 Score =  150 bits (363), Expect = 2e-35
 Identities = 81/143 (56%), Positives = 98/143 (68%), Gaps = 2/143 (1%)
 Frame = +1

Query: 52  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSV 231
           SE    N MR++ ++KL LNI VGESGDRLTRA+KVLEQL+G +  F +           
Sbjct: 3   SEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIR 62

Query: 232 VMKRLLSMYSPRA-KAEEILRX-FKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSI 405
             +++    + R  KA ++L    KV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS 
Sbjct: 63  RNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST 122

Query: 406 GIYGLDFYVVLCRPGFNVAHRRR 474
           GIYG+DFYVVL RPG+ VA RRR
Sbjct: 123 GIYGMDFYVVLERPGYRVARRRR 145


>UniRef50_UPI000155375A Cluster: PREDICTED: similar to ribosomal
           protein L11; n=1; Mus musculus|Rep: PREDICTED: similar
           to ribosomal protein L11 - Mus musculus
          Length = 279

 Score =  118 bits (285), Expect = 5e-26
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +1

Query: 268 AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLCR 444
           AKAEEIL +  KVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVL R
Sbjct: 131 AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 190

Query: 445 PGFNVAHRRR 474
            GF++A ++R
Sbjct: 191 SGFSIADKKR 200



 Score = 50.4 bits (115), Expect = 2e-05
 Identities = 24/29 (82%), Positives = 24/29 (82%)
 Frame = +3

Query: 183 PVFSKARYTVRSFGIRRNEKIAVHVQSEG 269
           PV SKARYTVRSFGIRRNEKIAVH    G
Sbjct: 102 PVESKARYTVRSFGIRRNEKIAVHCTVRG 130


>UniRef50_A0DI11 Cluster: Chromosome undetermined scaffold_51, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_51,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 197

 Score =  113 bits (272), Expect = 2e-24
 Identities = 63/135 (46%), Positives = 89/135 (65%), Gaps = 5/135 (3%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYF--PRLGIQC-GLLV 225
           ++  +NVMR + I KL ++IC GESGD+LT+AAKVLE LTG    F   R  ++  G+  
Sbjct: 32  QETKENVMRKIRIEKLMVHICAGESGDKLTKAAKVLEDLTGQKPVFGKARYTVRSFGIRR 91

Query: 226 SVVMKRLLSMYSPRAKAEEILRXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSI 405
           +  +    ++   +A+ + ++R  +V+E EL++ NFS +GNFGFGIQEHIDLG+KYDP  
Sbjct: 92  NEKISVFCTIRGDQAR-DILVRGLRVKEMELKKRNFSESGNFGFGIQEHIDLGLKYDPYT 150

Query: 406 GI--YGLDFYVVLCR 444
           GI  YGL   VV  R
Sbjct: 151 GIFRYGLLCCVVKTR 165


>UniRef50_Q6LXE0 Cluster: 50S ribosomal protein L5P; n=7;
           Euryarchaeota|Rep: 50S ribosomal protein L5P -
           Methanococcus maripaludis
          Length = 181

 Score = 88.2 bits (209), Expect = 8e-17
 Identities = 59/143 (41%), Positives = 77/143 (53%), Gaps = 8/143 (5%)
 Frame = +1

Query: 67  KNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVMKRL 246
           K  M+   I+K+ +N  VGE+GDRLT  AKV+E+LTG S     L  Q       + K+L
Sbjct: 9   KEPMKKPRIQKVTVNFGVGEAGDRLTIGAKVIEELTGQS-PVRTLAKQTNPAFG-IRKKL 66

Query: 247 ---LSMYSPRAKAEEILR----XFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPS 402
              L +     KAEE L+     FK     L   +F   GNF FG+ EHID  G KYDPS
Sbjct: 67  PIGLKVTLRGKKAEEFLKNAFTAFKACGKTLFASSFDQVGNFSFGVPEHIDFPGQKYDPS 126

Query: 403 IGIYGLDFYVVLCRPGFNVAHRR 471
           +GIYG+D  V   + G+ V  R+
Sbjct: 127 VGIYGMDICVTFEKSGYRVKSRK 149


>UniRef50_A3H987 Cluster: Ribosomal protein L5; n=1; Caldivirga
           maquilingensis IC-167|Rep: Ribosomal protein L5 -
           Caldivirga maquilingensis IC-167
          Length = 197

 Score = 87.4 bits (207), Expect = 1e-16
 Identities = 51/137 (37%), Positives = 81/137 (59%), Gaps = 4/137 (2%)
 Frame = +1

Query: 76  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVMKRLLSM 255
           MR + I  + +N+ +G+SG+RL +AAKV+ +LTG +  + RL  +      +     + +
Sbjct: 32  MRRIFIWSVAVNMGIGQSGERLEKAAKVMSELTGRTPSY-RLAHKSIKDFGIRRGEPIGL 90

Query: 256 YSPRAKAEEI---LRXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLD 423
                + E +   LR     ++ LR ++F+A GN  FGI+EHI + G +YDP++GI+G D
Sbjct: 91  LVTLRRNEAVWFLLRALAAVDFTLREESFNA-GNVSFGIREHILVPGSRYDPALGIFGFD 149

Query: 424 FYVVLCRPGFNVAHRRR 474
             V L RPGF V +RRR
Sbjct: 150 VAVTLARPGFRVQYRRR 166


>UniRef50_UPI00015BB1AB Cluster: LSU ribosomal protein L5P; n=1;
           Ignicoccus hospitalis KIN4/I|Rep: LSU ribosomal protein
           L5P - Ignicoccus hospitalis KIN4/I
          Length = 198

 Score = 84.6 bits (200), Expect = 1e-15
 Identities = 48/136 (35%), Positives = 81/136 (59%), Gaps = 8/136 (5%)
 Frame = +1

Query: 91  IRKLCLNICVGESGDRLTRAAKVLEQLTGN-------SLYFPRLGIQCGLLVSVVMKRLL 249
           + K+ +NI +GESG+RL +A  +LE+LTG             + GI+ G  ++V    ++
Sbjct: 38  LAKVTVNIALGESGERLEKAYNLLEELTGQRPVKRKAKKTIRQFGIRRGENIAV----MV 93

Query: 250 SMYSPRAKAEEILRXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDF 426
           ++   RA  E + +  +   ++++  +F   GN GFGI+EHI + G +YDP +GI+G+D 
Sbjct: 94  TLRGQRA-VEFLKKALEAVGWKIKASSFDEFGNVGFGIREHIQIPGTRYDPRVGIFGMDV 152

Query: 427 YVVLCRPGFNVAHRRR 474
            + + RPG+ VA RRR
Sbjct: 153 ILTIERPGYRVARRRR 168


>UniRef50_Q9YF87 Cluster: 50S ribosomal protein L5P; n=20;
           Archaea|Rep: 50S ribosomal protein L5P - Aeropyrum
           pernix
          Length = 192

 Score = 84.2 bits (199), Expect = 1e-15
 Identities = 50/139 (35%), Positives = 75/139 (53%), Gaps = 3/139 (2%)
 Frame = +1

Query: 67  KNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVMKRL 246
           ++ MR   I K+ +NI +G+SG+RL RAA+VLE+LTG    F +             + +
Sbjct: 24  RSPMRRPRIVKVTVNISIGQSGERLQRAAEVLEELTGQKPVFRKAKRTIRAFGVRKGENI 83

Query: 247 LSMYSPRA-KAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYG 417
             M + R  KA   L R      + ++  +    GN  FGI+EHI + G+KYDP +GI G
Sbjct: 84  AVMVTLRGEKALNFLKRALDAVGHRIKTSSIDEHGNVSFGIEEHILIPGVKYDPRVGILG 143

Query: 418 LDFYVVLCRPGFNVAHRRR 474
           +D  + + RPG  +  RRR
Sbjct: 144 MDVAITIQRPGHRIVERRR 162


>UniRef50_Q8PV37 Cluster: 50S ribosomal protein L5P; n=6;
           Methanomicrobia|Rep: 50S ribosomal protein L5P -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 169

 Score = 79.4 bits (187), Expect = 4e-14
 Identities = 47/138 (34%), Positives = 77/138 (55%), Gaps = 4/138 (2%)
 Frame = +1

Query: 70  NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSL---YFPRLGIQCGLLVSVVMK 240
           N MR   + K+ +++ VGESG  L  A ++L+ +TG  +   +  R      +  +  + 
Sbjct: 3   NPMRTPMVEKVIVHMGVGESGQHLVNAEEILKTITGQEVVRCFAKRTLPAFSIKKNEPIG 62

Query: 241 RLLSMYSPRAKAEEILRXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYG 417
             +++   RA+ E +   F++ E  L R  F + GN  FGI+EH D  G++YDP+IG++G
Sbjct: 63  CKVTLRGQRAQ-EFLGTSFEIIEKTLSRAQFDSLGNVSFGIEEHTDFPGMRYDPNIGVFG 121

Query: 418 LDFYVVLCRPGFNVAHRR 471
           +D  VVL RPG  +  RR
Sbjct: 122 MDVTVVLKRPGERICKRR 139


>UniRef50_Q74N79 Cluster: 50S ribosomal protein L5P; n=1;
           Nanoarchaeum equitans|Rep: 50S ribosomal protein L5P -
           Nanoarchaeum equitans
          Length = 169

 Score = 77.8 bits (183), Expect = 1e-13
 Identities = 48/136 (35%), Positives = 80/136 (58%), Gaps = 4/136 (2%)
 Frame = +1

Query: 76  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLL-VSVVMKRLLS 252
           MR + I K+ LNI VGESG++L +A ++L++LTG      +  ++     +   +   + 
Sbjct: 5   MRKIRIEKVTLNIGVGESGEKLDKAYELLKRLTGQKPVKTKAKVRVEQWHIRPGLPIGVK 64

Query: 253 MYSPRAKAEEILRX--FKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLD 423
           +     KA +IL+       +++++  +F+  G FGFGI E+I + G+KYDP +G+ GL+
Sbjct: 65  VTLRGEKAYKILKEKLLPAVDFKIKASSFTDRG-FGFGIPEYIMIPGMKYDPELGLIGLE 123

Query: 424 FYVVLCRPGFNVAHRR 471
            YV L RPG+ V  RR
Sbjct: 124 AYVTLERPGYRVERRR 139


>UniRef50_Q3LWF5 Cluster: Ribosomal protein L11; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L11 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 139

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 42/133 (31%), Positives = 76/133 (57%), Gaps = 5/133 (3%)
 Frame = +1

Query: 76  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVMKR--LL 249
           M+ + + KL L+I VG SG  L +++K+L+++   SL FP  G+    + +  ++R   +
Sbjct: 1   MKQIFLNKLILSIDVGSSGSNLYKSSKLLKKI---SLQFPSFGMAKRTIKTFSIRRGEYI 57

Query: 250 SMYSPRAKAEEIL---RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGL 420
           S +   +K + IL   +  K++ + +   NFS T  FG GI +H++LG  +D  IGI+G+
Sbjct: 58  SCFCSLSKKKGILFLYKMLKLKTFTINESNFSLTSTFGIGISDHLELGYNFDQKIGIHGI 117

Query: 421 DFYVVLCRPGFNV 459
           +    L R G+ +
Sbjct: 118 NIIGDLSRRGYRI 130


>UniRef50_O28367 Cluster: 50S ribosomal protein L5P; n=1;
           Archaeoglobus fulgidus|Rep: 50S ribosomal protein L5P -
           Archaeoglobus fulgidus
          Length = 178

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 50/141 (35%), Positives = 81/141 (57%), Gaps = 4/141 (2%)
 Frame = +1

Query: 64  SKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGN--SLYFPRLGIQ-CGLLVSVV 234
           ++N MR + + K+ +NI VGESG+R  +A  +LE+L     ++ + ++ I+  G+     
Sbjct: 12  NENPMREVVLDKVVINIGVGESGERHKKAYSLLEELVEQKPAITYAKMTIKNFGIRKGEA 71

Query: 235 MKRLLSMYSPRAKAEEILRXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGI 411
           +   +++   +A  + +     V+E  L R +    G F FGI EHIDL G+ YDP +GI
Sbjct: 72  IGIKVTLRGEKA-LKFLKDALTVKENRLSRKSIGE-GYFAFGIAEHIDLPGVDYDPDVGI 129

Query: 412 YGLDFYVVLCRPGFNVAHRRR 474
           +G+D  V L R G+ VA RRR
Sbjct: 130 FGMDVCVSLKRRGYRVARRRR 150


>UniRef50_Q673R5 Cluster: Ribosomal protein L5/L11; n=2;
           environmental samples|Rep: Ribosomal protein L5/L11 -
           uncultured marine group II euryarchaeote DeepAnt-JyKC7
          Length = 168

 Score = 76.2 bits (179), Expect = 4e-13
 Identities = 58/141 (41%), Positives = 70/141 (49%), Gaps = 13/141 (9%)
 Frame = +1

Query: 91  IRKLCLNICVGESGDRLTRAAKVLEQLTG-----------NSLYFPRLGIQCGLLVSVVM 237
           I K+ +NI VGE G RL  A +VLE LTG           N     RLG   G  V++  
Sbjct: 6   ITKVTVNIGVGEGGSRLQLAERVLELLTGLKPIRTISRMTNRDLGTRLGAPIGCKVTI-- 63

Query: 238 KRLLSMYSPRAKAEEILRX-FKVREYELRRDNFSATGNFGFGIQEHIDLGI-KYDPSIGI 411
                      K +  L+  F VRE  L   NF  +GN  FGI ++ D    KYDP IGI
Sbjct: 64  -------RDADKVQSFLKDAFWVRENTLPSYNFDQSGNLSFGIADYTDFPAQKYDPDIGI 116

Query: 412 YGLDFYVVLCRPGFNVAHRRR 474
           YG+D  VVL RPG  V+ RRR
Sbjct: 117 YGMDVNVVLERPGHRVSRRRR 137


>UniRef50_Q46GA8 Cluster: 50S ribosomal protein L5P; n=3;
           Methanomicrobia|Rep: 50S ribosomal protein L5P -
           Methanosarcina barkeri (strain Fusaro / DSM 804)
          Length = 169

 Score = 75.4 bits (177), Expect = 6e-13
 Identities = 45/138 (32%), Positives = 76/138 (55%), Gaps = 4/138 (2%)
 Frame = +1

Query: 70  NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLY--FPRLGIQC-GLLVSVVMK 240
           NVMR   + K+ +++ VGESG  L  A ++L  +TG  +   F +  +    +  +  + 
Sbjct: 3   NVMRTPVVEKVIVHMGVGESGQHLVDAEEILRNITGQEVVRCFAKRTLPAFSIKKNEPIG 62

Query: 241 RLLSMYSPRAKAEEILRXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYG 417
             +++   RA+ + +     + +  L R  F + GN  FGI+EH D  G+KYDP+IG++G
Sbjct: 63  CKVTLRGQRAQ-QFLETALGIVDKTLVRSQFDSLGNVSFGIEEHTDFPGMKYDPNIGVFG 121

Query: 418 LDFYVVLCRPGFNVAHRR 471
           +D  VV+ RPG  +  RR
Sbjct: 122 MDVTVVIKRPGERICKRR 139


>UniRef50_A7DSY1 Cluster: Ribosomal protein L5; n=1; Candidatus
           Nitrosopumilus maritimus SCM1|Rep: Ribosomal protein L5
           - Candidatus Nitrosopumilus maritimus SCM1
          Length = 173

 Score = 74.1 bits (174), Expect = 1e-12
 Identities = 49/145 (33%), Positives = 82/145 (56%), Gaps = 8/145 (5%)
 Frame = +1

Query: 64  SKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTG------NSLYFPR-LGIQCGLL 222
           +++ M+ + + K+ LN+ VG+SGD +  A++ LEQ++G      N+    R  G++ G  
Sbjct: 5   TESPMKKISLEKVVLNMGVGKSGDVIEIASRALEQISGKKPSARNAKETQRDWGVRKGEP 64

Query: 223 VSVVMKRLLSMYSPRAKAEEILRXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDP 399
           + V +    ++    AKA  + R  + +   +    F   GN+ FGI+EHID+ G+KY+P
Sbjct: 65  IGVAV----TIRGDDAKAL-LKRLLEAKGNTVNGRAFDNFGNYSFGIREHIDIPGVKYEP 119

Query: 400 SIGIYGLDFYVVLCRPGFNVAHRRR 474
           SIGI GL   V L RPG+ +  R +
Sbjct: 120 SIGILGLGISVTLTRPGYGIRTRSK 144


>UniRef50_A5UL75 Cluster: Ribosomal protein L5p; n=1;
           Methanobrevibacter smithii ATCC 35061|Rep: Ribosomal
           protein L5p - Methanobrevibacter smithii (strain PS /
           ATCC 35061 / DSM 861)
          Length = 170

 Score = 74.1 bits (174), Expect = 1e-12
 Identities = 47/139 (33%), Positives = 78/139 (56%), Gaps = 5/139 (3%)
 Frame = +1

Query: 70  NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQL---TGNSLYFPRLGIQCGLLVSVVMK 240
           N M  + I K  ++I VGE+G++L+RA  +LEQ+   T    +      + G+     + 
Sbjct: 2   NPMNEVQISKATVSIGVGEAGEKLSRAITLLEQMFDQTPVKTFSKVTNPEFGIRKRQPIA 61

Query: 241 RLLSMYSPRA-KAEEILRXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIY 414
             L++   +A KA E++   +     ++   F A GN  FGI+EHID+ G+KY+P IGI+
Sbjct: 62  CKLTLRGEKADKAIEMV--LEGINKNIKPTQFDAQGNLSFGIKEHIDIPGMKYNPDIGIF 119

Query: 415 GLDFYVVLCRPGFNVAHRR 471
           G++  V   +PG+ +A RR
Sbjct: 120 GMNVSVTFEKPGYRIAKRR 138


>UniRef50_Q6L1B4 Cluster: 50S ribosomal protein L5P; n=4;
           Thermoplasmatales|Rep: 50S ribosomal protein L5P -
           Picrophilus torridus
          Length = 176

 Score = 73.7 bits (173), Expect = 2e-12
 Identities = 53/147 (36%), Positives = 79/147 (53%), Gaps = 9/147 (6%)
 Frame = +1

Query: 58  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPR-------LGIQCG 216
           + ++N MR + I K+ +NI VG +G+RL RAAKVLE LT +   F           I+ G
Sbjct: 3   ETTENSMREIVIDKVVVNIGVGAAGERLNRAAKVLELLTHHKPAFTSAKRTVRDFNIRKG 62

Query: 217 LLVSVVMKRLLSMYSPRAKAEEILRXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKY 393
           L + V  K  L      +  +E    F  ++Y++   +F   GN  FGI ++ D  G+KY
Sbjct: 63  LNIGV--KVTLRKDDALSFLKE---AFYAKDYKIPVYSFDKNGNAYFGISDYTDFKGMKY 117

Query: 394 DPSIGIYGLDFYVVL-CRPGFNVAHRR 471
           DP IGI+G+D  +V   R G+ +  RR
Sbjct: 118 DPDIGIFGMDIAIVFRRRGGYRIEKRR 144


>UniRef50_A0RVY6 Cluster: Ribosomal protein L5; n=1; Cenarchaeum
           symbiosum|Rep: Ribosomal protein L5 - Cenarchaeum
           symbiosum
          Length = 169

 Score = 70.1 bits (164), Expect = 2e-11
 Identities = 45/137 (32%), Positives = 72/137 (52%), Gaps = 4/137 (2%)
 Frame = +1

Query: 76  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLY---FPRLGIQCGLLVSVVMKRL 246
           MR + + K+ LN+ VG+SG+ +  A + L +++G               G+     +   
Sbjct: 5   MRKITLEKVVLNMGVGQSGNAVEVAKRALGEISGKKPCGRDAHETQRDFGVRKGEPIGAA 64

Query: 247 LSMYSPRAKAEEILRXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLD 423
           +++    A A    R F+ +  +++  +F   GNF FGI EHID+ GIKYDP IGI GLD
Sbjct: 65  VTIRGEDAGALA-RRLFEAKGGQVKGRSFDDFGNFSFGIGEHIDIPGIKYDPGIGILGLD 123

Query: 424 FYVVLCRPGFNVAHRRR 474
             + L RPG+ +  R +
Sbjct: 124 VCMTLSRPGYGIRKRSK 140


>UniRef50_P14124 Cluster: 50S ribosomal protein L5P; n=5;
           Halobacteriaceae|Rep: 50S ribosomal protein L5P -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 177

 Score = 68.5 bits (160), Expect = 7e-11
 Identities = 47/133 (35%), Positives = 67/133 (50%), Gaps = 2/133 (1%)
 Frame = +1

Query: 76  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVMKRLLSM 255
           MR   I K+ +++ +G  G  L  A  +L ++TG      +     G         + + 
Sbjct: 14  MREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAK 73

Query: 256 YSPRAK-AEEILRXFKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFY 429
            + R + AEE L+   +   EL    F  TGNF FG++EH +    +YDPSIGIYGLD  
Sbjct: 74  VTLRDEMAEEFLQT-ALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVT 132

Query: 430 VVLCRPGFNVAHR 468
           V L RPG+ VA R
Sbjct: 133 VNLVRPGYRVAKR 145


>UniRef50_Q6CKT5 Cluster: Similarity; n=1; Kluyveromyces lactis|Rep:
           Similarity - Kluyveromyces lactis (Yeast) (Candida
           sphaerica)
          Length = 191

 Score = 66.1 bits (154), Expect = 4e-10
 Identities = 36/129 (27%), Positives = 70/129 (54%), Gaps = 2/129 (1%)
 Frame = -3

Query: 450 TWPAKYDVKVQSINSN*GIVLDTQVNVFLNTEAKITRGGEVVTPQFIFSDFKPS-KDLFC 274
           TW    +V++ ++N++  +VLDTQ++VFL+TE ++T   EV   Q +F D + S +D F 
Sbjct: 44  TWSTHDNVEIHTVNTDTWVVLDTQIDVFLDTETEVTGSREVSVSQLVFLDLQTSFQDFFS 103

Query: 273 FSPRTVHGQQSFHYDGYQKTALYT*PWKIQ-AVSCELLQHLGGTSQPVTGFTNTDVQAKL 97
                 +   +       +++       +  +++ +L Q+LG + Q VT FTN ++Q + 
Sbjct: 104 LWTTNSNVDSNLFVSSDTESSDSVSSLGLNWSLTRQLFQNLGSSGQSVTRFTNRNIQDQF 163

Query: 96  SDMKIPHYI 70
            D++  H +
Sbjct: 164 LDLQFTHRV 172


>UniRef50_Q01C63 Cluster: Chromosome 03 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 03 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 363

 Score = 59.3 bits (137), Expect = 4e-08
 Identities = 41/143 (28%), Positives = 76/143 (53%), Gaps = 4/143 (2%)
 Frame = -3

Query: 474 TPSVCNVETWPAKYDVKVQSINSN*GIVLDTQVNVFLNTEAKITRGGEVVTPQFIFSDFK 295
           TP+V +V     ++DV++ +++    +VLD +VNVF +TE ++TRG EV   +F F   +
Sbjct: 66  TPAVDSVAR-ALQHDVEIHTVDPCGRVVLDAEVNVFADTETEVTRGAEVALEEFEFLHLE 124

Query: 294 PS-KDLFCFSPRT---VHGQQSFHYDGYQKTALYT*PWKIQAVSCELLQHLGGTSQPVTG 127
           P+ ++L    P T   V G   F     ++        + + ++ +LLQHL    + +T 
Sbjct: 125 PALQNLHRLVPVTNGDVRG-DLFVTANAERAHGVARLGEDRLLTGQLLQHLRRLREAITA 183

Query: 126 FTNTDVQAKLSDMKIPHYIFRII 58
             N +V+ +L +   PH + R++
Sbjct: 184 LANANVEHELVNADRPHRVLRLV 206


>UniRef50_Q7R5U0 Cluster: GLP_81_173473_174138; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_81_173473_174138 - Giardia lamblia
           ATCC 50803
          Length = 221

 Score = 40.7 bits (91), Expect = 0.016
 Identities = 20/63 (31%), Positives = 37/63 (58%)
 Frame = -3

Query: 471 PSVCNVETWPAKYDVKVQSINSN*GIVLDTQVNVFLNTEAKITRGGEVVTPQFIFSDFKP 292
           P++ + E    K  V+V +I+++  +VLD ++NVF + E +++ GGE    QF   D + 
Sbjct: 65  PALIDAEPGARKDHVEVHTIDTHGRVVLDPEINVFRDAEPEVSSGGEARVGQFKVLDAEA 124

Query: 291 SKD 283
           + D
Sbjct: 125 ALD 127


>UniRef50_P38517 Cluster: 50S ribosomal protein L5; n=18; cellular
           organisms|Rep: 50S ribosomal protein L5 - Thermotoga
           maritima
          Length = 184

 Score = 33.9 bits (74), Expect = 1.9
 Identities = 38/140 (27%), Positives = 64/140 (45%), Gaps = 13/140 (9%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESG---DRLTRAAKVLEQLTGNSLYFPR-------LG 204
           E N KN+ +   + K+ +N+ +GE     D + R A  L ++TG      R         
Sbjct: 23  EFNYKNIHQVPKLVKIVINMGIGEGSRNYDLIERHANELAKITGQKPIVTRARKSISNFK 82

Query: 205 IQCGLLVSV-VMKRLLSMYSPRAKAEEILRXFKVREYE-LRRDNFSATGNFGFGIQEHID 378
           I+ G+ + + V  R   MY+   K   I+   KVR++  L  ++F   GN+ FG+ E + 
Sbjct: 83  IRKGMPIGLKVTLRGARMYNFLYKLINIVLP-KVRDFRGLDPNSFDGRGNYSFGLSEQLV 141

Query: 379 L-GIKYDPSIGIYGLDFYVV 435
              +  D    I G+D  +V
Sbjct: 142 FPELNPDEVRRIQGMDITIV 161


>UniRef50_A6CBF6 Cluster: Putative uncharacterized protein; n=1;
            Planctomyces maris DSM 8797|Rep: Putative uncharacterized
            protein - Planctomyces maris DSM 8797
          Length = 1731

 Score = 33.5 bits (73), Expect = 2.5
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 3/58 (5%)
 Frame = -3

Query: 249  QQSFHYDGYQKTALYT*PWKIQAVSCELLQHLGGTSQPVTGF---TNTDVQAKLSDMK 85
            QQ +H  G Q       PW+ QAVS  LLQ LG  +Q +T F   +N  ++  L  +K
Sbjct: 1230 QQIYHVVGKQTAGKTFEPWQFQAVSA-LLQSLGRRNQSLTQFYQKSNQQLREVLDQLK 1286


>UniRef50_Q8XMC3 Cluster: Putative uncharacterized protein CPE0766;
           n=10; Clostridium|Rep: Putative uncharacterized protein
           CPE0766 - Clostridium perfringens
          Length = 464

 Score = 33.1 bits (72), Expect = 3.3
 Identities = 28/98 (28%), Positives = 47/98 (47%)
 Frame = +1

Query: 58  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVM 237
           +  KN++  L+ R+  LN+   E    L  A KV+    GN++      +    LV+   
Sbjct: 42  NGEKNII--LNFRETFLNLDEDEYFKYLEIAKKVMSGTIGNNILELNFPLN-DYLVNERQ 98

Query: 238 KRLLSMYSPRAKAEEILRXFKVREYELRRDNFSATGNF 351
             L+ + + + K +E+L  F    Y+L  DN+  TGNF
Sbjct: 99  VSLMQLKNSQLKDDELLNDF----YKLVIDNYDYTGNF 132


>UniRef50_Q11UJ1 Cluster: Endoglucanase, glycoside hydrolase family
           9 protein; n=1; Cytophaga hutchinsonii ATCC 33406|Rep:
           Endoglucanase, glycoside hydrolase family 9 protein -
           Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
          Length = 854

 Score = 33.1 bits (72), Expect = 3.3
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = -3

Query: 168 LLQHLGGTSQPVTG-FTNTDVQAKLSDMKIPHYIFRI 61
           ++  L G   PVTG ++ TD+Q  LSD+K   Y+ R+
Sbjct: 803 IILDLNGREYPVTGDWSTTDIQLNLSDLKAGMYLIRL 839


>UniRef50_Q1Q797 Cluster: Similar to cobalamin 5'-phosphate
           synthase; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Similar to cobalamin 5'-phosphate synthase - Candidatus
           Kuenenia stuttgartiensis
          Length = 274

 Score = 32.7 bits (71), Expect = 4.3
 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
 Frame = +1

Query: 187 YFPRLGIQCGLLVSVVMKRLLSMYSPRAKAEEILRXFKVREYELRRDNFSAT--GNFGFG 360
           +FP +GI  G ++SVV   L +++ P      IL  + V    L  D F+ T  G +G G
Sbjct: 32  WFPIVGIVIGAILSVVSLLLQNVFPPCITNAFILITYIVITGALHLDGFADTCDGIYG-G 90

Query: 361 IQEHIDLGIKYDPSIGIYGL 420
             +   L I  D  IG YG+
Sbjct: 91  WNKEKRLEIMKDSHIGSYGV 110


>UniRef50_A3CXT4 Cluster: Zinc finger, AN1-type; n=1; Methanoculleus
           marisnigri JR1|Rep: Zinc finger, AN1-type -
           Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498
           / JR1)
          Length = 415

 Score = 32.3 bits (70), Expect = 5.7
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +1

Query: 19  CVEER*KGEEGSEDNSK-NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFP 195
           CV+ER    E SED S+ +   N H RK        ++   +T+   VL  + G +L++P
Sbjct: 54  CVQERYSYTENSEDYSRYSDNANGHSRKTSSQRLARQTEQEITKTLAVLAIVVGLALFYP 113

Query: 196 RL 201
           ++
Sbjct: 114 QI 115


>UniRef50_Q30TV2 Cluster: 50S ribosomal protein L5; n=2;
           Epsilonproteobacteria|Rep: 50S ribosomal protein L5 -
           Thiomicrospira denitrificans (strain ATCC 33889 / DSM
           1351)
          Length = 181

 Score = 32.3 bits (70), Expect = 5.7
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +1

Query: 298 KVREYE-LRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVV 435
           +V+++  + R+ F   GN+ FG+QE +    + YD  + I+G++  VV
Sbjct: 109 RVKDFRGVPRNGFDGRGNYNFGLQEQLIFPEVSYDSVMQIHGMNITVV 156


>UniRef50_Q7WFV5 Cluster: Putative uncharacterized protein; n=3;
           Bordetella|Rep: Putative uncharacterized protein -
           Bordetella bronchiseptica (Alcaligenes bronchisepticus)
          Length = 414

 Score = 31.5 bits (68), Expect = 10.0
 Identities = 13/23 (56%), Positives = 14/23 (60%)
 Frame = +2

Query: 398 PQLEFMDWTFTSYFAGQVSTLHT 466
           P  E  DW F  YFAG+VS L T
Sbjct: 200 PSEELCDWGFLGYFAGEVSGLRT 222


>UniRef50_Q1PLH5 Cluster: ORF16-like conjugation protein from
           Tn916-like elements; n=6; Clostridium perfringens|Rep:
           ORF16-like conjugation protein from Tn916-like elements
           - Clostridium perfringens
          Length = 841

 Score = 31.5 bits (68), Expect = 10.0
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = +1

Query: 25  EER*KGEEGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTR-AAKVLEQLTGNSLYF 192
           +E  + +  +E   K V RN HI +  ++IC+  + +++ R   KVL +    SL F
Sbjct: 351 DEEYEAKAAAESLEKEVKRNKHIIETSISICLASTKEKIVRNNTKVLMEYFNKSLKF 407


>UniRef50_A5FG97 Cluster: Glucose-1-phosphate adenylyltransferase;
           n=7; Bacteroidetes|Rep: Glucose-1-phosphate
           adenylyltransferase - Flavobacterium johnsoniae UW101
          Length = 426

 Score = 31.5 bits (68), Expect = 10.0
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = -1

Query: 275 ALALGLYMDSNLFITTDTKRPHCIPSLGKYRLFPVSCSNTL 153
           A+ LG    S LF  T+T+    +P  GKYRL  +  SN +
Sbjct: 10  AIILGGGQGSRLFPLTETRSKPAVPIGGKYRLVDIPISNCI 50


>UniRef50_Q9M8J7 Cluster: F28L1.15 protein; n=8; core
           eudicotyledons|Rep: F28L1.15 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 840

 Score = 31.5 bits (68), Expect = 10.0
 Identities = 15/60 (25%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +2

Query: 278 KRSLXGLKSENMNCGVTTSPPRVILASVF--KNTLTWVSSTIPQLEFMDWTFTSYFAGQV 451
           KR   G+    ++ G+  +  R+    +F  + TLTW +S +P L +  W + S +  ++
Sbjct: 168 KRISDGIFKPILDNGLREATTRIGRQEIFDRRTTLTWKNSEVPLLPYARWLYISSYVSRI 227


>UniRef50_A7P4M8 Cluster: Chromosome chr4 scaffold_6, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr4 scaffold_6, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 840

 Score = 31.5 bits (68), Expect = 10.0
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = +1

Query: 196 RLGIQCGLLVSVVMKRLLSMYSPRAKAEEILRXFKVREYELRRDNFSATGNFGFGIQEHI 375
           +L I  GL+  +    +  M  P   A+E+L+ + +R YELR D+F  +    F +Q   
Sbjct: 214 QLTILDGLVQKIADMVVERMGGPVGDADEMLKRWTIRSYELRIDHFRQSSLVLFLVQPTF 273

Query: 376 DL 381
           +L
Sbjct: 274 NL 275


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 459,309,560
Number of Sequences: 1657284
Number of extensions: 9121854
Number of successful extensions: 24494
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 23885
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24461
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 26870548160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -