SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20017
         (763 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5D417 Cluster: N-terminal domain of molybdenum-binding...    33   5.8  

>UniRef50_A5D417 Cluster: N-terminal domain of molybdenum-binding
           protein; n=1; Pelotomaculum thermopropionicum SI|Rep:
           N-terminal domain of molybdenum-binding protein -
           Pelotomaculum thermopropionicum SI
          Length = 110

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +1

Query: 310 RYLIQIIKQHNSR-YSDAPY--FIRIESRTIDGSRSKG*YVINARFHNAWRILAASKDRA 480
           R + +I   +N + + D PY   +R+E RT  GS SK    I   ++ AWR++ A +DR 
Sbjct: 2   RLVCKIWLDNNGKAFGDGPYDLLLRVE-RT--GSLSKAAAEIGMSYNKAWRLIRAMEDRL 58

Query: 481 RHILLCVPAGPAN 519
              LL   AG A+
Sbjct: 59  GFPLLESKAGGAS 71


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 684,319,661
Number of Sequences: 1657284
Number of extensions: 12777983
Number of successful extensions: 24167
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 23618
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24165
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63381147830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -