SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20018
         (688 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7PQR6 Cluster: ENSANGP00000003221; n=3; Endopterygota|...    94   3e-18
UniRef50_Q9VDG2 Cluster: RalA-binding protein 1; n=1; Drosophila...    73   9e-12
UniRef50_UPI0000D5610A Cluster: PREDICTED: similar to CG11622-PA...    72   2e-11
UniRef50_UPI0000DA37DC Cluster: PREDICTED: similar to RalA bindi...    60   5e-08
UniRef50_Q15311 Cluster: RalA-binding protein 1; n=39; Euteleost...    58   3e-07
UniRef50_UPI0000E46C52 Cluster: PREDICTED: similar to RLIP76 pro...    52   1e-05
UniRef50_A7SQL1 Cluster: Predicted protein; n=1; Nematostella ve...    51   3e-05
UniRef50_Q27267 Cluster: Putative uncharacterized protein tag-34...    47   4e-04
UniRef50_Q4WNH0 Cluster: Rho GTPase activator (Bem3), putative; ...    43   0.008
UniRef50_Q10164 Cluster: Probable Rho-type GTPase-activating pro...    42   0.011
UniRef50_Q9XVI0 Cluster: Putative uncharacterized protein rlbp-1...    42   0.019
UniRef50_A7T6J8 Cluster: Predicted protein; n=1; Nematostella ve...    42   0.019
UniRef50_Q8C170 Cluster: 10 days neonate skin cDNA, RIKEN full-l...    40   0.057
UniRef50_Q0CFX3 Cluster: Putative uncharacterized protein; n=2; ...    40   0.057
UniRef50_Q1LV01 Cluster: Novel protein; n=16; Danio rerio|Rep: N...    40   0.075
UniRef50_UPI000065CAE5 Cluster: myosin IXA; n=1; Takifugu rubrip...    39   0.099
UniRef50_Q9UNJ2 Cluster: Myosin-IXA; n=38; Euteleostomi|Rep: Myo...    39   0.099
UniRef50_Q5KA89 Cluster: Signal transducer, putative; n=1; Filob...    39   0.099
UniRef50_UPI0000DB7630 Cluster: PREDICTED: similar to Rho GTPase...    39   0.13 
UniRef50_UPI0000F1EAD6 Cluster: PREDICTED: hypothetical protein;...    38   0.17 
UniRef50_UPI00004D3AFF Cluster: UPI00004D3AFF related cluster; n...    38   0.17 
UniRef50_Q4SA83 Cluster: Chromosome 12 SCAF14692, whole genome s...    38   0.17 
UniRef50_Q4SHH2 Cluster: Chromosome 5 SCAF14581, whole genome sh...    38   0.23 
UniRef50_Q0UWA1 Cluster: Putative uncharacterized protein; n=1; ...    38   0.23 
UniRef50_Q4RYA5 Cluster: Chromosome 3 SCAF14978, whole genome sh...    38   0.30 
UniRef50_A1CE30 Cluster: RhoGAP domain protein; n=3; Aspergillus...    38   0.30 
UniRef50_UPI0000585067 Cluster: PREDICTED: similar to RIKEN cDNA...    37   0.40 
UniRef50_Q1DQZ7 Cluster: Putative uncharacterized protein; n=1; ...    37   0.40 
UniRef50_A6R389 Cluster: Putative uncharacterized protein; n=1; ...    37   0.40 
UniRef50_A1C738 Cluster: Rho GTPase activator (Lrg11), putative;...    37   0.40 
UniRef50_Q8K2H3 Cluster: Uncharacterized protein C5orf5 homolog;...    37   0.40 
UniRef50_Q7SHT9 Cluster: Putative uncharacterized protein NCU025...    37   0.53 
UniRef50_O13390 Cluster: GTPase activating protein homolog; n=7;...    37   0.53 
UniRef50_Q07960 Cluster: Rho GTPase-activating protein 1; n=30; ...    37   0.53 
UniRef50_Q9NYF5 Cluster: Uncharacterized protein C5orf5; n=25; E...    37   0.53 
UniRef50_Q4SQ36 Cluster: Chromosome 7 SCAF14536, whole genome sh...    36   0.70 
UniRef50_Q55DW9 Cluster: Putative uncharacterized protein; n=1; ...    36   0.93 
UniRef50_Q54SL6 Cluster: Putative uncharacterized protein; n=1; ...    36   0.93 
UniRef50_A2DD87 Cluster: RhoGAP domain containing protein; n=1; ...    36   0.93 
UniRef50_A7TKH9 Cluster: Putative uncharacterized protein; n=1; ...    36   0.93 
UniRef50_Q3E875 Cluster: Uncharacterized protein At5g61530.2; n=...    36   1.2  
UniRef50_Q86NH1 Cluster: Synapse defective protein 1, isoform a;...    36   1.2  
UniRef50_A7EF99 Cluster: Putative uncharacterized protein; n=1; ...    36   1.2  
UniRef50_A3GFQ9 Cluster: Cortical Rho GTPase activating protein;...    36   1.2  
UniRef50_UPI0000EBC9F9 Cluster: PREDICTED: similar to FAM13A1_v2...    35   1.6  
UniRef50_A1DI65 Cluster: Rho GTPase activator (Lrg11), putative;...    35   1.6  
UniRef50_Q9NRY4 Cluster: Glucocorticoid receptor DNA-binding fac...    35   1.6  
UniRef50_UPI0000F20C62 Cluster: PREDICTED: similar to Rho GTPase...    35   2.1  
UniRef50_Q7ZWQ2 Cluster: Arhgap12 protein; n=2; Xenopus|Rep: Arh...    35   2.1  
UniRef50_Q54TH9 Cluster: Putative uncharacterized protein; n=1; ...    35   2.1  
UniRef50_Q54NL0 Cluster: RhoGAP domain-containing protein; n=2; ...    35   2.1  
UniRef50_Q9P2N2 Cluster: Rho GTPase-activating protein 28; n=20;...    35   2.1  
UniRef50_UPI00015B542A Cluster: PREDICTED: similar to myosin-rho...    34   2.8  
UniRef50_UPI0000DB74CB Cluster: PREDICTED: similar to CG6424-PA,...    34   2.8  
UniRef50_UPI0000EB073C Cluster: Rho GTPase-activating protein 22...    34   2.8  
UniRef50_Q5KF77 Cluster: Rho GTPase activator, putative; n=2; Fi...    34   2.8  
UniRef50_Q8N264 Cluster: Rho GTPase-activating protein 24; n=38;...    34   2.8  
UniRef50_UPI00015B53CC Cluster: PREDICTED: similar to ENSANGP000...    34   3.7  
UniRef50_UPI0000E80EDA Cluster: PREDICTED: similar to MGC83845 p...    34   3.7  
UniRef50_Q4SQC0 Cluster: Chromosome 4 SCAF14533, whole genome sh...    34   3.7  
UniRef50_Q4SLV2 Cluster: Chromosome 13 SCAF14555, whole genome s...    34   3.7  
UniRef50_Q9V4C2 Cluster: CG1748-PA; n=3; Endopterygota|Rep: CG17...    34   3.7  
UniRef50_UPI0000F1D424 Cluster: PREDICTED: similar to hCG2019858...    33   4.9  
UniRef50_UPI00004D875D Cluster: Rho GTPase activating protein 2;...    33   4.9  
UniRef50_UPI0000611472 Cluster: UPI0000611472 related cluster; n...    33   4.9  
UniRef50_Q01Q65 Cluster: Cna B-type protein precursor; n=1; Soli...    33   4.9  
UniRef50_Q9VFK2 Cluster: CG31319-PA; n=6; Endopterygota|Rep: CG3...    33   4.9  
UniRef50_A7RKY9 Cluster: Predicted protein; n=1; Nematostella ve...    33   4.9  
UniRef50_Q7SF96 Cluster: Putative uncharacterized protein NCU005...    33   4.9  
UniRef50_A7EGQ4 Cluster: Putative uncharacterized protein; n=1; ...    33   4.9  
UniRef50_UPI0000E46DB5 Cluster: PREDICTED: similar to SLIT-ROBO ...    33   6.5  
UniRef50_Q6FP34 Cluster: Candida glabrata strain CBS138 chromoso...    33   6.5  
UniRef50_A6RIY7 Cluster: Putative uncharacterized protein; n=1; ...    33   6.5  
UniRef50_A5DX85 Cluster: Putative uncharacterized protein; n=1; ...    33   6.5  
UniRef50_UPI00015B50B9 Cluster: PREDICTED: similar to Rho GTPase...    33   8.6  
UniRef50_UPI0000F210C3 Cluster: PREDICTED: hypothetical protein;...    33   8.6  
UniRef50_A1KXK7 Cluster: Rho GTPase activating protein N/AflII-2...    33   8.6  
UniRef50_Q7D6H9 Cluster: Putative uncharacterized protein; n=9; ...    33   8.6  
UniRef50_Q7Z6I6 Cluster: Rho GTPase-activating protein 30; n=25;...    33   8.6  

>UniRef50_Q7PQR6 Cluster: ENSANGP00000003221; n=3;
           Endopterygota|Rep: ENSANGP00000003221 - Anopheles
           gambiae str. PEST
          Length = 610

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 45/84 (53%), Positives = 56/84 (66%)
 Frame = +3

Query: 255 IFTLGVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIK 434
           +  LG A PIFGV L  + ERSRCHD   LPLVVRD IDYLQ HGL+S+ IY+ E  K K
Sbjct: 161 VLELGDAQPIFGVSLGLATERSRCHDGINLPLVVRDCIDYLQEHGLQSEQIYKVEAVKTK 220

Query: 435 FQQLRKLFTDRGPTFPYHWDVPVA 506
            QQL++ + +R  +     DVP+A
Sbjct: 221 LQQLKRTYNNREGSCSGEMDVPIA 244



 Score = 33.1 bits (72), Expect = 6.5
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +2

Query: 512 MLKAFISELPESILTQELHGQFEQATAIAE-PQREATMTNLI 634
           +LK F+ ELPE ILT +L  +FE+  + ++  Q+E  +  L+
Sbjct: 247 LLKMFLRELPEPILTTDLSSRFEEVASHSQVSQQEQELVCLV 288


>UniRef50_Q9VDG2 Cluster: RalA-binding protein 1; n=1; Drosophila
           melanogaster|Rep: RalA-binding protein 1 - Drosophila
           melanogaster (Fruit fly)
          Length = 625

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 32/68 (47%), Positives = 45/68 (66%)
 Frame = +3

Query: 264 LGVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQ 443
           L +  P+FGV +  + ERSRCHD   +PLVVRD ID+LQ H LK + IY+ EP K +   
Sbjct: 180 LALGYPVFGVSVSLATERSRCHDGVDIPLVVRDCIDFLQDH-LKCEQIYKIEPIKTRLMH 238

Query: 444 LRKLFTDR 467
            ++L+ +R
Sbjct: 239 FKRLYNNR 246


>UniRef50_UPI0000D5610A Cluster: PREDICTED: similar to CG11622-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG11622-PA - Tribolium castaneum
          Length = 526

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 33/79 (41%), Positives = 47/79 (59%)
 Frame = +3

Query: 264 LGVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQ 443
           +G  LPIFG  L  +VERSRCHD   +PL +R+ IDY++  G+  + IY+    K K  Q
Sbjct: 141 IGDILPIFGASLDVAVERSRCHDGVDIPLPIRECIDYVETVGMSFEGIYKISGTKSKVLQ 200

Query: 444 LRKLFTDRGPTFPYHWDVP 500
           +RK++  RG      +D P
Sbjct: 201 IRKMYNQRGNINLNDYDPP 219


>UniRef50_UPI0000DA37DC Cluster: PREDICTED: similar to RalA binding
           protein 1; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to RalA binding protein 1 - Rattus norvegicus
          Length = 666

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 25/60 (41%), Positives = 38/60 (63%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PIFGVPL  +VER+  +D   LP V R+ +DY++ HG+K + +YR    K K  +L+  +
Sbjct: 136 PIFGVPLADAVERTMMYDGIRLPAVFRECVDYMEQHGMKCEGVYRVSGVKSKVDELKAAY 195


>UniRef50_Q15311 Cluster: RalA-binding protein 1; n=39;
           Euteleostomi|Rep: RalA-binding protein 1 - Homo sapiens
           (Human)
          Length = 655

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 25/60 (41%), Positives = 38/60 (63%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PIFG+PL  +VER+  +D   LP V R+ IDY++ +G+K + IYR    K K  +L+  +
Sbjct: 188 PIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAY 247


>UniRef50_UPI0000E46C52 Cluster: PREDICTED: similar to RLIP76
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to RLIP76 protein -
           Strongylocentrotus purpuratus
          Length = 797

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/62 (37%), Positives = 39/62 (62%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PIFG+ L+ +V +S+ +D+  LP +VR+ IDY++  GL +  IYR    K K + L+  +
Sbjct: 177 PIFGILLEDAVAKSKLYDNIELPKIVRECIDYVEEFGLTTAGIYRLSGVKSKVEALKAQY 236

Query: 459 TD 464
            +
Sbjct: 237 NN 238


>UniRef50_A7SQL1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 537

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 25/64 (39%), Positives = 41/64 (64%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PIFG+PL+++V++S   D   LP + R+ I Y++ +GL  + IYR    K K   L++L+
Sbjct: 97  PIFGIPLEKAVKQSILPDGVELPRLFREGIMYVEENGLNVEGIYRVSGVKSKVDALKELY 156

Query: 459 TDRG 470
            D+G
Sbjct: 157 -DQG 159


>UniRef50_Q27267 Cluster: Putative uncharacterized protein tag-341;
           n=3; Caenorhabditis|Rep: Putative uncharacterized
           protein tag-341 - Caenorhabditis elegans
          Length = 775

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 25/59 (42%), Positives = 36/59 (61%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           IFGVPL+  +E    H +  +PL++  SID LQ  GL++K IYRT   K K +++   F
Sbjct: 405 IFGVPLKGLLE----HQNRHIPLIIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAF 459


>UniRef50_Q4WNH0 Cluster: Rho GTPase activator (Bem3), putative; n=2;
            Trichocomaceae|Rep: Rho GTPase activator (Bem3), putative
            - Aspergillus fumigatus (Sartorya fumigata)
          Length = 1508

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +3

Query: 279  PIFGVPLQQSVERSRCHD-DTGLPLVVRDSIDYLQAHGLKSKD-IYRTEPDKIKFQQLRK 452
            P+FG+PL ++V+    H  D  LP VV   I+YL+A G  +++ I+R     +  + L++
Sbjct: 1147 PVFGIPLAEAVQHCAPHGIDVDLPAVVYRCIEYLKAKGAATEEGIFRLSGSNVVVKALKE 1206

Query: 453  LFTDRG 470
             F   G
Sbjct: 1207 RFNTEG 1212


>UniRef50_Q10164 Cluster: Probable Rho-type GTPase-activating protein
            2; n=1; Schizosaccharomyces pombe|Rep: Probable Rho-type
            GTPase-activating protein 2 - Schizosaccharomyces pombe
            (Fission yeast)
          Length = 1275

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +3

Query: 282  IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQA-HGLKSKDIYRTEPDKIKFQQLRKLF 458
            IFG+PL ++V  S   +D+GLP+VV   I+YL++    K + IYR        + L++ F
Sbjct: 1062 IFGLPLNEAVNISTQFNDSGLPIVVYRCIEYLESCRAEKEEGIYRLSGSASTIKHLKEQF 1121

Query: 459  TD 464
             +
Sbjct: 1122 NE 1123


>UniRef50_Q9XVI0 Cluster: Putative uncharacterized protein rlbp-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein rlbp-1 - Caenorhabditis elegans
          Length = 512

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 19/57 (33%), Positives = 32/57 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK 452
           + G+PL +SV      D   LP   R +ID+++ +GL ++ IYR  P K +  +L +
Sbjct: 52  VLGLPLTESVSADPSLDGIPLPSFFRYAIDFVEENGLCTEGIYRLSPPKSRLDELER 108


>UniRef50_A7T6J8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 444

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 24/62 (38%), Positives = 38/62 (61%), Gaps = 3/62 (4%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPD---KIKFQQLR 449
           PIFG+PL+++V++S   D   LP + R+ I Y++ +G K  D+   EP+    I  Q LR
Sbjct: 97  PIFGIPLEKAVKQSILPDGVELPRLFREGIMYVEENG-KQVDLKEYEPEVVASIVKQYLR 155

Query: 450 KL 455
           +L
Sbjct: 156 EL 157


>UniRef50_Q8C170 Cluster: 10 days neonate skin cDNA, RIKEN
           full-length enriched library, clone:4732465J09
           product:MYOSIN-IXA homolog; n=12; Tetrapoda|Rep: 10 days
           neonate skin cDNA, RIKEN full-length enriched library,
           clone:4732465J09 product:MYOSIN-IXA homolog - Mus
           musculus (Mouse)
          Length = 692

 Score = 39.9 bits (89), Expect = 0.057
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = +3

Query: 300 QQSVERSRC-HDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK-LFTD 464
           Q  VE SR   +D  +PLVV   I+Y++ HGL ++ IYR      K ++LR+ L TD
Sbjct: 212 QFGVELSRLTSEDRAVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDTD 268


>UniRef50_Q0CFX3 Cluster: Putative uncharacterized protein; n=2;
            Trichocomaceae|Rep: Putative uncharacterized protein -
            Aspergillus terreus (strain NIH 2624)
          Length = 1409

 Score = 39.9 bits (89), Expect = 0.057
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 4/68 (5%)
 Frame = +3

Query: 279  PIFGVPLQQSVE---RSRCHDDTGLPLVVRDSIDYLQAHGLKSKD-IYRTEPDKIKFQQL 446
            P+FG+PL ++V+         DT LP VV   I+YL+A G +S++ I+R     +  + L
Sbjct: 1104 PVFGIPLAEAVQFCPPQGIGVDTELPAVVYRCIEYLKAKGAESEEGIFRLSGSNVVVKAL 1163

Query: 447  RKLFTDRG 470
            ++ F   G
Sbjct: 1164 KERFNTEG 1171



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 13/43 (30%), Positives = 27/43 (62%)
 Frame = +2

Query: 509  AMLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
            ++ K ++ ELP S+LT+ELH +F +   + E +++    N ++
Sbjct: 1189 SLFKQYLRELPTSVLTRELHIEFLRVLELTEKEKKIVAFNALV 1231


>UniRef50_Q1LV01 Cluster: Novel protein; n=16; Danio rerio|Rep:
           Novel protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 174

 Score = 39.5 bits (88), Expect = 0.075
 Identities = 22/63 (34%), Positives = 33/63 (52%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FGVPL    +  R     GLPL     + +L+ HGL +  ++R     ++  +LRK F 
Sbjct: 14  VFGVPLSHLRKTGRMRQ--GLPLAFTHLVSFLEKHGLSTIGLFRVGGTVLRQYELRKCF- 70

Query: 462 DRG 470
           DRG
Sbjct: 71  DRG 73


>UniRef50_UPI000065CAE5 Cluster: myosin IXA; n=1; Takifugu
            rubripes|Rep: myosin IXA - Takifugu rubripes
          Length = 2415

 Score = 39.1 bits (87), Expect = 0.099
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 2/57 (3%)
 Frame = +3

Query: 300  QQSVERSRC-HDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK-LFTD 464
            Q  VE SR  +D+  +PLVV   I+Y++ HGL ++ IYR      K ++L++ L TD
Sbjct: 1996 QFGVEVSRLTNDERAVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIRELKQGLDTD 2052


>UniRef50_Q9UNJ2 Cluster: Myosin-IXA; n=38; Euteleostomi|Rep:
            Myosin-IXA - Homo sapiens (Human)
          Length = 2548

 Score = 39.1 bits (87), Expect = 0.099
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = +3

Query: 300  QQSVERSRC-HDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK-LFTD 464
            Q  VE SR   +D  +PLVV   I+Y++ HGL ++ IYR      K ++LR+ L TD
Sbjct: 2060 QFGVELSRLTSEDRTVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDTD 2116


>UniRef50_Q5KA89 Cluster: Signal transducer, putative; n=1;
            Filobasidiella neoformans|Rep: Signal transducer,
            putative - Cryptococcus neoformans (Filobasidiella
            neoformans)
          Length = 1151

 Score = 39.1 bits (87), Expect = 0.099
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 5/77 (6%)
 Frame = +3

Query: 279  PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKD-IYRTEPDKIKFQQLRKL 455
            P+FGVPL  S+  +      GLP +V   I+YL+A   + ++ IYR        + L++ 
Sbjct: 868  PVFGVPLTDSIAVANI---AGLPAIVFRCIEYLEAKKAEDEEGIYRLSGSSAVIKGLKEK 924

Query: 456  FTDRGP----TFPYHWD 494
            F D+G         HWD
Sbjct: 925  FDDQGDIKLLAADEHWD 941



 Score = 33.5 bits (73), Expect = 4.9
 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 512  MLKAFISELPESILTQELHGQFEQATAIAE-PQREATMTNLI 634
            +LK F+ +LP S+LT+ELH +F       E  +R A + +L+
Sbjct: 948  LLKTFLRDLPTSLLTRELHARFLAVMDFVESSERIAELAHLV 989


>UniRef50_UPI0000DB7630 Cluster: PREDICTED: similar to Rho GTPase
            activating protein 21 isoform 1; n=1; Apis mellifera|Rep:
            PREDICTED: similar to Rho GTPase activating protein 21
            isoform 1 - Apis mellifera
          Length = 1943

 Score = 38.7 bits (86), Expect = 0.13
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = +2

Query: 509  AMLKAFISELPESILTQELHGQFEQATAIAEPQREAT 619
            ++LK+F  +LP+S+LT EL+  F  A  + +PQR  T
Sbjct: 1386 SLLKSFFRQLPDSLLTAELYPMFIDADKVEDPQRRMT 1422


>UniRef50_UPI0000F1EAD6 Cluster: PREDICTED: hypothetical protein; n=1;
            Danio rerio|Rep: PREDICTED: hypothetical protein - Danio
            rerio
          Length = 2049

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 2/57 (3%)
 Frame = +3

Query: 300  QQSVERSRC-HDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK-LFTD 464
            Q  VE SR  +D+  +PLVV   ++Y++ HGL ++ IYR      K ++L++ L TD
Sbjct: 1578 QFGVELSRLTNDERTVPLVVEKLVNYIEMHGLYTEGIYRKSGSTNKIKELKQGLDTD 1634


>UniRef50_UPI00004D3AFF Cluster: UPI00004D3AFF related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00004D3AFF UniRef100 entry -
           Xenopus tropicalis
          Length = 167

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 20/63 (31%), Positives = 36/63 (57%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FGV    S+E+ +  D   +PLV++D +++L   GLK K ++R      K + L+  + 
Sbjct: 5   VFGV----SLEQCKSKDTDSIPLVIKDIVEHLSMFGLKHKGLFRISASVHKVKTLKAKY- 59

Query: 462 DRG 470
           D+G
Sbjct: 60  DKG 62


>UniRef50_Q4SA83 Cluster: Chromosome 12 SCAF14692, whole genome
           shotgun sequence; n=5; Clupeocephala|Rep: Chromosome 12
           SCAF14692, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 483

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FG  L  +V   +      +P++V+  ++++Q HGL  + I+R        +Q R+ F 
Sbjct: 1   VFGKSLVDTVTYEQRFGPRTVPILVQKCVEFIQEHGLTEEGIFRLPGQDNAVKQFREAF- 59

Query: 462 DRG--PTFPYHWDV 497
           D G  P+FP   DV
Sbjct: 60  DAGERPSFPSDTDV 73


>UniRef50_Q4SHH2 Cluster: Chromosome 5 SCAF14581, whole genome shotgun
            sequence; n=2; Tetraodon nigroviridis|Rep: Chromosome 5
            SCAF14581, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 2373

 Score = 37.9 bits (84), Expect = 0.23
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = +3

Query: 300  QQSVERSRCH-DDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK-LFTD 464
            Q  VE SR   D+  +PLVV   I+Y++ HGL ++ IYR      K ++L++ L TD
Sbjct: 1956 QFGVEVSRLTTDERAVPLVVEKLINYIEMHGLYAEGIYRKSGSANKIRELKQGLDTD 2012


>UniRef50_Q0UWA1 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1507

 Score = 37.9 bits (84), Expect = 0.23
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = +3

Query: 282  IFGVPLQQSVERSR-CHDDTGLPLVVRDSIDYLQ-AHGLKSKDIYRTEPDKIKFQQLRKL 455
            IFG+PLQ++VE S+    +  LP VV   ++YLQ    +  + I+R     I  + LR+ 
Sbjct: 1153 IFGIPLQEAVEYSQPAGVNVPLPAVVYRCLEYLQEKKAINEEGIFRLSGSNIVIKGLRER 1212

Query: 456  FTDRG 470
            F   G
Sbjct: 1213 FNTEG 1217



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 15/43 (34%), Positives = 27/43 (62%)
 Frame = +2

Query: 509  AMLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
            ++LK ++ ELP SILT+ELH  F +   + E  ++    N+++
Sbjct: 1234 SLLKLYLRELPSSILTRELHLDFLKVLDMDERSKKIQTFNVLV 1276


>UniRef50_Q4RYA5 Cluster: Chromosome 3 SCAF14978, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 3 SCAF14978, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 315

 Score = 37.5 bits (83), Expect = 0.30
 Identities = 21/67 (31%), Positives = 37/67 (55%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FGV LQ  + R R  DD  +P+V+RD+I +L   GL+ + I+R   +    ++++  + 
Sbjct: 146 VFGVSLQ--LLRHRSSDDDCVPVVMRDTICFLSEQGLEIEGIFRRSANVTLVKEIQHRYN 203

Query: 462 DRGPTFP 482
               T P
Sbjct: 204 SGQITSP 210


>UniRef50_A1CE30 Cluster: RhoGAP domain protein; n=3; Aspergillus|Rep:
            RhoGAP domain protein - Aspergillus clavatus
          Length = 1289

 Score = 37.5 bits (83), Expect = 0.30
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
 Frame = +3

Query: 279  PIFGVPLQQSVERSRCHD-DTGLPLVVRDSIDYLQAHGLKSKD-IYRTEPDKIKFQQLRK 452
            P+FG+PL ++V+       +  LP VV   I+YLQA G  +++ I+R     +  + L++
Sbjct: 980  PVFGIPLAEAVQFCAPQGVNIDLPAVVYRCIEYLQAKGAATEEGIFRLSGSNVVVKALKE 1039

Query: 453  LFTDRG 470
             F   G
Sbjct: 1040 RFNTEG 1045


>UniRef50_UPI0000585067 Cluster: PREDICTED: similar to RIKEN cDNA
           3110043J09 gene; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to RIKEN cDNA 3110043J09 gene -
           Strongylocentrotus purpuratus
          Length = 337

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 17/63 (26%), Positives = 39/63 (61%)
 Frame = +3

Query: 285 FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTD 464
           FGV L+   E      +  +P VVR++++YL+ +GL+++ ++R  P+ I  +++++++  
Sbjct: 114 FGVSLEFLRENGA---EEAIPKVVRETVEYLKRNGLRTEGLFRRCPNAITVKKVQEMYNR 170

Query: 465 RGP 473
             P
Sbjct: 171 GDP 173


>UniRef50_Q1DQZ7 Cluster: Putative uncharacterized protein; n=1;
            Coccidioides immitis|Rep: Putative uncharacterized
            protein - Coccidioides immitis
          Length = 1472

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
 Frame = +3

Query: 279  PIFGVPLQQSVERSRCHD-DTGLPLVVRDSIDYLQAHGLKSKD-IYRTEPDKIKFQQLRK 452
            P+FG+PL ++VE       D GLP VV   ++YL+A   + ++ I+R     +  + L++
Sbjct: 1162 PVFGLPLAEAVEFCGPRGFDCGLPAVVYRCLEYLRAQRAELEEGIFRLSGSNVVIKALKE 1221

Query: 453  LFTDRG 470
             F   G
Sbjct: 1222 RFNTEG 1227


>UniRef50_A6R389 Cluster: Putative uncharacterized protein; n=1;
            Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized
            protein - Ajellomyces capsulatus NAm1
          Length = 1689

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = +3

Query: 282  IFGVPLQQSVERSRCHD-DTGLPLVVRDSIDYLQAHGLKSKD-IYRTEPDKIKFQQLRKL 455
            +FG+PL ++VE       +TGLP VV   IDYL+A     ++ I+R     +  + L++ 
Sbjct: 1306 VFGLPLAEAVEYCGVPGLNTGLPAVVYRCIDYLRAKDAALEEGIFRLSGSNVVIRSLKEK 1365

Query: 456  FTDRG 470
            F   G
Sbjct: 1366 FNTEG 1370


>UniRef50_A1C738 Cluster: Rho GTPase activator (Lrg11), putative; n=5;
            Pezizomycotina|Rep: Rho GTPase activator (Lrg11),
            putative - Aspergillus clavatus
          Length = 1215

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 15/41 (36%), Positives = 28/41 (68%)
 Frame = +2

Query: 509  AMLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNL 631
            A+LK F+ E+P+ +LT +LH  F  +  IA+P+++  + +L
Sbjct: 940  ALLKKFLREMPDPLLTFKLHNLFVISQKIADPEKQKRLLHL 980


>UniRef50_Q8K2H3 Cluster: Uncharacterized protein C5orf5 homolog;
           n=9; Mammalia|Rep: Uncharacterized protein C5orf5
           homolog - Mus musculus (Mouse)
          Length = 851

 Score = 37.1 bits (82), Expect = 0.40
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 270 VALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAH-GLKSKDIYRTEPDKIKFQQL 446
           +A  IFG+PL +  +    H D  +P +VR  +DY++ H GL+ + +++   +    + L
Sbjct: 16  LASKIFGIPLDELQQGG--HPDNEVPFIVRHVVDYIEEHGGLEQQGLFQVNGNAETVEWL 73

Query: 447 RKLF 458
           R+ +
Sbjct: 74  RQRY 77


>UniRef50_Q7SHT9 Cluster: Putative uncharacterized protein NCU02524.1;
            n=2; Sordariomycetes|Rep: Putative uncharacterized
            protein NCU02524.1 - Neurospora crassa
          Length = 1464

 Score = 36.7 bits (81), Expect = 0.53
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = +3

Query: 267  GVALPIFGVPLQQSVERSRCHD-DTGLPLVVRDSIDYLQA-HGLKSKDIYRTEPDKIKFQ 440
            G   P+FG PL ++V  +   D    LP VV   I YL A   +  + I+R     +  +
Sbjct: 1117 GPVRPVFGAPLAEAVRYNAPADVRVPLPAVVYRCIQYLDAKDAINEEGIFRLSGSNVVIK 1176

Query: 441  QLRKLFTDRG 470
            QL++ F + G
Sbjct: 1177 QLKERFNNEG 1186



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 17/44 (38%), Positives = 30/44 (68%), Gaps = 2/44 (4%)
 Frame = +2

Query: 509  AMLKAFISELPESILTQELHGQFEQATAIA--EPQREATMTNLI 634
            ++LKA++ ELP +ILT++LH +F+  T     + QR A ++ L+
Sbjct: 1204 SLLKAYLRELPTTILTRDLHPEFQSVTEKLPDQAQRIAALSVLV 1247


>UniRef50_O13390 Cluster: GTPase activating protein homolog; n=7;
           Pleosporales|Rep: GTPase activating protein homolog -
           Cochliobolus heterostrophus (Drechslera maydis)
          Length = 714

 Score = 36.7 bits (81), Expect = 0.53
 Identities = 20/60 (33%), Positives = 32/60 (53%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PIFGV L++   R    D + +P++V   I  +  +GL+ + IYR        QQ++ LF
Sbjct: 527 PIFGVTLEELFRR----DGSPVPIIVYQCIQAVDLYGLEVEGIYRIPGTSSHIQQMKALF 582


>UniRef50_Q07960 Cluster: Rho GTPase-activating protein 1; n=30;
           Euteleostomi|Rep: Rho GTPase-activating protein 1 - Homo
           sapiens (Human)
          Length = 439

 Score = 36.7 bits (81), Expect = 0.53
 Identities = 17/43 (39%), Positives = 29/43 (67%)
 Frame = +3

Query: 285 FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           FGV LQ   E++   +   +P+V+R+++ YLQAH L ++ I+R
Sbjct: 242 FGVSLQHLQEKNP--EQEPIPIVLRETVAYLQAHALTTEGIFR 282


>UniRef50_Q9NYF5 Cluster: Uncharacterized protein C5orf5; n=25;
           Euteleostomi|Rep: Uncharacterized protein C5orf5 - Homo
           sapiens (Human)
          Length = 915

 Score = 36.7 bits (81), Expect = 0.53
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 270 VALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAH-GLKSKDIYRTEPDKIKFQQL 446
           +A  IFG+PL +  +    H D  +P +VR  +DY++ H GL+ + +++   +    + L
Sbjct: 16  LANKIFGIPLDELQQGG--HPDNEVPFIVRHVVDYIEEHGGLEQQGLFQVNGNAETVEWL 73

Query: 447 RKLF 458
           R+ +
Sbjct: 74  RQRY 77


>UniRef50_Q4SQ36 Cluster: Chromosome 7 SCAF14536, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 7
           SCAF14536, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 471

 Score = 36.3 bits (80), Expect = 0.70
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF- 458
           +FG  L+++V   R +    +PL+V   + +++ HGL+   ++R        Q+L++ F 
Sbjct: 2   VFGQRLEETVLYERRYGVRLVPLIVEQCVGFIRDHGLQEVGLFRLPGQASLVQELQQAFD 61

Query: 459 TDRGPTFPYHWDV 497
           + + P+F  + DV
Sbjct: 62  SGKRPSFDGNTDV 74


>UniRef50_Q55DW9 Cluster: Putative uncharacterized protein; n=1;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1043

 Score = 35.9 bits (79), Expect = 0.93
 Identities = 20/63 (31%), Positives = 36/63 (57%)
 Frame = +3

Query: 282  IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
            IFG+PL+++V++S       +P V+  SI+Y++  G++ + I+R          L+  F 
Sbjct: 852  IFGIPLEEAVKKSATLHPL-IPDVIYKSIEYIREKGIQEEGIFRLSGSANAITLLKNEF- 909

Query: 462  DRG 470
            DRG
Sbjct: 910  DRG 912


>UniRef50_Q54SL6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 531

 Score = 35.9 bits (79), Expect = 0.93
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF-TDRGPTFPYH 488
           LP ++  +IDYLQ  GL++  I+R        Q  R L+  D+   FP H
Sbjct: 77  LPTILVQTIDYLQLFGLQTPGIFRENGSLASIQSYRSLYDNDKPVNFPPH 126


>UniRef50_A2DD87 Cluster: RhoGAP domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: RhoGAP domain containing
           protein - Trichomonas vaginalis G3
          Length = 431

 Score = 35.9 bits (79), Expect = 0.93
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPL--VVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK 452
           IF  PL  +++ +    +T LP+   ++  +DYL A+GLK + IYR        + L+K
Sbjct: 113 IFNKPLLNALKINPDDRETPLPIPYFIKTGVDYLNANGLKVEGIYRLNGSSANIETLQK 171


>UniRef50_A7TKH9 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 702

 Score = 35.9 bits (79), Expect = 0.93
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 276 LPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKL 455
           L +FG PL+   E    ++   +P +VR SI  +  +GL+ ++IYR  P  ++F +  K 
Sbjct: 503 LKLFGAPLENLFE----YEQDMVPSIVRQSIHVIDKYGLELEEIYR-HPVGLEFLESLKN 557

Query: 456 FTDRGPT 476
             +  PT
Sbjct: 558 QVENNPT 564


>UniRef50_Q3E875 Cluster: Uncharacterized protein At5g61530.2; n=9;
           Magnoliophyta|Rep: Uncharacterized protein At5g61530.2 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 367

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQL 446
           +FGV ++ +V+R        +PL++    DYL   GL S ++++ E D+   QQL
Sbjct: 136 VFGVAIEITVQRQE--SSRPIPLILVKCADYLILTGLNSPNLFKAEGDRKLIQQL 188


>UniRef50_Q86NH1 Cluster: Synapse defective protein 1, isoform a;
           n=4; Caenorhabditis|Rep: Synapse defective protein 1,
           isoform a - Caenorhabditis elegans
          Length = 987

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 13/42 (30%), Positives = 27/42 (64%)
 Frame = +2

Query: 512 MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           ++K F+ ELPE +++ ++HG   +A ++A P    T  +L++
Sbjct: 829 LIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVL 870


>UniRef50_A7EF99 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 693

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR-TEPDKIKFQQLRKL 455
           P+FG+ L++  ER    D + +P++V   I  +   GL+ + IYR ++  K+ F+     
Sbjct: 511 PVFGLSLEELFER----DGSAVPMIVYQCIQAVDLFGLEVEGIYRLSDASKVDFRNPESF 566

Query: 456 FTD 464
           F D
Sbjct: 567 FHD 569


>UniRef50_A3GFQ9 Cluster: Cortical Rho GTPase activating protein;
           n=3; Pichia|Rep: Cortical Rho GTPase activating protein
           - Pichia stipitis (Yeast)
          Length = 591

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 17/66 (25%), Positives = 35/66 (53%)
 Frame = +3

Query: 252 RIFTLGVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKI 431
           ++    ++ P FGV ++  ++ +       +P VV+   + ++ +GL  + IYRT  +K 
Sbjct: 379 KVLKTQISQPTFGVSIEDVIQYA---GQDNVPYVVKKCFETIERYGLDLEGIYRTSGNKA 435

Query: 432 KFQQLR 449
             QQL+
Sbjct: 436 AVQQLK 441


>UniRef50_UPI0000EBC9F9 Cluster: PREDICTED: similar to FAM13A1_v2
           protein; n=2; Bos taurus|Rep: PREDICTED: similar to
           FAM13A1_v2 protein - Bos taurus
          Length = 447

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
 Frame = +2

Query: 476 IPVSLGRS---CRLA-MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNL 631
           +PV LGR    C  A +LK F+ ELPES++T  L  +F Q     + + +A  +NL
Sbjct: 228 VPVELGRDGDVCAAASLLKLFLRELPESVITSTLQPRFLQ--LFQDDRNDAQESNL 281



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 19/64 (29%), Positives = 32/64 (50%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FGV LQ   ++     + G+P +V   ++YL  HGL  + ++R   +    +QLR  F 
Sbjct: 168 LFGVSLQDLHQQGLT--ENGVPAIVGSIVEYLTMHGLTQEGLFRVNGNVKVVEQLRWKFE 225

Query: 462 DRGP 473
              P
Sbjct: 226 SGVP 229


>UniRef50_A1DI65 Cluster: Rho GTPase activator (Lrg11), putative; n=3;
            Eurotiomycetidae|Rep: Rho GTPase activator (Lrg11),
            putative - Neosartorya fischeri (strain ATCC 1020 / DSM
            3700 / NRRL 181)(Aspergillus fischerianus (strain ATCC
            1020 / DSM 3700 / NRRL 181))
          Length = 1239

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 14/41 (34%), Positives = 27/41 (65%)
 Frame = +2

Query: 509  AMLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNL 631
            A+LK F+ E+P+ +LT +LH  F  +  I +P+++  + +L
Sbjct: 964  ALLKKFLREMPDPLLTFKLHNLFVISQKIPDPEKQKRLLHL 1004


>UniRef50_Q9NRY4 Cluster: Glucocorticoid receptor DNA-binding factor
            1; n=23; cellular organisms|Rep: Glucocorticoid receptor
            DNA-binding factor 1 - Homo sapiens (Human)
          Length = 1513

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = +3

Query: 285  FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
            FGVPL   V   +      +P+ +   I+Y++A GL ++ IYR   +K + + L++ F
Sbjct: 1247 FGVPLTTVVTPEK-----PIPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQF 1299


>UniRef50_UPI0000F20C62 Cluster: PREDICTED: similar to Rho GTPase
           activating protein 24; n=1; Danio rerio|Rep: PREDICTED:
           similar to Rho GTPase activating protein 24 - Danio
           rerio
          Length = 621

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FG  L+++V   R + D   PLVV   +D+++  GL    ++R        ++L++ F 
Sbjct: 33  VFGQRLEETVLYERRYGDHMAPLVVEQCVDFIRERGLTEVGLFRQPGQATLVKELQEAF- 91

Query: 462 DRG--PTF 479
           D G  P+F
Sbjct: 92  DAGEKPSF 99


>UniRef50_Q7ZWQ2 Cluster: Arhgap12 protein; n=2; Xenopus|Rep:
           Arhgap12 protein - Xenopus laevis (African clawed frog)
          Length = 776

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLR 449
           P+FG  L    +R    ++T +P  V+  ID+++AHGL    +YR   +    Q+LR
Sbjct: 582 PVFGSSLTSLCQR----ENTTVPNFVKMCIDHVEAHGLDVDGLYRVSGNLAVIQKLR 634


>UniRef50_Q54TH9 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 721

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 1/65 (1%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTG-LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKL 455
           PIFG PL+  + R    D+ G +P++    I YL   GL+ + ++R      + + LR+ 
Sbjct: 524 PIFGAPLEDVINRP---DNPGEIPVLFEKGIAYLSRRGLQVEGLFRLSGANSQIKSLRQG 580

Query: 456 FTDRG 470
           F D+G
Sbjct: 581 F-DQG 584


>UniRef50_Q54NL0 Cluster: RhoGAP domain-containing protein; n=2;
           Dictyostelium discoideum|Rep: RhoGAP domain-containing
           protein - Dictyostelium discoideum AX4
          Length = 1009

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 21/66 (31%), Positives = 33/66 (50%)
 Frame = +3

Query: 273 ALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK 452
           A  IFGVPL Q      C   + +P+++   ID+++   L S+ ++R     +   Q  K
Sbjct: 157 ARKIFGVPLTQVP----CRAGSNVPIIIEKLIDHIERTSLNSEGLFRIPGVDLTINQYIK 212

Query: 453 LFTDRG 470
           LF D G
Sbjct: 213 LF-DNG 217


>UniRef50_Q9P2N2 Cluster: Rho GTPase-activating protein 28; n=20;
           Eutheria|Rep: Rho GTPase-activating protein 28 - Homo
           sapiens (Human)
          Length = 729

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDD-TGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           IFGVPL   ++  R  D    +PLV++   + ++  GL+S+ I+R      K +Q R+  
Sbjct: 377 IFGVPLTVLLDGDRKKDPGVKVPLVLQKFFEKVEESGLESEGIFRLSGCTAKVKQYREEL 436

Query: 459 TDRGPTFPYHWD 494
             +     + WD
Sbjct: 437 DAKFNADKFKWD 448


>UniRef50_UPI00015B542A Cluster: PREDICTED: similar to myosin-rhogap
            protein, myr; n=1; Nasonia vitripennis|Rep: PREDICTED:
            similar to myosin-rhogap protein, myr - Nasonia
            vitripennis
          Length = 2292

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +2

Query: 509  AMLKAFISELPESILTQELHGQFEQATAIAEPQ 607
            A+LK+F  ++PE +LT E +  F  A ++ EPQ
Sbjct: 1727 AVLKSFFRDMPEPLLTFEYYDDFLHAASLTEPQ 1759


>UniRef50_UPI0000DB74CB Cluster: PREDICTED: similar to CG6424-PA,
           isoform A isoform 1, partial; n=1; Apis mellifera|Rep:
           PREDICTED: similar to CG6424-PA, isoform A isoform 1,
           partial - Apis mellifera
          Length = 807

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +3

Query: 333 DTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKF-QQLRKLFTDRG 470
           DTG+P VV    +Y++ HG +S  ++R      +  ++LR  F  RG
Sbjct: 39  DTGVPFVVHRLCNYIETHGFQSAAVFRLSGGSPRLAERLRATFERRG 85


>UniRef50_UPI0000EB073C Cluster: Rho GTPase-activating protein 22
           (Rho-type GTPase-activating protein 22).; n=1; Canis
           lupus familiaris|Rep: Rho GTPase-activating protein 22
           (Rho-type GTPase-activating protein 22). - Canis
           familiaris
          Length = 651

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           IFG  L+ +V   R +     PL+V   +D+++ HGL  + ++R
Sbjct: 37  IFGQRLEDTVHHERKYGPRLAPLLVEQCVDFIREHGLTEEGLFR 80


>UniRef50_Q5KF77 Cluster: Rho GTPase activator, putative; n=2;
            Filobasidiella neoformans|Rep: Rho GTPase activator,
            putative - Cryptococcus neoformans (Filobasidiella
            neoformans)
          Length = 1296

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +2

Query: 431  KVSTTEEAVHGSRAYIPVSLGRSCRLA-MLKAFISELPESILTQELHGQFEQATAIAEPQ 607
            K+ T  EA+      + +S     +LA +LK F+ ELP+ +LT  LH  F  A  +   +
Sbjct: 1052 KLQTLVEALDKDSTAVNLSEENVIQLAALLKRFLRELPDPLLTFRLHKLFCAAATLPNLE 1111

Query: 608  REATMTNLIIS 640
              +   +L++S
Sbjct: 1112 ERSRCLHLLVS 1122


>UniRef50_Q8N264 Cluster: Rho GTPase-activating protein 24; n=38;
           Euteleostomi|Rep: Rho GTPase-activating protein 24 -
           Homo sapiens (Human)
          Length = 748

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF- 458
           IFG  L+ +V   + + +   P++V   +D+++  GLK + ++R        ++L+  F 
Sbjct: 132 IFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFD 191

Query: 459 TDRGPTFPYHWDV 497
               P+F  + DV
Sbjct: 192 CGEKPSFDSNTDV 204


>UniRef50_UPI00015B53CC Cluster: PREDICTED: similar to
           ENSANGP00000028300; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000028300 - Nasonia
           vitripennis
          Length = 801

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +3

Query: 303 QSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDR 467
           + +E    H++TG+P VV     YL+A+G  +  ++R      K  +  +L  DR
Sbjct: 84  RELELVETHNETGVPYVVYRLCSYLEAYGFHNPALFRLASSSSKLAERLRLAFDR 138


>UniRef50_UPI0000E80EDA Cluster: PREDICTED: similar to MGC83845
           protein; n=2; Gallus gallus|Rep: PREDICTED: similar to
           MGC83845 protein - Gallus gallus
          Length = 978

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKL 455
           +FGVPL  +V+R+  H    LP+ +  ++DYL++H L    ++R    + +   LR++
Sbjct: 712 VFGVPLLLNVQRTN-HP---LPIGILQALDYLRSHFLDQVGLFRKSGVRSRILSLREM 765


>UniRef50_Q4SQC0 Cluster: Chromosome 4 SCAF14533, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 4
           SCAF14533, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 999

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF- 458
           IFG  L+++V   R   +   P++V   +D+++  GL+ + ++R        ++L+  F 
Sbjct: 321 IFGQKLEETVRYERRFGNKPAPMLVEQCVDFIRQWGLREEGLFRLPGQANLVKELQDAFD 380

Query: 459 TDRGPTFPYHWDV 497
               P+F  + DV
Sbjct: 381 CGEKPSFDCNTDV 393


>UniRef50_Q4SLV2 Cluster: Chromosome 13 SCAF14555, whole genome
            shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 13
            SCAF14555, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 2051

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 2/57 (3%)
 Frame = +3

Query: 300  QQSVERSRC-HDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK-LFTD 464
            Q  VE SR   ++  +P +V   I+Y++ HGL ++ IYR      K ++LR+ L TD
Sbjct: 1665 QFGVELSRLTSEERQVPQLVEKLINYIEMHGLYTEGIYRKSGSANKIKELRQGLDTD 1721


>UniRef50_Q9V4C2 Cluster: CG1748-PA; n=3; Endopterygota|Rep:
           CG1748-PA - Drosophila melanogaster (Fruit fly)
          Length = 202

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           +P+ V + IDYL+ +GL+   ++R    K + +QLR+ F
Sbjct: 2   VPIFVNNCIDYLEDNGLQQVGLFRVSTSKKRVKQLREEF 40


>UniRef50_UPI0000F1D424 Cluster: PREDICTED: similar to hCG2019858,;
           n=1; Danio rerio|Rep: PREDICTED: similar to hCG2019858,
           - Danio rerio
          Length = 536

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           A+LK FI ELP  +LT E    F     IA+ +++  M NL++
Sbjct: 367 ALLKKFIRELPAPLLTAEHLNTFSAVRDIADLKQKLHMLNLLV 409


>UniRef50_UPI00004D875D Cluster: Rho GTPase activating protein 2;
           n=1; Xenopus tropicalis|Rep: Rho GTPase activating
           protein 2 - Xenopus tropicalis
          Length = 451

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FG  L+ +V     H     PLVV   +D+++ +GL+ + ++R        ++L+  F 
Sbjct: 27  VFGQRLEDAVSLETRH----APLVVEQCVDFIRENGLQEEGLFRLPGQATLVKELQDTFD 82

Query: 462 DRG-PTF 479
             G PTF
Sbjct: 83  SGGKPTF 89


>UniRef50_UPI0000611472 Cluster: UPI0000611472 related cluster; n=1;
           Gallus gallus|Rep: UPI0000611472 UniRef100 entry -
           Gallus gallus
          Length = 200

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = +3

Query: 285 FGVPLQQ-SVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           FGVPL+  + + ++C    G+P +V   ++YL+  GL+   I+R      K ++L++ +
Sbjct: 38  FGVPLEALTKDATQC----GVPFLVTQLVEYLEVFGLRRVGIFRISGSVSKIKELKQKY 92


>UniRef50_Q01Q65 Cluster: Cna B-type protein precursor; n=1;
           Solibacter usitatus Ellin6076|Rep: Cna B-type protein
           precursor - Solibacter usitatus (strain Ellin6076)
          Length = 1123

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 3/66 (4%)
 Frame = +2

Query: 500 CRLA---MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLIISCRTVTTSAGL 670
           CR+A   ++   +S LP  +   ++ G+   AT    P    TMTNL       TT+   
Sbjct: 6   CRIAGVVLVWGTLSSLPAQVFNAQVTGEVTDATGALVPNARLTMTNLATKTVVTTTTTDA 65

Query: 671 ADETFP 688
               FP
Sbjct: 66  GVYRFP 71


>UniRef50_Q9VFK2 Cluster: CG31319-PA; n=6; Endopterygota|Rep:
           CG31319-PA - Drosophila melanogaster (Fruit fly)
          Length = 1017

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK 452
           +FGVPL   ++RS       LPL VR +  +LQ + L    I+R    K +  +LR+
Sbjct: 562 VFGVPLLMILQRS----GQTLPLAVRAAFRWLQLNALDQVGIFRKSGGKSRIMKLRE 614


>UniRef50_A7RKY9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 754

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 21/62 (33%), Positives = 33/62 (53%)
 Frame = +3

Query: 285 FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTD 464
           FGVPL++ V +SR  D + +P V+   + YL   GLK + I+R   +    + L+  F  
Sbjct: 103 FGVPLEE-VTKSR--DGSPIPWVLAKIVHYLSQCGLKHEGIFRVSGNHKVVESLKATFDR 159

Query: 465 RG 470
            G
Sbjct: 160 DG 161


>UniRef50_Q7SF96 Cluster: Putative uncharacterized protein
           NCU00553.1; n=2; Sordariomycetes|Rep: Putative
           uncharacterized protein NCU00553.1 - Neurospora crassa
          Length = 742

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 1/65 (1%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           P+FGV L +  ER    D   +P+VV   I  +   GL  + IYR         +L+ LF
Sbjct: 541 PVFGVSLSKLYER----DGLAVPMVVYQCIQAVDLFGLGLEGIYRLSGSVPHVNKLKTLF 596

Query: 459 -TDRG 470
            TD G
Sbjct: 597 DTDSG 601


>UniRef50_A7EGQ4 Cluster: Putative uncharacterized protein; n=1;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1497

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 14/43 (32%), Positives = 27/43 (62%)
 Frame = +2

Query: 509  AMLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
            ++LK ++ ELP +ILT+ELH +F   T + +   + +  N ++
Sbjct: 1269 SLLKLYLRELPTTILTRELHLEFLAVTELHDMNEKVSALNGLV 1311


>UniRef50_UPI0000E46DB5 Cluster: PREDICTED: similar to SLIT-ROBO Rho
           GTPase activating protein 1; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to SLIT-ROBO Rho
           GTPase activating protein 1 - Strongylocentrotus
           purpuratus
          Length = 885

 Score = 33.1 bits (72), Expect = 6.5
 Identities = 17/63 (26%), Positives = 30/63 (47%)
 Frame = +3

Query: 270 VALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLR 449
           V +P+FG  LQ  +E         +P +V   ID++   GLK   I+R     ++   ++
Sbjct: 475 VYMPLFGADLQSYLESGHYE----IPPIVLSCIDFISVFGLKHHGIFRLPGSHLEINDMK 530

Query: 450 KLF 458
           + F
Sbjct: 531 EQF 533


>UniRef50_Q6FP34 Cluster: Candida glabrata strain CBS138 chromosome J
            complete sequence; n=1; Candida glabrata|Rep: Candida
            glabrata strain CBS138 chromosome J complete sequence -
            Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 1105

 Score = 33.1 bits (72), Expect = 6.5
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)
 Frame = +3

Query: 282  IFGVPLQQSVERS--RCHDDTGLPLVVRDSIDYL-QAHGLKSKDIYRTEPDKIKFQQLRK 452
            +FG PLQ+S++ S         LP +V   ++YL + HG++ + I+R        +QL++
Sbjct: 879  VFGAPLQKSMQLSSKTYQRQYHLPSIVYRCLEYLYKNHGIQEEGIFRLSGSSTLIKQLQE 938

Query: 453  LF 458
             F
Sbjct: 939  KF 940


>UniRef50_A6RIY7 Cluster: Putative uncharacterized protein; n=1;
            Botryotinia fuckeliana B05.10|Rep: Putative
            uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 1493

 Score = 33.1 bits (72), Expect = 6.5
 Identities = 14/43 (32%), Positives = 27/43 (62%)
 Frame = +2

Query: 509  AMLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
            ++LK ++ ELP +ILT+ELH +F   T + +   + +  N ++
Sbjct: 1265 SLLKLYLRELPTTILTRELHLEFIAVTELHDVNEKISALNGLV 1307


>UniRef50_A5DX85 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 743

 Score = 33.1 bits (72), Expect = 6.5
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKL 455
           P FGV +++ +  +   +   +PLVVR  I+ ++ +G+    IYRT  +   F Q++KL
Sbjct: 540 PTFGVSIEEVITFAGVDN---VPLVVRKCIEVIETYGIDLVGIYRTSSN---FNQVKKL 592


>UniRef50_UPI00015B50B9 Cluster: PREDICTED: similar to Rho GTPase
           activating protein 6; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to Rho GTPase activating protein 6 -
           Nasonia vitripennis
          Length = 1467

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK 452
           +P VVR  I +L+  GL +  I+R  P K + +QLR+
Sbjct: 792 VPSVVRQCIRHLETTGLHTLGIFRVSPSKKRVRQLRE 828


>UniRef50_UPI0000F210C3 Cluster: PREDICTED: hypothetical protein;
           n=2; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 269

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 17/64 (26%), Positives = 35/64 (54%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           P+FGV LQ+     +     G+P V+   +++L+ +GL  ++++     + + + LR+  
Sbjct: 33  PVFGVCLQRLRNAGQMRQ--GVPAVLMQMVEFLEQYGLHQRELFCVSGSEAEREALRQRL 90

Query: 459 TDRG 470
            DRG
Sbjct: 91  -DRG 93


>UniRef50_A1KXK7 Cluster: Rho GTPase activating protein N/AflII-2;
           n=1; Gallus gallus|Rep: Rho GTPase activating protein
           N/AflII-2 - Gallus gallus (Chicken)
          Length = 992

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = +2

Query: 482 VSLGRSCRLA-MLKAFISELPESILTQELHGQFEQATAIAEPQREATM-TNLIISCRTVT 655
           +S    C +A +LK F  ELPE IL   L     +A  +A  ++ ATM  + +++ RT+ 
Sbjct: 108 LSAALPCDVAGLLKQFFRELPEPILPSHLQDGLLKAQQLANGKKAATMLLSCLMTDRTIE 167

Query: 656 T 658
           T
Sbjct: 168 T 168


>UniRef50_Q7D6H9 Cluster: Putative uncharacterized protein; n=9;
           Mycobacterium tuberculosis complex|Rep: Putative
           uncharacterized protein - Mycobacterium tuberculosis
          Length = 315

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = -1

Query: 379 CK*SMLSRTTSGRPVSSWQRERSTDCCSGTPNIGSATPNVKILQKEH-QMSPLTVFSS 209
           C    L R  SGRP S+WQR        G P  G A     +L K H ++ P+T F++
Sbjct: 231 CSDERLERLLSGRPTSAWQRASYLLDSGGEPARGQA-----LLAKRHTEVMPVTRFTT 283


>UniRef50_Q7Z6I6 Cluster: Rho GTPase-activating protein 30; n=25;
           Theria|Rep: Rho GTPase-activating protein 30 - Homo
           sapiens (Human)
          Length = 1101

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +2

Query: 500 CRLAMLKAFISELPESILTQELHGQFEQATAI-AEPQR 610
           C  ++ KA+  ELP+ +LT  L+ +F +A  +  EP+R
Sbjct: 89  CVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEPER 126


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 525,926,339
Number of Sequences: 1657284
Number of extensions: 10274966
Number of successful extensions: 29819
Number of sequences better than 10.0: 79
Number of HSP's better than 10.0 without gapping: 28961
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29809
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 53719013270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -