SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20009
         (710 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P25007 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   164   2e-39
UniRef50_P30405 Cluster: Peptidyl-prolyl cis-trans isomerase, mi...   162   7e-39
UniRef50_P29117 Cluster: Peptidyl-prolyl cis-trans isomerase, mi...   161   2e-38
UniRef50_P52011 Cluster: Peptidyl-prolyl cis-trans isomerase 3; ...   160   3e-38
UniRef50_Q4RNX9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   160   4e-38
UniRef50_Q9UNP9 Cluster: Peptidyl-prolyl cis-trans isomerase E; ...   159   5e-38
UniRef50_Q8LDP4 Cluster: Peptidyl-prolyl cis-trans isomerase CYP...   158   1e-37
UniRef50_P52015 Cluster: Peptidyl-prolyl cis-trans isomerase 7; ...   157   3e-37
UniRef50_A4S478 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   156   4e-37
UniRef50_Q38867 Cluster: Peptidyl-prolyl cis-trans isomerase CYP...   156   4e-37
UniRef50_Q38900 Cluster: Peptidyl-prolyl cis-trans isomerase CYP...   156   6e-37
UniRef50_Q5KEB7 Cluster: Peptidyl-prolyl cis-trans isomerase B p...   153   5e-36
UniRef50_A6RNY3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   151   1e-35
UniRef50_P34791 Cluster: Peptidyl-prolyl cis-trans isomerase CYP...   151   2e-35
UniRef50_P23284 Cluster: Peptidyl-prolyl cis-trans isomerase B p...   150   3e-35
UniRef50_Q9LY53 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   150   4e-35
UniRef50_P10255 Cluster: Peptidyl-prolyl cis-trans isomerase, mi...   147   3e-34
UniRef50_A7TFR2 Cluster: Putative uncharacterized protein; n=1; ...   146   4e-34
UniRef50_A4RGX7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   144   1e-33
UniRef50_P73789 Cluster: Peptidyl-prolyl cis-trans isomerase slr...   143   4e-33
UniRef50_UPI00015B6411 Cluster: PREDICTED: similar to CG2852-PA;...   140   4e-32
UniRef50_A6R4C7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   140   4e-32
UniRef50_Q00Y46 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   137   2e-31
UniRef50_UPI0000D9D32B Cluster: PREDICTED: similar to peptidylpr...   137   3e-31
UniRef50_A0D290 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   136   4e-31
UniRef50_Q11004 Cluster: 40 kDa peptidyl-prolyl cis-trans isomer...   136   5e-31
UniRef50_Q4T3X3 Cluster: Chromosome 2 SCAF9897, whole genome sho...   135   9e-31
UniRef50_A2AX39 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   135   9e-31
UniRef50_Q4QBH1 Cluster: Cyclophilin, putative; n=12; Eukaryota|...   135   1e-30
UniRef50_P35176 Cluster: Peptidyl-prolyl cis-trans isomerase D p...   135   1e-30
UniRef50_UPI00005A1484 Cluster: PREDICTED: similar to peptidylpr...   134   2e-30
UniRef50_Q06118 Cluster: Peptidyl-prolyl cis-trans isomerase A; ...   134   2e-30
UniRef50_Q08752 Cluster: 40 kDa peptidyl-prolyl cis-trans isomer...   134   3e-30
UniRef50_A7AQ12 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...   132   6e-30
UniRef50_Q5KHA0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   132   6e-30
UniRef50_UPI0000D575B9 Cluster: PREDICTED: similar to CG1866-PA,...   132   1e-29
UniRef50_A4HIW9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   131   2e-29
UniRef50_P0C1I8 Cluster: Peptidyl-prolyl cis-trans isomerase cyp...   131   2e-29
UniRef50_Q4Q424 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   130   3e-29
UniRef50_P45877 Cluster: Peptidyl-prolyl cis-trans isomerase C; ...   130   3e-29
UniRef50_P52018 Cluster: Peptidyl-prolyl cis-trans isomerase 11;...   130   4e-29
UniRef50_A7PUI4 Cluster: Chromosome chr7 scaffold_31, whole geno...   129   8e-29
UniRef50_Q4N689 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   129   8e-29
UniRef50_Q9ERU9 Cluster: E3 SUMO-protein ligase RanBP2; n=5; Mur...   129   8e-29
UniRef50_P49792 Cluster: E3 SUMO-protein ligase RanBP2; n=98; Eu...   128   1e-28
UniRef50_UPI0000D9E199 Cluster: PREDICTED: similar to peptidylpr...   128   2e-28
UniRef50_A2YAQ0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   128   2e-28
UniRef50_Q4P0V4 Cluster: Peptidyl-prolyl cis-trans isomerase D; ...   128   2e-28
UniRef50_Q9C566 Cluster: Peptidyl-prolyl cis-trans isomerase CYP...   127   2e-28
UniRef50_Q5KA96 Cluster: Peptidyl-prolyl cis-trans isomerase H; ...   125   9e-28
UniRef50_UPI0000E4607F Cluster: PREDICTED: similar to peptidylpr...   125   1e-27
UniRef50_Q54WQ9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   125   1e-27
UniRef50_Q23U86 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...   124   2e-27
UniRef50_Q1KL26 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   124   2e-27
UniRef50_Q4N3T7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   124   3e-27
UniRef50_P53691 Cluster: Peptidyl-prolyl cis-trans isomerase CPR...   124   3e-27
UniRef50_Q13427 Cluster: Peptidyl-prolyl cis-trans isomerase G; ...   123   5e-27
UniRef50_P52016 Cluster: Peptidyl-prolyl cis-trans isomerase 8; ...   123   5e-27
UniRef50_UPI0000F1EBFC Cluster: PREDICTED: hypothetical protein;...   122   1e-26
UniRef50_Q7PQY3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   122   1e-26
UniRef50_O43447 Cluster: Peptidyl-prolyl cis-trans isomerase H; ...   120   5e-26
UniRef50_UPI000051A399 Cluster: PREDICTED: similar to Peptidyl-p...   119   8e-26
UniRef50_Q45UE8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   118   1e-25
UniRef50_Q27450 Cluster: Peptidyl-prolyl cis-trans isomerase 1; ...   118   1e-25
UniRef50_Q014U0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   118   1e-25
UniRef50_P30414 Cluster: NK-tumor recognition protein; n=55; Euk...   118   2e-25
UniRef50_A7RA48 Cluster: Cyclophilin; n=4; Stichotrichida|Rep: C...   117   2e-25
UniRef50_A0BG75 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   116   4e-25
UniRef50_Q6V7K6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   116   6e-25
UniRef50_UPI00003C1FBD Cluster: hypothetical protein UM04137.1; ...   115   1e-24
UniRef50_Q5C1X2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   115   1e-24
UniRef50_UPI0000DA2DF2 Cluster: PREDICTED: similar to Peptidyl-p...   114   2e-24
UniRef50_Q94611 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   114   2e-24
UniRef50_Q4RPL0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   113   3e-24
UniRef50_Q9W0Q2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   113   3e-24
UniRef50_Q5CKI0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   113   4e-24
UniRef50_Q4UI04 Cluster: Cyclophilin peptidyl-prolyl cis-trans i...   113   5e-24
UniRef50_Q27716 Cluster: Cyclophilin precursor; n=10; Eukaryota|...   113   5e-24
UniRef50_O49605 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   112   7e-24
UniRef50_A5AK94 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   107   8e-24
UniRef50_Q23QY9 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...   111   2e-23
UniRef50_P87051 Cluster: Peptidyl-prolyl cis-trans isomerase ppi...   110   4e-23
UniRef50_A3A4B4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   109   5e-23
UniRef50_UPI0000D9E752 Cluster: PREDICTED: similar to peptidylpr...   109   9e-23
UniRef50_Q01FP9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   108   1e-22
UniRef50_Q23GA6 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...   108   1e-22
UniRef50_Q010G5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   108   2e-22
UniRef50_Q5A2Z0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   108   2e-22
UniRef50_UPI0000D55F9D Cluster: PREDICTED: similar to peptidylpr...   107   2e-22
UniRef50_Q09637 Cluster: Peptidyl-prolyl cis-trans isomerase 9; ...   107   2e-22
UniRef50_P0C1I9 Cluster: Peptidyl-prolyl cis-trans isomerase cyp...   107   2e-22
UniRef50_O66105 Cluster: Probable peptidyl-prolyl cis-trans isom...   107   3e-22
UniRef50_Q8W4D0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   107   4e-22
UniRef50_A5DJZ6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   107   4e-22
UniRef50_P0C1I3 Cluster: Peptidyl-prolyl cis-trans isomerase H; ...   107   4e-22
UniRef50_P15425 Cluster: Peptidyl-prolyl cis-trans isomerase, rh...   107   4e-22
UniRef50_Q6MRB4 Cluster: Peptidyl-prolyl cis-trans isomerase pre...   106   5e-22
UniRef50_A4HE26 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   106   5e-22
UniRef50_Q96BP3 Cluster: Peptidylprolyl isomerase domain and WD ...   106   5e-22
UniRef50_A0BD35 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   106   6e-22
UniRef50_Q9Y3C6 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...   106   6e-22
UniRef50_A5BS03 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   105   1e-21
UniRef50_Q6CGQ3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   105   1e-21
UniRef50_A5DY13 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   104   2e-21
UniRef50_Q5KKX7 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...   103   3e-21
UniRef50_A7P5P2 Cluster: Chromosome chr4 scaffold_6, whole genom...   103   6e-21
UniRef50_Q7Q137 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   103   6e-21
UniRef50_Q7RHT4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   102   1e-20
UniRef50_UPI000065E7F5 Cluster: Peptidyl-prolyl cis-trans isomer...   101   2e-20
UniRef50_Q6CBT5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   101   2e-20
UniRef50_Q7M8J1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...   100   3e-20
UniRef50_UPI00005A1932 Cluster: PREDICTED: similar to peptidylpr...   100   4e-20
UniRef50_Q6BSZ1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    99   5e-20
UniRef50_Q8IXY8 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...   100   7e-20
UniRef50_Q6BUC1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    99   1e-19
UniRef50_UPI0000DA3F53 Cluster: PREDICTED: similar to peptidylpr...    98   2e-19
UniRef50_UPI0000447DE0 Cluster: PREDICTED: similar to novel cycl...    98   2e-19
UniRef50_Q7QKK5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    98   2e-19
UniRef50_A3LNY3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    98   2e-19
UniRef50_A3GI64 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    97   4e-19
UniRef50_Q0UY21 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    97   5e-19
UniRef50_P0C1J1 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...    97   5e-19
UniRef50_A7S5B9 Cluster: Predicted protein; n=1; Nematostella ve...    96   9e-19
UniRef50_O74942 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    96   9e-19
UniRef50_Q8SQZ8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    95   1e-18
UniRef50_Q6CU04 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    95   1e-18
UniRef50_A1AVY1 Cluster: Peptidylprolyl isomerase precursor; n=1...    95   2e-18
UniRef50_Q9NJS4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    95   2e-18
UniRef50_A0DTP4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    95   2e-18
UniRef50_Q4N6R7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    94   3e-18
UniRef50_Q9U1Q3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    94   4e-18
UniRef50_UPI0001552A97 Cluster: PREDICTED: similar to Peptidylpr...    93   5e-18
UniRef50_A6SGG7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    93   5e-18
UniRef50_A2Y8V7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    93   6e-18
UniRef50_Q23AP4 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    93   6e-18
UniRef50_A7D6E7 Cluster: Peptidylprolyl isomerase; n=1; Halorubr...    93   6e-18
UniRef50_Q4IBK5 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...    93   6e-18
UniRef50_UPI00015B61FF Cluster: PREDICTED: similar to CG8336-PC;...    93   8e-18
UniRef50_UPI000038C9B9 Cluster: COG0652: Peptidyl-prolyl cis-tra...    92   1e-17
UniRef50_Q8I621 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    92   1e-17
UniRef50_Q55F01 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    92   1e-17
UniRef50_A0DHQ7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    92   1e-17
UniRef50_Q38FI6 Cluster: Cyclophilin type peptidyl-prolyl cis-tr...    91   2e-17
UniRef50_Q55JJ2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    91   2e-17
UniRef50_A4RTS6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    91   3e-17
UniRef50_A3U9L4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    90   4e-17
UniRef50_Q5ALM7 Cluster: Putative uncharacterized protein; n=1; ...    90   4e-17
UniRef50_Q5KAW8 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...    90   4e-17
UniRef50_Q8BUY4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    89   8e-17
UniRef50_Q26DW5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    89   8e-17
UniRef50_A7AVW0 Cluster: Peptidyl-prolyl isomerase; n=1; Babesia...    89   8e-17
UniRef50_Q9H2H8 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...    89   8e-17
UniRef50_P52017 Cluster: Peptidyl-prolyl cis-trans isomerase 10;...    89   8e-17
UniRef50_A7BSP0 Cluster: Peptidylprolyl isomerase domain and WD ...    89   1e-16
UniRef50_A4ASR7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    89   1e-16
UniRef50_A6G1Z4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    89   1e-16
UniRef50_Q13356 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...    88   2e-16
UniRef50_Q4AGQ3 Cluster: Peptidylprolyl isomerase precursor; n=1...    88   2e-16
UniRef50_A5DNZ6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    88   2e-16
UniRef50_Q5UXK8 Cluster: Peptidyl-prolyl cis-trans isomerase slr...    88   2e-16
UniRef50_Q9RXR9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    87   3e-16
UniRef50_Q5WV81 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    87   3e-16
UniRef50_A3J1I4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    87   4e-16
UniRef50_UPI0000F346D2 Cluster: UPI0000F346D2 related cluster; n...    87   5e-16
UniRef50_Q2L6V8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    87   5e-16
UniRef50_A7AUF8 Cluster: Peptidyl-prolyl cis-trans isomerase 4; ...    86   7e-16
UniRef50_Q012P6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    86   9e-16
UniRef50_UPI0000E462A1 Cluster: PREDICTED: similar to LOC495937 ...    85   1e-15
UniRef50_Q9VT21 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    85   1e-15
UniRef50_UPI0000D55828 Cluster: PREDICTED: similar to Peptidyl-p...    85   2e-15
UniRef50_Q8KRN2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    85   2e-15
UniRef50_Q6C7K2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    85   2e-15
UniRef50_A2Z3I5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    84   3e-15
UniRef50_Q1VV59 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    84   4e-15
UniRef50_Q09928 Cluster: Peptidyl-prolyl cis-trans isomerase cyp...    84   4e-15
UniRef50_Q6E7C4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    83   5e-15
UniRef50_A4RXD7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    83   7e-15
UniRef50_A4H346 Cluster: Cyclophilin type peptidyl-prolyl cis-tr...    83   7e-15
UniRef50_UPI0000EBC5E4 Cluster: PREDICTED: similar to peptidyl-P...    83   9e-15
UniRef50_A2YY42 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    83   9e-15
UniRef50_Q5CKV3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    83   9e-15
UniRef50_Q7RXA6 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...    83   9e-15
UniRef50_Q7ZWA6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    82   1e-14
UniRef50_A3ERA5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    82   1e-14
UniRef50_Q4P555 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...    82   1e-14
UniRef50_UPI0000DBEFB8 Cluster: similar to peptidylprolyl isomer...    81   2e-14
UniRef50_Q019H4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    81   3e-14
UniRef50_A3E4E6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    81   3e-14
UniRef50_Q4DJN9 Cluster: Putative uncharacterized protein; n=2; ...    81   3e-14
UniRef50_P77949 Cluster: Peptidyl-prolyl cis-trans isomerase B; ...    81   3e-14
UniRef50_Q9LIK6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    80   6e-14
UniRef50_A6DKQ5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    79   8e-14
UniRef50_A0H3N0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    79   8e-14
UniRef50_A0BH25 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    79   1e-13
UniRef50_Q8C6U1 Cluster: 0 day neonate lung cDNA, RIKEN full-len...    78   2e-13
UniRef50_Q486E3 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    78   2e-13
UniRef50_A7AR76 Cluster: Peptidyl-prolyl cis-trans isomerase, pu...    78   2e-13
UniRef50_UPI00015B5D99 Cluster: PREDICTED: similar to peptidyl-p...    77   3e-13
UniRef50_O82646 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    77   3e-13
UniRef50_A7TG12 Cluster: Putative uncharacterized protein; n=1; ...    77   4e-13
UniRef50_Q7UQJ9 Cluster: Probable cyclophilin type peptidylproly...    76   8e-13
UniRef50_UPI0000D5687A Cluster: PREDICTED: similar to CG10907-PA...    76   1e-12
UniRef50_A3ZZ38 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    75   1e-12
UniRef50_UPI00015B5F55 Cluster: PREDICTED: similar to ENSANGP000...    75   2e-12
UniRef50_UPI000023E0CF Cluster: hypothetical protein FG00940.1; ...    75   2e-12
UniRef50_Q9VTN7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    75   2e-12
UniRef50_UPI00005A4697 Cluster: PREDICTED: similar to peptidylpr...    74   3e-12
UniRef50_Q4N4R0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    74   3e-12
UniRef50_Q7P4Y1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    74   4e-12
UniRef50_Q01C80 Cluster: Chromosome 03 contig 1, DNA sequence; n...    74   4e-12
UniRef50_Q7RKZ9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    74   4e-12
UniRef50_Q4QBK2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    74   4e-12
UniRef50_Q2RZV1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    73   5e-12
UniRef50_Q6L1D0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    73   5e-12
UniRef50_Q8WUA2 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...    73   7e-12
UniRef50_A3XNT1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    73   9e-12
UniRef50_Q6UX04 Cluster: Serologically defined colon cancer anti...    73   9e-12
UniRef50_Q9RT72 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    72   1e-11
UniRef50_UPI00006CAF6D Cluster: peptidyl-prolyl cis-trans isomer...    72   2e-11
UniRef50_Q9XXI7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    72   2e-11
UniRef50_Q1IW71 Cluster: Peptidylprolyl isomerase precursor; n=1...    71   2e-11
UniRef50_Q0SAE5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    71   2e-11
UniRef50_Q9SUV0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    71   2e-11
UniRef50_Q1ING9 Cluster: Peptidylprolyl isomerase precursor; n=4...    71   3e-11
UniRef50_A0JQU3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    71   3e-11
UniRef50_A2DEW6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    71   3e-11
UniRef50_A0DRH4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    71   3e-11
UniRef50_A2WRT5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    71   4e-11
UniRef50_Q4DVC9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    71   4e-11
UniRef50_Q388S5 Cluster: Cyclophilin type peptidyl-prolyl cis-tr...    71   4e-11
UniRef50_Q4QDV4 Cluster: Putative uncharacterized protein; n=3; ...    70   7e-11
UniRef50_A1A249 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    69   9e-11
UniRef50_Q9CDE9 Cluster: Probable peptidyl-prolyl cis-trans isom...    69   1e-10
UniRef50_A7QD90 Cluster: Chromosome undetermined scaffold_80, wh...    69   2e-10
UniRef50_A5BCZ5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    69   2e-10
UniRef50_A2XN96 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    69   2e-10
UniRef50_A7AUH3 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    69   2e-10
UniRef50_Q6FPI7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    68   2e-10
UniRef50_A7EA49 Cluster: Putative uncharacterized protein; n=1; ...    68   2e-10
UniRef50_Q7PYL0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    68   3e-10
UniRef50_Q4Q1A6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    68   3e-10
UniRef50_Q54CU3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    67   3e-10
UniRef50_Q6ZQM2 Cluster: CDNA fis, clone TRACH3016614, moderatel...    66   6e-10
UniRef50_A0BRF8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    66   6e-10
UniRef50_Q4L4W9 Cluster: Putative peptidyl-prolyl cis-trans isom...    66   6e-10
UniRef50_Q4S257 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    66   8e-10
UniRef50_P25334 Cluster: Peptidyl-prolyl cis-trans isomerase CPR...    66   8e-10
UniRef50_Q01DA3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    66   1e-09
UniRef50_Q4N4P2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    66   1e-09
UniRef50_Q75EN4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    66   1e-09
UniRef50_P0C1J2 Cluster: Peptidyl-prolyl isomerase cwc27; n=2; F...    66   1e-09
UniRef50_Q97FH0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    65   1e-09
UniRef50_Q3ZYD0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    65   1e-09
UniRef50_A4C1M0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    65   1e-09
UniRef50_Q4UCL3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    65   1e-09
UniRef50_A0DS98 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    65   1e-09
UniRef50_P35137 Cluster: Peptidyl-prolyl cis-trans isomerase B; ...    65   1e-09
UniRef50_A3IAQ1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    65   2e-09
UniRef50_Q5BS51 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    65   2e-09
UniRef50_A6DL04 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    64   2e-09
UniRef50_Q01GJ5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    64   2e-09
UniRef50_A7I5G8 Cluster: Peptidylprolyl isomerase precursor; n=1...    64   2e-09
UniRef50_Q5KAB3 Cluster: Peptidyl-prolyl isomerase CWC27; n=1; F...    64   2e-09
UniRef50_Q1FEH9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    64   3e-09
UniRef50_Q094T3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    64   4e-09
UniRef50_Q00VG9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    64   4e-09
UniRef50_Q5WK17 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    63   7e-09
UniRef50_Q177R8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    63   7e-09
UniRef50_A0DHN7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    63   7e-09
UniRef50_P47103 Cluster: Peptidyl-prolyl cis-trans isomerase CYP...    63   7e-09
UniRef50_Q4QEP7 Cluster: Cyclophilin, putative; n=3; Leishmania|...    62   1e-08
UniRef50_Q0TYV1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    62   1e-08
UniRef50_Q49W93 Cluster: Putative peptidyl-prolyl cis-trans isom...    62   1e-08
UniRef50_Q4P7H2 Cluster: Peptidyl-prolyl isomerase CWC27; n=1; U...    62   1e-08
UniRef50_A5TVT5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    62   2e-08
UniRef50_A0V2L5 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    61   3e-08
UniRef50_Q9C8M7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    61   3e-08
UniRef50_UPI0000DD8138 Cluster: PREDICTED: similar to peptidylpr...    60   4e-08
UniRef50_UPI0000DB7C4D Cluster: PREDICTED: similar to peptidylpr...    60   4e-08
UniRef50_UPI0000D9DB1B Cluster: PREDICTED: hypothetical protein;...    60   4e-08
UniRef50_Q8F4G4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    60   4e-08
UniRef50_A6G9T2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    60   5e-08
UniRef50_Q67L36 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    60   7e-08
UniRef50_A5UW12 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    60   7e-08
UniRef50_Q00XS5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    60   7e-08
UniRef50_A6NSI3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    59   9e-08
UniRef50_A3M003 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    59   9e-08
UniRef50_Q9XYZ6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    59   1e-07
UniRef50_Q8XK36 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    58   2e-07
UniRef50_Q020M1 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    58   2e-07
UniRef50_Q27YU2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    58   2e-07
UniRef50_Q22XP3 Cluster: Fructose-1,6-bisphosphatase family prot...    58   2e-07
UniRef50_O25982 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    58   2e-07
UniRef50_Q0EZ78 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    58   2e-07
UniRef50_A4A1I7 Cluster: Probable cyclophilin type peptidylproly...    58   2e-07
UniRef50_Q3VQT0 Cluster: Peptidylprolyl isomerase precursor; n=1...    58   3e-07
UniRef50_A2XN93 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    57   4e-07
UniRef50_O42941 Cluster: Peptidylprolyl isomerase cyp7; n=1; Sch...    57   4e-07
UniRef50_Q5ALM5 Cluster: Putative uncharacterized protein; n=1; ...    57   5e-07
UniRef50_Q029I9 Cluster: Peptidylprolyl isomerase precursor; n=1...    56   9e-07
UniRef50_A5ZUU1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    56   9e-07
UniRef50_Q8ILM0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    56   9e-07
UniRef50_UPI0001552C95 Cluster: PREDICTED: hypothetical protein;...    56   1e-06
UniRef50_Q2F611 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    56   1e-06
UniRef50_A6Q2E2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    55   2e-06
UniRef50_Q64DF8 Cluster: FKBP-type peptidyl-prolyl cis-trans iso...    55   2e-06
UniRef50_A3E4C5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    54   3e-06
UniRef50_A6RQU9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    54   3e-06
UniRef50_Q9LIK2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    54   5e-06
UniRef50_Q9BHM3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    54   5e-06
UniRef50_Q5D8I5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    54   5e-06
UniRef50_Q3LDS3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    54   5e-06
UniRef50_Q593S4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    53   6e-06
UniRef50_A6EHM2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    53   6e-06
UniRef50_A6FZ16 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    53   8e-06
UniRef50_A5FXQ7 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    53   8e-06
UniRef50_A5AQ60 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    53   8e-06
UniRef50_A0RYN7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    53   8e-06
UniRef50_Q4Q7V7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    52   1e-05
UniRef50_A1ZMW4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    52   1e-05
UniRef50_A7Q0X2 Cluster: Chromosome chr7 scaffold_42, whole geno...    52   1e-05
UniRef50_A2FJP1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    52   1e-05
UniRef50_A6G2Z6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    52   2e-05
UniRef50_Q6LY63 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    51   3e-05
UniRef50_A7DQG4 Cluster: Peptidylprolyl isomerase precursor; n=1...    50   6e-05
UniRef50_Q9QWD4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    50   7e-05
UniRef50_Q7R6S7 Cluster: GLP_170_10240_10485; n=1; Giardia lambl...    50   7e-05
UniRef50_Q55G43 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    49   1e-04
UniRef50_A0NHY9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    49   1e-04
UniRef50_Q4DQI8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    49   1e-04
UniRef50_O54168 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    48   2e-04
UniRef50_Q7NLZ6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    48   2e-04
UniRef50_O33988 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    48   2e-04
UniRef50_Q5NP83 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    48   3e-04
UniRef50_Q45527 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    48   3e-04
UniRef50_A0YXW9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    48   3e-04
UniRef50_Q8IMS5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    48   3e-04
UniRef50_Q7SBX8 Cluster: Peptidyl-prolyl isomerase cwc-27; n=2; ...    48   3e-04
UniRef50_Q4UIU2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    47   4e-04
UniRef50_Q23JQ1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    47   4e-04
UniRef50_Q97RN2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    47   5e-04
UniRef50_A1GDX8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    47   5e-04
UniRef50_A7PGM7 Cluster: Chromosome chr17 scaffold_16, whole gen...    46   7e-04
UniRef50_A4HN31 Cluster: Peptidyl-prolyl cis-trans isomerase (Cy...    46   7e-04
UniRef50_A4HMJ2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    46   7e-04
UniRef50_Q28R27 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    46   0.001
UniRef50_A6GCZ0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    46   0.001
UniRef50_Q38DM0 Cluster: Cyclophilin type peptidyl-prolyl cis-tr...    46   0.001
UniRef50_Q8YHB4 Cluster: PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A; ...    45   0.002
UniRef50_Q1GR21 Cluster: Peptidylprolyl isomerase precursor; n=2...    45   0.002
UniRef50_Q01V68 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    45   0.002
UniRef50_A2X006 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    45   0.002
UniRef50_Q7RCZ5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    45   0.002
UniRef50_A2E6H3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    45   0.002
UniRef50_Q8BG77 Cluster: Adult male corpora quadrigemina cDNA, R...    45   0.002
UniRef50_Q9CIJ2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    45   0.002
UniRef50_Q6N6L1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    45   0.002
UniRef50_A7HCB4 Cluster: Peptidyl-prolyl cis-trans isomerase cyc...    45   0.002
UniRef50_Q8IAN0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    45   0.002
UniRef50_Q46JS2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    44   0.003
UniRef50_Q2JJV7 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    44   0.003
UniRef50_A4A436 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    44   0.003
UniRef50_Q9KXP0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    44   0.004
UniRef50_A3TP02 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    44   0.004
UniRef50_Q9A7Y7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    44   0.005
UniRef50_Q296G9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    44   0.005
UniRef50_Q0FGL5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    43   0.006
UniRef50_Q9C9C7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    43   0.006
UniRef50_P20753 Cluster: Peptidyl-prolyl cis-trans isomerase A p...    43   0.006
UniRef50_Q2JD84 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    42   0.011
UniRef50_Q1YRT6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    42   0.011
UniRef50_Q9N579 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    42   0.011
UniRef50_UPI0000F1F551 Cluster: PREDICTED: hypothetical protein;...    42   0.015
UniRef50_Q4JVE6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    42   0.015
UniRef50_Q1ZBP3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    42   0.015
UniRef50_O53021 Cluster: Peptidyl-prolyl cis-trans isomerase A p...    42   0.020
UniRef50_Q8FPL3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    41   0.026
UniRef50_Q0KUY2 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    41   0.026
UniRef50_O68612 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    41   0.026
UniRef50_A5CVS3 Cluster: Peptidyl-prolyl cis-trans isomerase B; ...    41   0.026
UniRef50_A2TPS6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    41   0.026
UniRef50_Q4UGD9 Cluster: Peptidyl-prolyl cis-trans isomerase, pu...    41   0.026
UniRef50_A7AWV2 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    41   0.026
UniRef50_A6R5J6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    41   0.026
UniRef50_Q1N5L2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    41   0.035
UniRef50_A7CWK6 Cluster: Peptidylprolyl isomerase precursor; n=2...    41   0.035
UniRef50_A7CWB8 Cluster: Biotin--acetyl-CoA-carboxylase ligase; ...    41   0.035
UniRef50_A2BXL8 Cluster: Cyclophilin-type peptidyl-prolyl cis-tr...    41   0.035
UniRef50_Q48LN3 Cluster: Peptidyl-prolyl cis-trans isomerase A; ...    40   0.046
UniRef50_Q0IBR0 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    40   0.046
UniRef50_Q581X3 Cluster: Cyclophilin type peptidyl-prolyl cis-tr...    40   0.046
UniRef50_Q50639 Cluster: Probable peptidyl-prolyl cis-trans isom...    40   0.046
UniRef50_Q8KBH4 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    40   0.060
UniRef50_Q9EXI3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    40   0.060
UniRef50_Q111D0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    40   0.060
UniRef50_Q57VC6 Cluster: Cyclophilin-type peptidyl-prolyl cis-tr...    40   0.060
UniRef50_Q5BAH7 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...    40   0.060
UniRef50_Q8DMH9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    40   0.080
UniRef50_A4ECF9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    40   0.080
UniRef50_A3S1V4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    40   0.080
UniRef50_A0Z766 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    40   0.080
UniRef50_Q4IPB3 Cluster: Peptidyl-prolyl isomerase CWC27; n=2; S...    40   0.080
UniRef50_A0YDT0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    39   0.11 
UniRef50_A0KZE3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    39   0.11 
UniRef50_P72704 Cluster: Probable peptidyl-prolyl cis-trans isom...    39   0.11 
UniRef50_Q4WE62 Cluster: Peptidyl-prolyl isomerase cwc27; n=7; E...    39   0.11 
UniRef50_A0M035 Cluster: Cyclophilin-type peptidyl-prolyl cis-tr...    39   0.14 
UniRef50_Q4QAK0 Cluster: Peptidyl-prolyl cis-trans isomerase-lik...    39   0.14 
UniRef50_P53728 Cluster: Peptidyl-prolyl cis-trans isomerase CYP...    39   0.14 
UniRef50_Q111D1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    38   0.18 
UniRef50_A3JIZ9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    38   0.18 
UniRef50_UPI0000DB6EFB Cluster: PREDICTED: similar to Moca-cyp C...    38   0.24 
UniRef50_Q7NHC7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    38   0.24 
UniRef50_Q26FJ2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    38   0.24 
UniRef50_A6CF65 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    38   0.24 
UniRef50_Q7RMM4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    38   0.24 
UniRef50_Q4QBG3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    38   0.24 
UniRef50_A6NM32 Cluster: Uncharacterized protein PPIH; n=1; Homo...    38   0.24 
UniRef50_Q94A16 Cluster: Peptidyl-prolyl cis-trans isomerase CYP...    38   0.24 
UniRef50_Q7VB46 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    38   0.32 
UniRef50_Q2IFL3 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    38   0.32 
UniRef50_Q11IH6 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    38   0.32 
UniRef50_A6PTN6 Cluster: Peptidylprolyl isomerase precursor; n=1...    38   0.32 
UniRef50_A4C5K1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    38   0.32 
UniRef50_Q7UP02 Cluster: Putative uncharacterized protein; n=1; ...    37   0.43 
UniRef50_Q6G305 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    37   0.43 
UniRef50_A4BVR5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    37   0.43 
UniRef50_Q016V9 Cluster: Cyclophilin type peptidyl-prolyl cis-tr...    37   0.43 
UniRef50_A5DF72 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    37   0.43 
UniRef50_Q6LT68 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    37   0.56 
UniRef50_Q2JSY6 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    37   0.56 
UniRef50_Q0M4E8 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    37   0.56 
UniRef50_Q0C588 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    37   0.56 
UniRef50_Q0JRB3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    37   0.56 
UniRef50_Q0C924 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    37   0.56 
UniRef50_UPI0001555111 Cluster: PREDICTED: similar to adaptor pr...    36   0.74 
UniRef50_A5V982 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    36   0.74 
UniRef50_A4RWJ8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    36   0.74 
UniRef50_Q57D43 Cluster: Probable peptidyl-prolyl cis-trans isom...    36   0.74 
UniRef50_Q82Y46 Cluster: Cyclophilin-type peptidyl-prolyl cis-tr...    36   0.98 
UniRef50_A0KHC2 Cluster: Peptidyl-prolyl cis-trans isomerase B; ...    36   0.98 
UniRef50_A4HA14 Cluster: Putative uncharacterized protein; n=1; ...    36   0.98 
UniRef50_A6GI88 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    36   1.3  
UniRef50_A3XNC4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    36   1.3  
UniRef50_A0X6A5 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    36   1.3  
UniRef50_O46598 Cluster: Hepatitis A virus cellular receptor 1 l...    36   1.3  
UniRef50_Q5QWT2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    35   1.7  
UniRef50_Q15WP8 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    35   1.7  
UniRef50_Q6H9N9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    35   1.7  
UniRef50_UPI00015055F6 Cluster: unknown protein; n=1; Arabidopsi...    35   2.3  
UniRef50_Q8A165 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    35   2.3  
UniRef50_Q7NKH8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    35   2.3  
UniRef50_Q8VXW1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    35   2.3  
UniRef50_Q55118 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    34   3.0  
UniRef50_Q4FL03 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    34   3.0  
UniRef50_A1UFB9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    34   3.0  
UniRef50_A0KXT7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    34   3.0  
UniRef50_Q4Q1I0 Cluster: Putative uncharacterized protein; n=3; ...    34   3.0  
UniRef50_A7T7P6 Cluster: Predicted protein; n=1; Nematostella ve...    34   3.0  
UniRef50_A7APN0 Cluster: Putative uncharacterized protein; n=1; ...    34   3.0  
UniRef50_Q5UP71 Cluster: Probable peptidyl-prolyl cis-trans isom...    34   3.0  
UniRef50_UPI0000E4A16C Cluster: PREDICTED: similar to dispatched...    34   4.0  
UniRef50_Q4RZL0 Cluster: Chromosome 18 SCAF14786, whole genome s...    34   4.0  
UniRef50_Q9A8L6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    34   4.0  
UniRef50_Q3AR72 Cluster: VCBS; n=1; Chlorobium chlorochromatii C...    34   4.0  
UniRef50_Q0HFE3 Cluster: Peptidyl-prolyl cis-trans isomerase, cy...    34   4.0  
UniRef50_A4U5H8 Cluster: Sensor protein; n=1; Magnetospirillum g...    34   4.0  
UniRef50_A3UCW8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    34   4.0  
UniRef50_A3U8T2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    34   4.0  
UniRef50_A3HYF6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    34   4.0  
UniRef50_A3HC17 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    34   4.0  
UniRef50_A2TTG2 Cluster: Carboxypeptidase T; n=1; Dokdonia dongh...    34   4.0  
UniRef50_A7BL17 Cluster: Peptidylprolyl isomerase; n=1; Beggiato...    33   5.2  
UniRef50_A4CNC6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    33   5.2  
UniRef50_A1S947 Cluster: Peptidyl-prolyl cis-trans isomerase (Ro...    33   5.2  
UniRef50_Q12053 Cluster: Aflatoxin biosynthesis polyketide synth...    33   5.2  
UniRef50_Q9A9K1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    33   6.9  
UniRef50_Q3F1C0 Cluster: Phage protein; n=2; Bacillus cereus gro...    33   6.9  
UniRef50_A0Y509 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    33   6.9  
UniRef50_UPI0000E485EA Cluster: PREDICTED: hypothetical protein,...    33   9.2  
UniRef50_Q1NFI5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    33   9.2  
UniRef50_A6LCB0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    33   9.2  
UniRef50_A5GPX4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=...    33   9.2  

>UniRef50_P25007 Cluster: Peptidyl-prolyl cis-trans isomerase; n=16;
           cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase - Drosophila melanogaster (Fruit fly)
          Length = 227

 Score =  164 bits (398), Expect = 2e-39
 Identities = 74/103 (71%), Positives = 86/103 (83%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FM QGGDFTNHNGTGGKSIYGNKF DENF LKHTG G+LSMANAGA+TN
Sbjct: 112 KGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTN 171

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GSQFFI TVKT+WLD +HVVFG VVEG++VVK+IE+  +  G+
Sbjct: 172 GSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGK 214



 Score =  113 bits (272), Expect = 4e-24
 Identities = 53/67 (79%), Positives = 58/67 (86%), Gaps = 1/67 (1%)
 Frame = +2

Query: 77  KMS-LPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           KMS LPRVFFD+T D+ PLG+IV+ELRSDV PKT ENFRALCTGEKGFGYKGSIFHRVIP
Sbjct: 62  KMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIP 121

Query: 254 ISCCKEG 274
              C+ G
Sbjct: 122 NFMCQGG 128


>UniRef50_P30405 Cluster: Peptidyl-prolyl cis-trans isomerase,
           mitochondrial precursor; n=127; Eukaryota|Rep:
           Peptidyl-prolyl cis-trans isomerase, mitochondrial
           precursor - Homo sapiens (Human)
          Length = 207

 Score =  162 bits (394), Expect = 7e-39
 Identities = 73/103 (70%), Positives = 84/103 (81%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P FM Q GDFTNHNGTGGKSIYG++F DENFTLKH GPGVLSMANAG +TN
Sbjct: 91  KGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTN 150

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GSQFFI T+KT WLDG+HVVFG+V EGM+VVK+IE+  +  GR
Sbjct: 151 GSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGR 193



 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 41/62 (66%), Positives = 49/62 (79%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P V+ DV  +  PLG++V+EL++DV PKT ENFRALCTGEKGFGYKGS FHRVIP   C+
Sbjct: 46  PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQ 105

Query: 269 EG 274
            G
Sbjct: 106 AG 107



 Score = 37.5 bits (83), Expect = 0.32
 Identities = 15/21 (71%), Positives = 19/21 (90%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQIA 572
           FGS SG+TSK+IVI DCGQ++
Sbjct: 187 FGSKSGRTSKKIVITDCGQLS 207


>UniRef50_P29117 Cluster: Peptidyl-prolyl cis-trans isomerase,
           mitochondrial precursor; n=4; Eukaryota|Rep:
           Peptidyl-prolyl cis-trans isomerase, mitochondrial
           precursor - Rattus norvegicus (Rat)
          Length = 206

 Score =  161 bits (390), Expect = 2e-38
 Identities = 72/103 (69%), Positives = 84/103 (81%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P FM Q GDFTNHNGTGGKSIYG++F DENFTLKH GPGVLSMANAG +TN
Sbjct: 90  KGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTN 149

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GSQFFI T+KT WLDG+HVVFG+V EGM+VVK+IE+  +  G+
Sbjct: 150 GSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGK 192



 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 42/62 (67%), Positives = 49/62 (79%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P V+ DV  D  PLG++V+EL++DV PKT ENFRALCTGEKGFGYKGS FHRVIP   C+
Sbjct: 45  PLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQ 104

Query: 269 EG 274
            G
Sbjct: 105 AG 106



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 16/21 (76%), Positives = 19/21 (90%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQIA 572
           FGS SGKTSK+IVI DCGQ++
Sbjct: 186 FGSKSGKTSKKIVITDCGQLS 206


>UniRef50_P52011 Cluster: Peptidyl-prolyl cis-trans isomerase 3;
           n=63; cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase 3 - Caenorhabditis elegans
          Length = 173

 Score =  160 bits (389), Expect = 3e-38
 Identities = 71/112 (63%), Positives = 88/112 (78%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P+FM+QGGDFT  NGTGG+SIYG KF DENF  KHTGPGVLSMANAG 
Sbjct: 53  LHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGP 112

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESL 549
           +TNGSQFF+ TVKT WLDG+HVVFG VVEG++VVK +E+  +  G+P+++ +
Sbjct: 113 NTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKDCM 164



 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 7/65 (10%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIF 238
           MS  +VFFD+T+     G+IV+EL  DV PKT  NFRALCTGE G G       +KGS F
Sbjct: 1   MSRSKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKF 60

Query: 239 HRVIP 253
           HR+IP
Sbjct: 61  HRIIP 65


>UniRef50_Q4RNX9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Tetraodon nigroviridis|Rep: Peptidyl-prolyl cis-trans
           isomerase - Tetraodon nigroviridis (Green puffer)
          Length = 326

 Score =  160 bits (388), Expect = 4e-38
 Identities = 71/104 (68%), Positives = 82/104 (78%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P FM QGGDFTNHNGTGGKSIYG KF+DENF LKHT PG LSMAN+G +TN
Sbjct: 211 KGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGRKFDDENFVLKHTAPGQLSMANSGPNTN 270

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           GSQFFITT KT WLDG+HVVFG +VEGM+V++Q+E      G+P
Sbjct: 271 GSQFFITTDKTDWLDGKHVVFGELVEGMDVLRQMEAQGTKEGKP 314



 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 33/62 (53%), Positives = 44/62 (70%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P+V+ D+ + + P G++   LR+D+ P T ENFR LCT EKGFGYKGS FHR+IP   C+
Sbjct: 166 PQVYMDIKIGNKPAGRLRFLLRADIVPMTAENFRCLCTHEKGFGYKGSSFHRIIPQFMCQ 225

Query: 269 EG 274
            G
Sbjct: 226 GG 227


>UniRef50_Q9UNP9 Cluster: Peptidyl-prolyl cis-trans isomerase E;
           n=390; root|Rep: Peptidyl-prolyl cis-trans isomerase E -
           Homo sapiens (Human)
          Length = 301

 Score =  159 bits (387), Expect = 5e-38
 Identities = 70/104 (67%), Positives = 83/104 (79%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P FM QGGDFTNHNGTGGKSIYG KF+DENF LKHTGPG+LSMAN+G +TN
Sbjct: 185 KGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTN 244

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           GSQFF+T  KT WLDG+HVVFG V EG++V++QIE   +  G+P
Sbjct: 245 GSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKP 288



 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 36/64 (56%), Positives = 46/64 (71%)
 Frame = +2

Query: 83  SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISC 262
           S P+V+ D+ + + P G+I + LRSDV P T ENFR LCT EKGFG+KGS FHR+IP   
Sbjct: 138 SNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFM 197

Query: 263 CKEG 274
           C+ G
Sbjct: 198 CQGG 201


>UniRef50_Q8LDP4 Cluster: Peptidyl-prolyl cis-trans isomerase
           CYP19-4 precursor; n=22; Eukaryota|Rep: Peptidyl-prolyl
           cis-trans isomerase CYP19-4 precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 201

 Score =  158 bits (383), Expect = 1e-37
 Identities = 74/107 (69%), Positives = 82/107 (76%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P FM+QGGDFT+ NG GG+SIYG KF DENF LKHTGPGVLSMAN+G 
Sbjct: 81  LHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGE 140

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           DTNGSQFFITTV TSWLDGRHVVFG VV+GM+VV +IE      G P
Sbjct: 141 DTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIEAEGKQSGTP 187



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 34/61 (55%), Positives = 40/61 (65%), Gaps = 7/61 (11%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHRVI 250
           +V+FDV +D    G++VI L     PKT ENFRALCTGEKG G       YKGS FHR+I
Sbjct: 33  KVYFDVEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRII 92

Query: 251 P 253
           P
Sbjct: 93  P 93


>UniRef50_P52015 Cluster: Peptidyl-prolyl cis-trans isomerase 7;
           n=12; Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase
           7 - Caenorhabditis elegans
          Length = 171

 Score =  157 bits (380), Expect = 3e-37
 Identities = 71/112 (63%), Positives = 85/112 (75%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P FM+QGGDFT  NGTGG+SIYG KF DENF  KHTGPGVLSMANAG 
Sbjct: 53  LHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGP 112

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESL 549
           +TNGSQFF+ TVKT+WLDG+HVVFG VVEG+++V ++E   ++ G P  E L
Sbjct: 113 NTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNGSSSGTPKSECL 164



 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 40/65 (61%), Positives = 48/65 (73%), Gaps = 7/65 (10%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIF 238
           MS PRVFFD+T+   P G+IV+EL +D+ PKT ENFRALCTGEKG G       +KGS F
Sbjct: 1   MSRPRVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKF 60

Query: 239 HRVIP 253
           HR+IP
Sbjct: 61  HRIIP 65


>UniRef50_A4S478 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Ostreococcus|Rep: Peptidyl-prolyl cis-trans isomerase -
           Ostreococcus lucimarinus CCE9901
          Length = 214

 Score =  156 bits (379), Expect = 4e-37
 Identities = 72/100 (72%), Positives = 79/100 (79%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F     +FM+QGGDFTNH+GTGGKSIYG +F DENF LKH GPG LSMANAG DTN
Sbjct: 95  KGSGFHRVIKNFMIQGGDFTNHDGTGGKSIYGARFPDENFKLKHEGPGTLSMANAGPDTN 154

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAAT 522
           GSQFFI TVKTSWLDGRH VFG V+EGM+VV  IE L  T
Sbjct: 155 GSQFFICTVKTSWLDGRHTVFGRVLEGMDVVTAIENLEGT 194



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 34/53 (64%), Positives = 39/53 (73%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +VFFDVT+D  P G+IV+ L     PKT ENF+ L TGE GFGYKGS FHRVI
Sbjct: 51  KVFFDVTIDGEPAGRIVMGLYGKTVPKTAENFKQLATGENGFGYKGSGFHRVI 103


>UniRef50_Q38867 Cluster: Peptidyl-prolyl cis-trans isomerase
           CYP19-3; n=18; Eukaryota|Rep: Peptidyl-prolyl cis-trans
           isomerase CYP19-3 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 176

 Score =  156 bits (379), Expect = 4e-37
 Identities = 71/107 (66%), Positives = 83/107 (77%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P FM QGGDFT  NGTGG+SIYG+KFEDENF LKHTGPG+LSMAN+G 
Sbjct: 53  LHYKGSAFHRIIPGFMCQGGDFTRGNGTGGESIYGSKFEDENFKLKHTGPGILSMANSGP 112

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           +TNGSQFFI T KTSWLDG+HVVFG VV+G  VVK +E + + +G P
Sbjct: 113 NTNGSQFFICTEKTSWLDGKHVVFGKVVDGYNVVKAMEDVGSDMGNP 159



 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 7/72 (9%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIF 238
           M+ P+VFFD+ +     G++V+EL +DVTP+T  NFRALCTGE G G       YKGS F
Sbjct: 1   MANPKVFFDILIGKMKAGRVVMELFADVTPRTANNFRALCTGENGIGKAGKALHYKGSAF 60

Query: 239 HRVIPISCCKEG 274
           HR+IP   C+ G
Sbjct: 61  HRIIPGFMCQGG 72


>UniRef50_Q38900 Cluster: Peptidyl-prolyl cis-trans isomerase
           CYP19-1; n=12; Eukaryota|Rep: Peptidyl-prolyl cis-trans
           isomerase CYP19-1 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 173

 Score =  156 bits (378), Expect = 6e-37
 Identities = 72/106 (67%), Positives = 83/106 (78%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P FM QGGDFT  NGTGG+SIYG+KF+DENF  KHTGPG+LSMANAGA
Sbjct: 54  LHYKGSSFHRVIPKFMCQGGDFTAGNGTGGESIYGSKFKDENFIKKHTGPGILSMANAGA 113

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           +TNGSQFFI T KTSWLDG+HVVFG VVEG+ VV+ IE + +  GR
Sbjct: 114 NTNGSQFFICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGR 159



 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 39/69 (56%), Positives = 48/69 (69%), Gaps = 7/69 (10%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHRV 247
           P+V+FD+TV     G+IV+EL +D TP+T ENFRALCTGE+G G       YKGS FHRV
Sbjct: 5   PKVYFDMTVGGKSAGRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSSFHRV 64

Query: 248 IPISCCKEG 274
           IP   C+ G
Sbjct: 65  IPKFMCQGG 73



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 14/20 (70%), Positives = 17/20 (85%)
 Frame = +3

Query: 513 GSHSGKTSKRIVIKDCGQIA 572
           GS SG+TSK +VI DCGQI+
Sbjct: 154 GSDSGRTSKPVVIADCGQIS 173


>UniRef50_Q5KEB7 Cluster: Peptidyl-prolyl cis-trans isomerase B
           precursor; n=10; Eukaryota|Rep: Peptidyl-prolyl
           cis-trans isomerase B precursor - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 231

 Score =  153 bits (370), Expect = 5e-36
 Identities = 70/102 (68%), Positives = 82/102 (80%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F     +FM+QGGDFT  +GTGGKSIYG+KF DENF LKHTGPGVLSMANAG DTN
Sbjct: 96  EGSSFHRIIKNFMIQGGDFTKGDGTGGKSIYGSKFPDENFKLKHTGPGVLSMANAGRDTN 155

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG 528
           GSQFFI TVKT+WLD RHVVFG+V+EGM+VV  +E +  + G
Sbjct: 156 GSQFFICTVKTAWLDNRHVVFGHVLEGMDVVYAMENVKTSRG 197



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 30/65 (46%), Positives = 40/65 (61%), Gaps = 6/65 (9%)
 Frame = +2

Query: 74  GKMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEK------GFGYKGSI 235
           G +   +V+FD+     PLG+IV+ L     PKT ENFRAL TG+       G+GY+GS 
Sbjct: 40  GPVITNKVYFDIEHGGKPLGRIVMGLYGKTVPKTAENFRALATGKNSDGEDLGYGYEGSS 99

Query: 236 FHRVI 250
           FHR+I
Sbjct: 100 FHRII 104


>UniRef50_A6RNY3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Botryotinia fuckeliana B05.10|Rep: Peptidyl-prolyl
           cis-trans isomerase - Botryotinia fuckeliana B05.10
          Length = 248

 Score =  151 bits (367), Expect = 1e-35
 Identities = 70/103 (67%), Positives = 78/103 (75%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNG 405
           G  F    P FMLQGGDFT  NGTGGKSIYG  F DENF LKHT PG LSMANAG +TNG
Sbjct: 133 GSSFHRIIPQFMLQGGDFTRGNGTGGKSIYGRTFPDENFELKHTKPGQLSMANAGRNTNG 192

Query: 406 SQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           SQFFITT+ T WL+G+HVVFG V+EGM++VK+IE L    G P
Sbjct: 193 SQFFITTIATPWLNGKHVVFGEVIEGMDLVKRIEGLGTRSGTP 235



 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 32/52 (61%), Positives = 39/52 (75%)
 Frame = +2

Query: 98  FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           FFD+TVD AP G+I  +L   +TP+T  NFR LCTG+ GFGY GS FHR+IP
Sbjct: 90  FFDITVDSAPAGRITFKLYDKITPRTARNFRELCTGQHGFGYAGSSFHRIIP 141


>UniRef50_P34791 Cluster: Peptidyl-prolyl cis-trans isomerase
           CYP20-3, chloroplast precursor; n=17; Magnoliophyta|Rep:
           Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplast
           precursor - Arabidopsis thaliana (Mouse-ear cress)
          Length = 260

 Score =  151 bits (365), Expect = 2e-35
 Identities = 68/96 (70%), Positives = 79/96 (82%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGDFT  NGTGG SIYG KFEDENFTLKHTGPG+LSMANAG +TN
Sbjct: 140 KGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTN 199

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIET 510
           GSQFFI TVKTSWLD +HVVFG V+EGM++V+ +E+
Sbjct: 200 GSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLES 235



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 32/53 (60%), Positives = 40/53 (75%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +V+FDV +     G+IV+ L  +V PKT ENFRALCTGEK +GYKGS FHR+I
Sbjct: 96  KVYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKGSSFHRII 148


>UniRef50_P23284 Cluster: Peptidyl-prolyl cis-trans isomerase B
           precursor; n=71; Eukaryota|Rep: Peptidyl-prolyl
           cis-trans isomerase B precursor - Homo sapiens (Human)
          Length = 208

 Score =  150 bits (364), Expect = 3e-35
 Identities = 68/97 (70%), Positives = 82/97 (84%), Gaps = 1/97 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM+QGGDFT  +GTGGKSIYG +F DENF LKH GPG +SMANAG DTNGSQFFITTVKT
Sbjct: 92  FMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKT 151

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIE-TLAATLGRPLRE 543
           +WLDG+HVVFG V+EGMEVV+++E T   +  +PL++
Sbjct: 152 AWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKD 188



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 28/53 (52%), Positives = 37/53 (69%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +V+FD+ + D  +G+++  L     PKT +NF AL TGEKGFGYK S FHRVI
Sbjct: 37  KVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVI 89


>UniRef50_Q9LY53 Cluster: Peptidyl-prolyl cis-trans isomerase; n=9;
           Magnoliophyta|Rep: Peptidyl-prolyl cis-trans isomerase -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 234

 Score =  150 bits (363), Expect = 4e-35
 Identities = 70/107 (65%), Positives = 80/107 (74%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P FM+QGGDFT  +G GG+SIYG+KF DENF LKHTGPG LSMAN+G 
Sbjct: 114 LYFKGSSFHRIIPGFMIQGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGFLSMANSGP 173

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           D+NGSQFFITTV TSWLDG HVVFG V+ GMEVV++IE      G P
Sbjct: 174 DSNGSQFFITTVTTSWLDGHHVVFGKVLSGMEVVRKIEAQGQDSGVP 220



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 13/67 (19%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCE----NFRAL--CTGEKGFG-------YKGS 232
           +V+FD+ ++ +P G+I+I L  ++ PKT      +F       GEKG G       +KGS
Sbjct: 60  KVYFDIQINGSPAGRILIGLFGNIVPKTAAKRLFSFDVYPPGAGEKGVGNMGKPLYFKGS 119

Query: 233 IFHRVIP 253
            FHR+IP
Sbjct: 120 SFHRIIP 126


>UniRef50_P10255 Cluster: Peptidyl-prolyl cis-trans isomerase,
           mitochondrial precursor; n=12; Pezizomycotina|Rep:
           Peptidyl-prolyl cis-trans isomerase, mitochondrial
           precursor - Neurospora crassa
          Length = 223

 Score =  147 bits (356), Expect = 3e-34
 Identities = 73/116 (62%), Positives = 83/116 (71%), Gaps = 2/116 (1%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P FMLQGGDFT  NGTGGKSIYG KF DENF  KH  PG+LSMANAG +TN
Sbjct: 104 KGSSFHRIIPEFMLQGGDFTRGNGTGGKSIYGEKFADENFAKKHVRPGLLSMANAGPNTN 163

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVV--EGMEVVKQIETLAATLGRPLRESLSKTVV 564
           GSQFF+TTV TSWLDGRHVVFG V   E M+VVK +E   ++ G  +R S   T+V
Sbjct: 164 GSQFFVTTVPTSWLDGRHVVFGEVADDESMKVVKALEATGSSSG-AIRYSKKPTIV 218



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 27/44 (61%), Positives = 31/44 (70%)
 Frame = +2

Query: 122 APLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           A  G+I   L  DV PKT  NF+ LCTG+ GFGYKGS FHR+IP
Sbjct: 70  AQSGRINFTLYDDVVPKTARNFKELCTGQNGFGYKGSSFHRIIP 113


>UniRef50_A7TFR2 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 216

 Score =  147 bits (355), Expect = 4e-34
 Identities = 66/99 (66%), Positives = 81/99 (81%), Gaps = 1/99 (1%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P+FM+QGGDFT+  G GGKSIYG  F+DE+FTLKH  PG LSMAN G +TNGSQFFITTV
Sbjct: 86  PNFMIQGGDFTHGTGVGGKSIYGAVFDDEDFTLKHDRPGRLSMANRGKNTNGSQFFITTV 145

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRE 543
           KT WLDG+HVVFG V+EG++V+ Q+ET+A   + +PL E
Sbjct: 146 KTPWLDGKHVVFGQVIEGLDVLSQLETVATDRMDKPLEE 184



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRAL-CTGEKGFGYKGSIFHRVIP 253
           V+FD+      LG+I+I L   V P+T ENF  L  + +   GY  SIFHR+IP
Sbjct: 33  VYFDIEHGGKELGRIIIGLYDSVAPRTVENFYQLTMSPDPEMGYLDSIFHRIIP 86


>UniRef50_A4RGX7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Magnaporthe grisea|Rep: Peptidyl-prolyl cis-trans
           isomerase - Magnaporthe grisea (Rice blast fungus)
           (Pyricularia grisea)
          Length = 201

 Score =  144 bits (350), Expect = 1e-33
 Identities = 64/83 (77%), Positives = 73/83 (87%)
 Frame = +1

Query: 259 MLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTS 438
           M+QGGDFT H+GTGGKSIYG++F DENF LKHT  GVLSMANAG DTNGSQFFITT  TS
Sbjct: 1   MIQGGDFTKHDGTGGKSIYGDRFPDENFKLKHTKRGVLSMANAGQDTNGSQFFITTATTS 60

Query: 439 WLDGRHVVFGNVVEGMEVVKQIE 507
           WLDGRHVVFG V+EG ++V++IE
Sbjct: 61  WLDGRHVVFGEVLEGYDIVQKIE 83


>UniRef50_P73789 Cluster: Peptidyl-prolyl cis-trans isomerase
           slr1251; n=11; cellular organisms|Rep: Peptidyl-prolyl
           cis-trans isomerase slr1251 - Synechocystis sp. (strain
           PCC 6803)
          Length = 171

 Score =  143 bits (346), Expect = 4e-33
 Identities = 65/106 (61%), Positives = 78/106 (73%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G HF      FM QGGDFT  NGTGG+SIYG KF DENF LKH  PG+LSMANAG 
Sbjct: 52  LHFKGSHFHRVITDFMAQGGDFTRGNGTGGESIYGEKFADENFQLKHDRPGLLSMANAGP 111

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           +TNGSQFF+T V   WLDG+HVVFG VVEG+E+++Q+E   +  G+
Sbjct: 112 NTNGSQFFLTFVPCPWLDGKHVVFGEVVEGLEILEQLEANGSQSGQ 157



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 36/62 (58%), Positives = 44/62 (70%), Gaps = 7/62 (11%)
 Frame = +2

Query: 86  LPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHR 244
           + +VFFD+T+     G+IV+EL  +VTPKT ENFRALCTGEKG G       +KGS FHR
Sbjct: 2   MSKVFFDITIGSDTAGRIVMELFDEVTPKTAENFRALCTGEKGVGKAGKPLHFKGSHFHR 61

Query: 245 VI 250
           VI
Sbjct: 62  VI 63


>UniRef50_UPI00015B6411 Cluster: PREDICTED: similar to CG2852-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG2852-PA - Nasonia vitripennis
          Length = 639

 Score =  140 bits (338), Expect = 4e-32
 Identities = 60/84 (71%), Positives = 73/84 (86%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM+QGGDFT  +GTGG+SIYG++FEDENF L H G G LSMANAG DTNGSQFFITT +T
Sbjct: 519 FMIQGGDFTKGDGTGGRSIYGDRFEDENFKLNHYGAGWLSMANAGKDTNGSQFFITTKQT 578

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIE 507
            WLDGRHVVFG +++GM+VV+++E
Sbjct: 579 PWLDGRHVVFGKIIKGMDVVRKVE 602



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/53 (43%), Positives = 30/53 (56%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +V+FD+ +     G++ I L     PKT +NF  L     G GYKGS FHRVI
Sbjct: 464 KVWFDIEIGGEKAGRVEIGLFGKTVPKTVKNFVELAKKPAGEGYKGSKFHRVI 516


>UniRef50_A6R4C7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Ajellomyces capsulatus NAm1|Rep: Peptidyl-prolyl
           cis-trans isomerase - Ajellomyces capsulatus NAm1
          Length = 243

 Score =  140 bits (338), Expect = 4e-32
 Identities = 70/117 (59%), Positives = 82/117 (70%), Gaps = 12/117 (10%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P FMLQGGDFT  NGTGGKSIYG KF DENF   H GPG+LSMANAG +TNGSQFFITT 
Sbjct: 123 PDFMLQGGDFTRGNGTGGKSIYGEKFADENFKCTHEGPGILSMANAGPNTNGSQFFITTA 182

Query: 430 KTSWLDGRHVVFGNVV------------EGMEVVKQIETLAATLGRPLRESLSKTVV 564
           KTSWLDG+HVVFG VV            + M+VV+ IE+  +T G  ++ S+   +V
Sbjct: 183 KTSWLDGKHVVFGKVVDCPSTRLGPNQKQSMDVVRDIESAGSTSG-AIKTSIKPKIV 238



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 39/63 (61%), Positives = 45/63 (71%), Gaps = 6/63 (9%)
 Frame = +2

Query: 83  SLPRVFFDVTVDD------APLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHR 244
           ++ R FF+V   D      + +G+I  EL SDV PKT ENFRALCTGEKGFGYK SIFHR
Sbjct: 61  AMTRTFFEVEYADPAQPTKSTVGRIEFELFSDVVPKTAENFRALCTGEKGFGYKDSIFHR 120

Query: 245 VIP 253
           VIP
Sbjct: 121 VIP 123


>UniRef50_Q00Y46 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Ostreococcus tauri
          Length = 367

 Score =  137 bits (332), Expect = 2e-31
 Identities = 64/106 (60%), Positives = 78/106 (73%), Gaps = 1/106 (0%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FMLQGGDF   +G GG+SIYG KF DE F + H GPG LSMANAG +TN
Sbjct: 145 EGSIFHRVIPNFMLQGGDFERGDGRGGRSIYGGKFADETFAIPHAGPGTLSMANAGPNTN 204

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPL 537
           GSQFFITT  T WL+G+HVVFG+V+EGM+VV+ IE+     G RP+
Sbjct: 205 GSQFFITTAATPWLNGKHVVFGHVLEGMDVVRAIESNPTARGDRPV 250



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 35/54 (64%), Positives = 42/54 (77%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           RVFFDV + DA  G+IV+ L  D  P+T  NF+AL TGEKG+GY+GSIFHRVIP
Sbjct: 101 RVFFDVDIGDARAGRIVLGLFGDDAPRTVANFKALATGEKGYGYEGSIFHRVIP 154


>UniRef50_UPI0000D9D32B Cluster: PREDICTED: similar to
           peptidylprolyl isomerase A isoform 1; n=1; Macaca
           mulatta|Rep: PREDICTED: similar to peptidylprolyl
           isomerase A isoform 1 - Macaca mulatta
          Length = 312

 Score =  137 bits (331), Expect = 3e-31
 Identities = 59/94 (62%), Positives = 72/94 (76%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P F+ QGGDFTNHNGTGGKS+Y  KF+DEN  +KH GPG+LS ANAG +TN SQF I T 
Sbjct: 205 PGFVCQGGDFTNHNGTGGKSVYREKFDDENSIMKHRGPGILSRANAGPNTNSSQFVICTA 264

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           KT WLDG+HVVFG V EGM++V+ +E   +  G+
Sbjct: 265 KTEWLDGKHVVFGKVKEGMKIVEAMECFGSRNGK 298



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 31/62 (50%), Positives = 38/62 (61%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P +FF++ +D  PL     EL +D      ENF AL TGEKGFGYKGS  HR+IP   C+
Sbjct: 151 PTMFFNIAIDSKPLDCASFELFADEVSMIAENFHALSTGEKGFGYKGSCVHRIIPGFVCQ 210

Query: 269 EG 274
            G
Sbjct: 211 GG 212



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQI 569
           FGS +GKTSK+I   DCGQ+
Sbjct: 292 FGSRNGKTSKKITTADCGQL 311


>UniRef50_A0D290 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Paramecium tetraurelia|Rep: Peptidyl-prolyl cis-trans
           isomerase - Paramecium tetraurelia
          Length = 456

 Score =  136 bits (330), Expect = 4e-31
 Identities = 64/109 (58%), Positives = 77/109 (70%), Gaps = 5/109 (4%)
 Frame = +1

Query: 223 QGLHFPSCHPH-----FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANA 387
           + LH+  C  H     FM+QGGDFT  NGTGG+SIYG KF DENFT KHTG G LSMANA
Sbjct: 334 KNLHYKGCKFHRLIKDFMIQGGDFTQGNGTGGESIYGEKFADENFTHKHTGRGYLSMANA 393

Query: 388 GADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           GA+TNGSQFFI    T WLDG+HVVFG + +G+E++  IE +     +P
Sbjct: 394 GANTNGSQFFILFKDTPWLDGKHVVFGKITKGIELLDVIEKIETEQDKP 442



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 22/34 (64%), Positives = 23/34 (67%), Gaps = 7/34 (20%)
 Frame = +2

Query: 170 KTCENFRALCTGEKGFG-------YKGSIFHRVI 250
           KT ENFRALCTGEKG G       YKG  FHR+I
Sbjct: 314 KTVENFRALCTGEKGVGKSGKNLHYKGCKFHRLI 347


>UniRef50_Q11004 Cluster: 40 kDa peptidyl-prolyl cis-trans
           isomerase; n=3; Dikarya|Rep: 40 kDa peptidyl-prolyl
           cis-trans isomerase - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 356

 Score =  136 bits (329), Expect = 5e-31
 Identities = 65/100 (65%), Positives = 74/100 (74%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F     +FMLQGGDFT  NGTGG+SIYG KFEDENF LKH  P +LSMANAG 
Sbjct: 49  LTYKGSRFHRVIKNFMLQGGDFTRGNGTGGESIYGEKFEDENFELKHDKPFLLSMANAGP 108

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           +TNGSQFFITTV T  LDG+HVVFG V++G   V+ IE L
Sbjct: 109 NTNGSQFFITTVPTPHLDGKHVVFGKVIQGKSTVRTIENL 148



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 4/55 (7%)
 Frame = +2

Query: 98  FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG----YKGSIFHRVI 250
           +F +++D      I  EL  +V PKT +NF +LC G +  G    YKGS FHRVI
Sbjct: 6   YFKISIDGKIQPTIYFELFDNVVPKTVKNFASLCNGFEKDGRCLTYKGSRFHRVI 60


>UniRef50_Q4T3X3 Cluster: Chromosome 2 SCAF9897, whole genome shotgun
            sequence; n=9; Euteleostomi|Rep: Chromosome 2 SCAF9897,
            whole genome shotgun sequence - Tetraodon nigroviridis
            (Green puffer)
          Length = 2990

 Score =  135 bits (327), Expect = 9e-31
 Identities = 60/98 (61%), Positives = 75/98 (76%)
 Frame = +1

Query: 250  PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
            P FM QGGD TN +G+GGKSIYGN+FEDENF ++HTGPG+LSMAN G DTN SQFFIT  
Sbjct: 2884 PDFMCQGGDITNSDGSGGKSIYGNRFEDENFDVRHTGPGILSMANRGQDTNSSQFFITLK 2943

Query: 430  KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRE 543
            K   LD +HV FG V +GM+VV+++E L +  G P ++
Sbjct: 2944 KAEHLDFKHVAFGRVQDGMDVVRKMEELGSKGGTPSKK 2981



 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 41/64 (64%), Positives = 46/64 (71%)
 Frame = +2

Query: 83   SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISC 262
            S PRVF  VT D+ PLG I IEL S + PKT ENFR L TGE+GFG+K SIFHRVIP   
Sbjct: 2828 SNPRVFLKVTADEEPLGLITIELFSHIVPKTAENFRVLSTGERGFGFKNSIFHRVIPDFM 2887

Query: 263  CKEG 274
            C+ G
Sbjct: 2888 CQGG 2891


>UniRef50_A2AX39 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Guillardia theta|Rep: Peptidyl-prolyl cis-trans
           isomerase - Guillardia theta (Cryptomonas phi)
          Length = 347

 Score =  135 bits (327), Expect = 9e-31
 Identities = 61/111 (54%), Positives = 81/111 (72%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P FM+QGGDFT  +GTGG+S+YG +FEDE+F +KH+  G++SMANAGA
Sbjct: 224 LTYKGTKFHRIIPSFMVQGGDFTKGDGTGGESVYGGRFEDESFQIKHSREGLVSMANAGA 283

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRES 546
           D NG+QFFITT   + L+G+HVVFG V+EG E V++IE   +  G+P R S
Sbjct: 284 DCNGAQFFITTASAAHLNGKHVVFGEVLEGYEFVQKIEDCGSNSGKPSRRS 334



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 15/69 (21%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE---------------KGFGYK 226
           + F D+ +D   +G+IVI L     P+T  NFRALCTGE                   YK
Sbjct: 168 KCFLDIQIDGEAVGRIVIGLYGKTCPRTAYNFRALCTGEVQVDPEKHKRTQAANATLTYK 227

Query: 227 GSIFHRVIP 253
           G+ FHR+IP
Sbjct: 228 GTKFHRIIP 236


>UniRef50_Q4QBH1 Cluster: Cyclophilin, putative; n=12;
           Eukaryota|Rep: Cyclophilin, putative - Leishmania major
          Length = 295

 Score =  135 bits (326), Expect = 1e-30
 Identities = 61/97 (62%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLK---HTGPGVLSMANAGADTNGSQFFI 420
           P+FM+QGGDFT  NGTGG+SIYG  F DE+F+ K   HTG G LSMANAG +TNGSQFFI
Sbjct: 85  PNFMIQGGDFTRGNGTGGESIYGTTFRDESFSGKAGRHTGLGCLSMANAGPNTNGSQFFI 144

Query: 421 TTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
            T  T WLDG+HVVFG V++G++VVK++E L ++ G+
Sbjct: 145 CTAATPWLDGKHVVFGRVIDGLDVVKKVERLGSSSGK 181



 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 38/66 (57%), Positives = 48/66 (72%), Gaps = 7/66 (10%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSI 235
           K + P+VFFD+++D+   G+IV+EL +D  PKT ENFRALCTGEKG G       YK S+
Sbjct: 20  KTTNPKVFFDISIDNKAAGRIVMELYADTVPKTAENFRALCTGEKGKGRSGKPLHYKSSV 79

Query: 236 FHRVIP 253
           FHRVIP
Sbjct: 80  FHRVIP 85



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 15/24 (62%), Positives = 18/24 (75%)
 Frame = +3

Query: 513 GSHSGKTSKRIVIKDCGQIA*FKS 584
           GS SGKT  RIV+ DCG++A  KS
Sbjct: 176 GSSSGKTRSRIVVSDCGEVAADKS 199


>UniRef50_P35176 Cluster: Peptidyl-prolyl cis-trans isomerase D
           precursor; n=30; Eukaryota|Rep: Peptidyl-prolyl
           cis-trans isomerase D precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 225

 Score =  135 bits (326), Expect = 1e-30
 Identities = 61/99 (61%), Positives = 77/99 (77%), Gaps = 1/99 (1%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P+FM+QGGDFT+ +G GGKSI+GN F+DENF +KH  PG LSMAN G +TNGSQFFITTV
Sbjct: 89  PNFMIQGGDFTHRSGIGGKSIFGNTFKDENFDVKHDKPGRLSMANRGKNTNGSQFFITTV 148

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRE 543
              WLDG+HVVFG V++GM+VV  IE +   +   P++E
Sbjct: 149 PCPWLDGKHVVFGEVLDGMDVVHYIENVKTDSRNMPVKE 187



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 1/55 (1%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRAL-CTGEKGFGYKGSIFHRVIP 253
           +V+FD+   D  +G+IV+ L    TP+T ENF  L  + +   GY  SIFHRVIP
Sbjct: 35  KVYFDINHGDKQIGRIVMGLYGLTTPQTVENFYQLTISRDPKMGYLNSIFHRVIP 89


>UniRef50_UPI00005A1484 Cluster: PREDICTED: similar to
           peptidylprolyl isomerase A isoform 1; n=1; Canis lupus
           familiaris|Rep: PREDICTED: similar to peptidylprolyl
           isomerase A isoform 1 - Canis familiaris
          Length = 268

 Score =  134 bits (325), Expect = 2e-30
 Identities = 58/84 (69%), Positives = 70/84 (83%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM QGGDFT H+GTGGKSI G KF+DENF L++T PG+LSMAN G +TNGSQFFI T+KT
Sbjct: 164 FMCQGGDFTRHSGTGGKSICGEKFDDENFILRYTRPGILSMANVGPNTNGSQFFICTIKT 223

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIE 507
           +WLDG+HVVF  V EGM +V+ +E
Sbjct: 224 AWLDGKHVVFDKVKEGMNIVEAME 247


>UniRef50_Q06118 Cluster: Peptidyl-prolyl cis-trans isomerase A;
           n=26; cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase A - Streptomyces chrysomallus
          Length = 165

 Score =  134 bits (325), Expect = 2e-30
 Identities = 64/94 (68%), Positives = 74/94 (78%), Gaps = 2/94 (2%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FMLQGGDFT  +GTGGKSIYG KF DENF LKH   G+LSMANAG +TNGSQFFITTV T
Sbjct: 59  FMLQGGDFTRGDGTGGKSIYGEKFADENFQLKHDRVGLLSMANAGKNTNGSQFFITTVLT 118

Query: 436 SWLDGRHVVFGNVV--EGMEVVKQIETLAATLGR 531
            WLDG+HVVFG V   + M +V++IE L ++ GR
Sbjct: 119 PWLDGKHVVFGEVADDDSMALVRKIEALGSSSGR 152



 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 37/53 (69%), Positives = 42/53 (79%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +V+FD+T+DDAP G+I   L  DV PKT ENFRAL TGEKGFGY GS FHRVI
Sbjct: 4   KVYFDITIDDAPAGRITFNLFDDVVPKTAENFRALATGEKGFGYAGSSFHRVI 56


>UniRef50_Q08752 Cluster: 40 kDa peptidyl-prolyl cis-trans
           isomerase; n=40; Eukaryota|Rep: 40 kDa peptidyl-prolyl
           cis-trans isomerase - Homo sapiens (Human)
          Length = 370

 Score =  134 bits (323), Expect = 3e-30
 Identities = 64/109 (58%), Positives = 78/109 (71%), Gaps = 5/109 (4%)
 Frame = +1

Query: 229 LHFPSCHPH-----FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           LHF  C  H     FM+QGGDF+N NGTGG+SIYG KFEDENF  KH   G+LSMANAG 
Sbjct: 66  LHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGR 125

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLR 540
           +TNGSQFFITTV T  LDG+HVVFG V++G+ V + +E +     +P +
Sbjct: 126 NTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAK 174



 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 36/64 (56%), Positives = 44/64 (68%), Gaps = 8/64 (12%)
 Frame = +2

Query: 83  SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIF 238
           S PRVFFDV +    +G+IV+EL +D+ PKT ENFRALCTGEKG G        +KG  F
Sbjct: 14  SNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPF 73

Query: 239 HRVI 250
           HR+I
Sbjct: 74  HRII 77


>UniRef50_A7AQ12 Cluster: Peptidyl-prolyl cis-trans isomerase,
           cyclophilin-type f domain containing protein; n=1;
           Babesia bovis|Rep: Peptidyl-prolyl cis-trans isomerase,
           cyclophilin-type f domain containing protein - Babesia
           bovis
          Length = 195

 Score =  132 bits (320), Expect = 6e-30
 Identities = 58/96 (60%), Positives = 73/96 (76%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FM+QGGD  N NGTG  SIYG +F DENF +KH  PG LSMANAG +TN
Sbjct: 78  KGSVFHRIIPNFMIQGGDIVNGNGTGSVSIYGERFADENFNIKHGAPGALSMANAGPNTN 137

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIET 510
           GSQFFITTV+T WLDGRHVVFG +++G   ++++E+
Sbjct: 138 GSQFFITTVQTPWLDGRHVVFGRLMDGWTTLQEMES 173



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 4/58 (6%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE----KGFGYKGSIFHRVIP 253
           +V  ++  +   +G++++ L  D TPKT  NF ++C G     + + YKGS+FHR+IP
Sbjct: 30  KVTMNIAKNGENIGQLILGLYGDETPKTVANFVSMCEGHSVNGRIYSYKGSVFHRIIP 87


>UniRef50_Q5KHA0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Filobasidiella neoformans|Rep: Peptidyl-prolyl cis-trans
           isomerase - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 196

 Score =  132 bits (320), Expect = 6e-30
 Identities = 61/101 (60%), Positives = 75/101 (74%), Gaps = 1/101 (0%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P FM+Q GDF   +GTGG SIYG KF DENF  KH   G++SMAN GA +NGSQFFITTV
Sbjct: 88  PSFMIQSGDFERQDGTGGVSIYGEKFPDENFEKKHDKVGLVSMANCGAHSNGSQFFITTV 147

Query: 430 -KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESL 549
            K  WLDG+HVVFG VVEGM+VVK++E+     G+P ++ +
Sbjct: 148 EKCEWLDGKHVVFGEVVEGMDVVKEVESKGNKEGKPPKDKI 188



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 8/71 (11%)
 Frame = +2

Query: 86  LPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEK--------GFGYKGSIFH 241
           LP V+  ++++   +GK+VI+L  DV PKTC NFR+LCTG K         F Y+ + FH
Sbjct: 25  LPNVYLKISINGKEVGKVVIKLYDDVVPKTCANFRSLCTGNKPDQTPLPPSFTYRSTPFH 84

Query: 242 RVIPISCCKEG 274
           R+IP    + G
Sbjct: 85  RIIPSFMIQSG 95


>UniRef50_UPI0000D575B9 Cluster: PREDICTED: similar to CG1866-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG1866-PA, isoform A - Tribolium castaneum
          Length = 599

 Score =  132 bits (318), Expect = 1e-29
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 1/118 (0%)
 Frame = +1

Query: 196 VHWRERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLS 375
           V+ ++ L  +G+ F      F++QGGDF+N NGTGG+S+YG  FEDENF LKH  P +LS
Sbjct: 53  VNTKKALHFKGVVFHRVVKDFIIQGGDFSNGNGTGGESVYGGTFEDENFELKHDQPLLLS 112

Query: 376 MANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL-GRPLRES 546
           MAN G DTNGSQFFITT     LD  HVVFG VV G++VV+QIE+L      RPL+++
Sbjct: 113 MANRGKDTNGSQFFITTQPAPHLDNVHVVFGRVVGGVDVVRQIESLPVDANSRPLQDA 170



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 8/61 (13%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHRV 247
           R FFDV++     G+IV EL +D+ PKTCENFR LCTGEKG G        +KG +FHRV
Sbjct: 10  RCFFDVSIGGLQSGRIVFELFTDIVPKTCENFRCLCTGEKGIGVNTKKALHFKGVVFHRV 69

Query: 248 I 250
           +
Sbjct: 70  V 70


>UniRef50_A4HIW9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Trypanosomatidae|Rep: Peptidyl-prolyl cis-trans
           isomerase - Leishmania braziliensis
          Length = 229

 Score =  131 bits (316), Expect = 2e-29
 Identities = 65/115 (56%), Positives = 77/115 (66%), Gaps = 3/115 (2%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLK---HTGPGVLSMAN 384
           L  +G  F    P FMLQGGD T  NGTGG SIYG +F+DE+F  K   H GPG+LSMAN
Sbjct: 103 LTYKGCPFHRIIPDFMLQGGDITKGNGTGGCSIYGARFKDESFNGKAGKHKGPGILSMAN 162

Query: 385 AGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESL 549
           AG +TNGSQFFI TV   WLDG+HVVFG V+ G E VK++E      G+P +  L
Sbjct: 163 AGRNTNGSQFFICTVACPWLDGKHVVFGQVLHGYEHVKKLEAYGTPHGKPSKTVL 217



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/59 (40%), Positives = 30/59 (50%), Gaps = 7/59 (11%)
 Frame = +2

Query: 98  FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG-------FGYKGSIFHRVIP 253
           FF V   + P+G+I +EL  D  P T  +FR LC G            YKG  FHR+IP
Sbjct: 58  FFGVAAHE-PIGRIELELFDDTVPVTARSFRELCRGSSNKSPEGVLLTYKGCPFHRIIP 115


>UniRef50_P0C1I8 Cluster: Peptidyl-prolyl cis-trans isomerase cyp6;
           n=3; Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase
           cyp6 - Rhizopus oryzae (Rhizopus delemar)
          Length = 176

 Score =  131 bits (316), Expect = 2e-29
 Identities = 61/107 (57%), Positives = 74/107 (69%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +  +F    P FM QGGDFT  +G GG+SIYG  F+DENFTLKH G G+LSMANAG 
Sbjct: 56  LHYKNSYFHRIIPGFMAQGGDFTMGDGRGGESIYGRTFKDENFTLKHKGKGLLSMANAGP 115

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           +TNGSQFFIT V T WLDG H VFG +V+G +V+  +E   +  G P
Sbjct: 116 NTNGSQFFITFVDTPWLDGNHTVFGQIVDGSKVLDLLEQHGSRSGMP 162



 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 35/64 (54%), Positives = 43/64 (67%), Gaps = 7/64 (10%)
 Frame = +2

Query: 83  SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFH 241
           +LP+VFFD+ V+    G++  +L SD  PKT ENFRALCTGEKG G       YK S FH
Sbjct: 5   NLPKVFFDIAVNGQHSGRMTFKLFSDTVPKTAENFRALCTGEKGKGISGKPLHYKNSYFH 64

Query: 242 RVIP 253
           R+IP
Sbjct: 65  RIIP 68


>UniRef50_Q4Q424 Cluster: Peptidyl-prolyl cis-trans isomerase; n=6;
           Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Leishmania major
          Length = 220

 Score =  130 bits (314), Expect = 3e-29
 Identities = 62/108 (57%), Positives = 75/108 (69%), Gaps = 3/108 (2%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLK---HTGPGVLSMAN 384
           L  +G  F    P FM QGGDFT  NGTGG+SIYG+KF DE+F  +   H GPG LSMAN
Sbjct: 96  LWFKGSRFHRVIPQFMCQGGDFTAGNGTGGESIYGHKFPDESFAGRAGRHFGPGTLSMAN 155

Query: 385 AGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG 528
           AG +TNGSQFFI T  T WLDG+HVVFG V +G +V+ ++ET  +  G
Sbjct: 156 AGPNTNGSQFFICTAPTDWLDGKHVVFGQVTKGYDVIMKVETQGSQSG 203



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 38/69 (55%), Positives = 46/69 (66%), Gaps = 7/69 (10%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHRV 247
           P VFFD+++   P G++ +EL  DV PKT ENFRALCTGEKG G       +KGS FHRV
Sbjct: 47  PIVFFDISIGSQPAGRVEMELFKDVVPKTAENFRALCTGEKGVGRSGKPLWFKGSRFHRV 106

Query: 248 IPISCCKEG 274
           IP   C+ G
Sbjct: 107 IPQFMCQGG 115


>UniRef50_P45877 Cluster: Peptidyl-prolyl cis-trans isomerase C;
           n=14; Eumetazoa|Rep: Peptidyl-prolyl cis-trans isomerase
           C - Homo sapiens (Human)
          Length = 212

 Score =  130 bits (314), Expect = 3e-29
 Identities = 67/107 (62%), Positives = 75/107 (70%), Gaps = 2/107 (1%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGD T  +GTGG SIYG  F DENF LKH G G +SMANAG DTN
Sbjct: 83  KGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTN 142

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG--RPL 537
           GSQFFIT  K +WLDG+HVVFG V++GM VV  IE L AT G  RPL
Sbjct: 143 GSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIE-LQATDGHDRPL 188



 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 35/53 (66%), Positives = 40/53 (75%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +VFFDV + D  +G+IVI L   V PKT ENF AL TGEKG+GYKGS FHRVI
Sbjct: 39  KVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVI 91


>UniRef50_P52018 Cluster: Peptidyl-prolyl cis-trans isomerase 11;
           n=27; cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase 11 - Caenorhabditis elegans
          Length = 183

 Score =  130 bits (313), Expect = 4e-29
 Identities = 58/86 (67%), Positives = 70/86 (81%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM+QGGDF N +GTG  SIYG+KF DENF LKH GPG+LSMANAG+DTNG QFFIT  KT
Sbjct: 78  FMIQGGDFCNGDGTGLMSIYGSKFRDENFELKHIGPGMLSMANAGSDTNGCQFFITCAKT 137

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIETL 513
            +LD +HVVFG V++GM  V++IE +
Sbjct: 138 DFLDNKHVVFGRVLDGMLTVRKIENV 163



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE---KGF--GYKGSIFHRVI 250
           P VF +VT   AP+G IVIEL +DVTP+T ENFR  CTGE    G   GYK   FHRVI
Sbjct: 17  PIVFLEVTAGGAPIGTIVIELFADVTPRTAENFRQFCTGEYKKDGVPNGYKNCTFHRVI 75


>UniRef50_A7PUI4 Cluster: Chromosome chr7 scaffold_31, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr7 scaffold_31, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 702

 Score =  129 bits (311), Expect = 8e-29
 Identities = 61/109 (55%), Positives = 75/109 (68%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F      FM QGGDF+  NGTGG+SIYG KF DENF   H GPG LSMAN+G 
Sbjct: 57  LHYKGSFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKRAHEGPGFLSMANSGP 116

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLR 540
           +TNGSQFF+T  +   LDG+HVVFG VV+G++ +K+IE L    G+P R
Sbjct: 117 NTNGSQFFMTFKRQPHLDGKHVVFGKVVQGIDTLKKIEQLGTGDGKPAR 165



 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 40/66 (60%), Positives = 45/66 (68%), Gaps = 8/66 (12%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGS 232
           K   P VF DV++D  P+ KIVIEL +DV PKT ENFRALCTGEKG G        YKGS
Sbjct: 3   KKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYKGS 62

Query: 233 IFHRVI 250
            FHR+I
Sbjct: 63  FFHRII 68


>UniRef50_Q4N689 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Theileria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Theileria parva
          Length = 196

 Score =  129 bits (311), Expect = 8e-29
 Identities = 59/103 (57%), Positives = 74/103 (71%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P+FM+QGGD  N NGTG  SIYG  FEDENF  KH   GV++MAN G +TNGSQF+ITTV
Sbjct: 89  PNFMVQGGDIVNRNGTGSISIYGGTFEDENFKAKHK-KGVIAMANRGPNTNGSQFYITTV 147

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESLSKT 558
            TSWLDGRHVVFG ++EG   ++ IE      G+P  +++ K+
Sbjct: 148 ATSWLDGRHVVFGELLEGEYTLQAIEATGTDSGKPSAQTIIKS 190



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTG----EKGFGYKGSIFHRVIP 253
           V  +V  D+     +++ L  ++ PKT  NF ALC G    +K + Y  S FHRVIP
Sbjct: 33  VHLEVQTDEKAPETLIVGLYGNLVPKTVNNFIALCEGTKIEDKHYSYVDSAFHRVIP 89


>UniRef50_Q9ERU9 Cluster: E3 SUMO-protein ligase RanBP2; n=5;
            Murinae|Rep: E3 SUMO-protein ligase RanBP2 - Mus musculus
            (Mouse)
          Length = 3053

 Score =  129 bits (311), Expect = 8e-29
 Identities = 58/93 (62%), Positives = 72/93 (77%)
 Frame = +1

Query: 250  PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
            P F+ QGGD T +NGTGG+SIYG+KF+DENF LKHTGPG+LSMAN G +TN SQFFIT  
Sbjct: 2947 PDFICQGGDITKYNGTGGQSIYGDKFDDENFDLKHTGPGLLSMANYGQNTNSSQFFITLK 3006

Query: 430  KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG 528
            K   LD +HVVFG V +GM+ V++IE+  +  G
Sbjct: 3007 KAEHLDFKHVVFGFVKDGMDTVRKIESFGSPKG 3039



 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 40/62 (64%), Positives = 49/62 (79%)
 Frame = +2

Query: 89   PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
            P VFFDV  D  PLG+I++EL S++ P+T ENFRALCTGEKGFG+K SIFHRV+P   C+
Sbjct: 2893 PVVFFDVCADGEPLGRIIMELFSNIVPQTAENFRALCTGEKGFGFKNSIFHRVVPDFICQ 2952

Query: 269  EG 274
             G
Sbjct: 2953 GG 2954


>UniRef50_P49792 Cluster: E3 SUMO-protein ligase RanBP2; n=98;
            Eukaryota|Rep: E3 SUMO-protein ligase RanBP2 - Homo
            sapiens (Human)
          Length = 3224

 Score =  128 bits (310), Expect = 1e-28
 Identities = 59/97 (60%), Positives = 72/97 (74%)
 Frame = +1

Query: 250  PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
            P F+ QGGD T H+GTGG+SIYG+KFEDENF +KHTGPG+LSMAN G +TN SQF IT  
Sbjct: 3118 PDFVCQGGDITKHDGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQNTNNSQFVITLK 3177

Query: 430  KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLR 540
            K   LD +HVVFG V +GM+ VK+IE+  +  G   R
Sbjct: 3178 KAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVCR 3214



 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 42/66 (63%), Positives = 50/66 (75%)
 Frame = +2

Query: 77   KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPI 256
            K + P VFFDV  D  PLG+I +EL S++ P+T ENFRALCTGEKGFG+K SIFHRVIP 
Sbjct: 3060 KETNPVVFFDVCADGEPLGRITMELFSNIVPRTAENFRALCTGEKGFGFKNSIFHRVIPD 3119

Query: 257  SCCKEG 274
              C+ G
Sbjct: 3120 FVCQGG 3125


>UniRef50_UPI0000D9E199 Cluster: PREDICTED: similar to
           peptidylprolyl isomerase A isoform 1; n=1; Macaca
           mulatta|Rep: PREDICTED: similar to peptidylprolyl
           isomerase A isoform 1 - Macaca mulatta
          Length = 317

 Score =  128 bits (308), Expect = 2e-28
 Identities = 59/104 (56%), Positives = 74/104 (71%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM QGGDFT HNGTG KSIY  KF+DE+F LKHTGPG+LS+ANA  DTN SQFFI T KT
Sbjct: 192 FMCQGGDFTCHNGTGAKSIYREKFDDEDFILKHTGPGILSVANAEPDTNSSQFFICTAKT 251

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESLSKTVVR 567
            WL+G+ VV G V EG  +V+ +    +  G+  ++S  + VV+
Sbjct: 252 EWLNGKWVVSGKVREGKNIVEAMGRFGSRNGKTSKKSCQRPVVQ 295



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 35/62 (56%), Positives = 41/62 (66%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P +FF + VD  PLG    EL +D  PKT ENF AL TGEKGFG+KGS FHR+I    C+
Sbjct: 136 PTMFFSIAVDGEPLGCTSFELFADKFPKTAENFHALSTGEKGFGFKGSCFHRIITEFMCQ 195

Query: 269 EG 274
            G
Sbjct: 196 GG 197


>UniRef50_A2YAQ0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Oryza sativa|Rep: Peptidyl-prolyl cis-trans isomerase -
           Oryza sativa subsp. indica (Rice)
          Length = 435

 Score =  128 bits (308), Expect = 2e-28
 Identities = 60/96 (62%), Positives = 73/96 (76%)
 Frame = +1

Query: 220 LQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADT 399
           +QG  F      FM+QGGD T  +GTGG+SIYG KFEDENF LKH   G+LSMAN+G +T
Sbjct: 117 VQGSCFHRVIKGFMVQGGDITAGDGTGGESIYGLKFEDENFVLKHERKGMLSMANSGPNT 176

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           NGSQFFITT +T  LDG+HVVFG V++GM VV+ +E
Sbjct: 177 NGSQFFITTTRTPHLDGKHVVFGRVIKGMGVVRSVE 212



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 27/44 (61%), Positives = 32/44 (72%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG 220
           PR F DV++     G+IVIEL + V P+T ENFRALCTGEKG G
Sbjct: 26  PRCFMDVSIGGEIEGRIVIELYASVVPRTAENFRALCTGEKGVG 69


>UniRef50_Q4P0V4 Cluster: Peptidyl-prolyl cis-trans isomerase D;
           n=1; Ustilago maydis|Rep: Peptidyl-prolyl cis-trans
           isomerase D - Ustilago maydis (Smut fungus)
          Length = 398

 Score =  128 bits (308), Expect = 2e-28
 Identities = 58/88 (65%), Positives = 73/88 (82%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P FM+QGGDFT  +GTGG+SIYG KF+DE+ T KH  P +LSMANAGA+TNGSQFFITTV
Sbjct: 79  PKFMIQGGDFTRADGTGGESIYGEKFQDEDLTGKHDVPFLLSMANAGANTNGSQFFITTV 138

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETL 513
            T  LDG+HVVFG V++G  VV+++E++
Sbjct: 139 PTPHLDGKHVVFGRVLKGKGVVRRVESV 166



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 12/73 (16%)
 Frame = +2

Query: 71  TGKMSLPRVFFDVTVDDAPLGK-----IVIELRSDVTPKTCENFRALCTGE-------KG 214
           T K   P V+ D+    +P  +     IV+EL +D  P+T ENFR LCT         + 
Sbjct: 7   TPKPGNPIVYLDLAFGSSPASRPGSNRIVLELYADRVPRTAENFRVLCTNTSKLASTGQP 66

Query: 215 FGYKGSIFHRVIP 253
             ++ SIFHRVIP
Sbjct: 67  LSFRNSIFHRVIP 79


>UniRef50_Q9C566 Cluster: Peptidyl-prolyl cis-trans isomerase CYP40;
           n=10; Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase
           CYP40 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 361

 Score =  127 bits (307), Expect = 2e-28
 Identities = 60/98 (61%), Positives = 74/98 (75%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F      FM+QGGD + ++GTGG+SIYG KF+DENF LKH   G+LSMAN+G 
Sbjct: 54  LHYKGNRFHRVIKGFMIQGGDISANDGTGGESIYGLKFDDENFELKHERKGMLSMANSGP 113

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           +TNGSQFFITT +TS LDG+HVVFG V +GM VV+ IE
Sbjct: 114 NTNGSQFFITTTRTSHLDGKHVVFGRVTKGMGVVRSIE 151



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 34/65 (52%), Positives = 40/65 (61%), Gaps = 8/65 (12%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSI 235
           M   + F D+++     G+IVIEL  DV PKT ENFR LCTGEKG G        YKG+ 
Sbjct: 1   MGRSKCFMDISIGGELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNR 60

Query: 236 FHRVI 250
           FHRVI
Sbjct: 61  FHRVI 65


>UniRef50_Q5KA96 Cluster: Peptidyl-prolyl cis-trans isomerase H;
           n=4; Fungi/Metazoa group|Rep: Peptidyl-prolyl cis-trans
           isomerase H - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 179

 Score =  125 bits (302), Expect = 9e-28
 Identities = 54/88 (61%), Positives = 69/88 (78%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P FM+QGGDF   +GTG  SIYG +FEDENF +KHTGPG+LSMAN+G +TNG QFFITT 
Sbjct: 72  PQFMVQGGDFVRGDGTGSFSIYGAQFEDENFKVKHTGPGLLSMANSGPNTNGCQFFITTA 131

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETL 513
              +LDG+H VFG V++G+  V++IE +
Sbjct: 132 PAEFLDGKHCVFGRVIDGLLTVRKIENV 159



 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 34/60 (56%), Positives = 41/60 (68%), Gaps = 5/60 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGF-----GYKGSIFHRVIP 253
           P VFFD+++ D P G+I +EL  D+TPKT ENFR LCTGE        GYK + FHRVIP
Sbjct: 13  PIVFFDISIGDTPAGRIKMELFDDITPKTAENFRQLCTGEHRINSVPQGYKKATFHRVIP 72


>UniRef50_UPI0000E4607F Cluster: PREDICTED: similar to
           peptidylprolyl isomerase (EC 5.2.1.8) B, 20.3K - rat;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to peptidylprolyl isomerase (EC 5.2.1.8) B,
           20.3K - rat - Strongylocentrotus purpuratus
          Length = 239

 Score =  125 bits (301), Expect = 1e-27
 Identities = 62/116 (53%), Positives = 76/116 (65%), Gaps = 3/116 (2%)
 Frame = +1

Query: 199 HWRE--RLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVL 372
           +WR+  RL           P F++Q GD T  +GTGGKSIYGN F DENF L+H GPG +
Sbjct: 87  NWRQDKRLSYNNTQVHRIVPDFVIQMGDVTEGDGTGGKSIYGNFFADENFYLRHWGPGWV 146

Query: 373 SMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVV-KQIETLAATLGRPL 537
           +MAN+G DTN SQFFI   +  WLDG+HVVFG V+EGM++V K  E  A   G PL
Sbjct: 147 AMANSGPDTNNSQFFILLTRARWLDGKHVVFGKVIEGMDIVDKMAEVDADDNGFPL 202



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 4/58 (6%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTG----EKGFGYKGSIFHRVIP 253
           +VFF++ +DD P G++VI L  D  P T +NF A+  G    +K   Y  +  HR++P
Sbjct: 49  KVFFEMEIDDEPAGRVVIALFGDTCPVTVQNFAAIVRGNWRQDKRLSYNNTQVHRIVP 106


>UniRef50_Q54WQ9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Dictyostelium discoideum AX4|Rep: Peptidyl-prolyl
           cis-trans isomerase - Dictyostelium discoideum AX4
          Length = 574

 Score =  125 bits (301), Expect = 1e-27
 Identities = 59/101 (58%), Positives = 72/101 (71%)
 Frame = +1

Query: 211 RLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG 390
           RL  +G  F     +FM+Q GDF N NGTGG+SIYG +F+DENF +KH+ P +LSMANAG
Sbjct: 52  RLHYKGTPFHRIIKNFMVQCGDFQNKNGTGGESIYGKRFDDENFKIKHSEPYLLSMANAG 111

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
            +TNGSQFFITT   S LDG+H VFG VV G  VV  + +L
Sbjct: 112 PNTNGSQFFITTAPASHLDGKHCVFGKVVSGQNVVDILNSL 152



 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 7/60 (11%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTG-------EKGFGYKGSIFHRVI 250
           R FFDV +D  P+G+I+ EL +DV PKT ENFR LC G       +    YKG+ FHR+I
Sbjct: 5   RTFFDVEIDGKPIGRIIFELFNDVAPKTTENFRVLCLGTQYSKITQTRLHYKGTPFHRII 64


>UniRef50_Q23U86 Cluster: Peptidyl-prolyl cis-trans isomerase,
           cyclophilin-type family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Peptidyl-prolyl cis-trans
           isomerase, cyclophilin-type family protein - Tetrahymena
           thermophila SB210
          Length = 299

 Score =  124 bits (300), Expect = 2e-27
 Identities = 58/105 (55%), Positives = 74/105 (70%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G+ F     +F++QGGD TN +G+GGKSIYG  F+DENF L H  PG+LSMAN G +TN
Sbjct: 181 KGIPFHRISKNFVIQGGDITNRDGSGGKSIYGQSFKDENFKLTHNKPGILSMANYGPNTN 240

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPL 537
           GSQFFIT      LD  HVVFG VV+GM+VVK+IE +     +P+
Sbjct: 241 GSQFFITLNACEGLDKLHVVFGEVVQGMDVVKEIEKVETYGEKPM 285



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 29/58 (50%), Positives = 38/58 (65%)
 Frame = +2

Query: 74  GKMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRV 247
           G+ + P  FF++ +D   +G I  +L   VTPKT  NFR LCTG+ GFGYKG  FHR+
Sbjct: 131 GEKTYPNCFFEIEIDGKQVGMITFKLYDKVTPKTARNFRELCTGQNGFGYKGIPFHRI 188


>UniRef50_Q1KL26 Cluster: Peptidyl-prolyl cis-trans isomerase; n=6;
           Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Oryza sativa subsp. indica (Rice)
          Length = 204

 Score =  124 bits (299), Expect = 2e-27
 Identities = 57/99 (57%), Positives = 72/99 (72%), Gaps = 1/99 (1%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGD+   +GTG  SIYG KF+DENF  KHTGPG+LSMAN+G ++N
Sbjct: 87  KGCQFHRVIKDFMIQGGDYMKGDGTGCTSIYGTKFDDENFIAKHTGPGLLSMANSGVNSN 146

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVV-EGMEVVKQIETLA 516
           GSQFFIT  K  WLD +HVVFG V+ +GM  V++IE +A
Sbjct: 147 GSQFFITCAKCEWLDNKHVVFGRVLGDGMLAVRKIENVA 185



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 34/59 (57%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE---KGF--GYKGSIFHRVI 250
           P VFFDVT+   P G+I +EL +D+ PKT ENFR  CTGE    G   GYKG  FHRVI
Sbjct: 37  PVVFFDVTIGSIPAGRIKMELFADIVPKTAENFRQFCTGEHRKSGLPQGYKGCQFHRVI 95


>UniRef50_Q4N3T7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=4;
           Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Theileria parva
          Length = 460

 Score =  124 bits (298), Expect = 3e-27
 Identities = 59/97 (60%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM QGGDFTN +GTGGKSIYG KF+DENFT KHT  G+LSMAN+G +TNGSQFFIT    
Sbjct: 355 FMAQGGDFTNGDGTGGKSIYGEKFDDENFTDKHTERGILSMANSGPNTNGSQFFITFAPA 414

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLRE 543
             LDG+HVVFG V+ G E +  +E +    G RP+ +
Sbjct: 415 PHLDGKHVVFGKVMVGSEYLDDLEKVETGPGDRPVND 451



 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = +2

Query: 86  LPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           LP+VFF+V++ D    K+V  L SD  PKT ENFR LC  +  F +K S FHR+I
Sbjct: 299 LPKVFFEVSLGDTTF-KMVFALFSDTVPKTAENFRKLCQTDHEFNFKNSKFHRII 352


>UniRef50_P53691 Cluster: Peptidyl-prolyl cis-trans isomerase CPR6;
           n=25; Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase
           CPR6 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 371

 Score =  124 bits (298), Expect = 3e-27
 Identities = 63/112 (56%), Positives = 75/112 (66%), Gaps = 2/112 (1%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F      FM Q GDFTN NGTGG+SIY  KFEDENFT+KH  P +LSMANAG 
Sbjct: 55  LSYKGSIFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFTVKHDKPFLLSMANAGP 114

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL--GRPLRE 543
           +TNGSQ FIT V T  LDG+HVVFG V++G  +V+ IE         +PLR+
Sbjct: 115 NTNGSQAFITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRD 166



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 9/83 (10%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG---------FGYKGS 232
           M+ P+ FFD+++   P G+IV EL +D+ PKT ENF  LC G  G           YKGS
Sbjct: 1   MTRPKTFFDISIGGKPQGRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGS 60

Query: 233 IFHRVIPISCCKEGTSPTITALG 301
           IFHRVI    C+ G        G
Sbjct: 61  IFHRVIKDFMCQFGDFTNFNGTG 83


>UniRef50_Q13427 Cluster: Peptidyl-prolyl cis-trans isomerase G;
           n=52; Fungi/Metazoa group|Rep: Peptidyl-prolyl cis-trans
           isomerase G - Homo sapiens (Human)
          Length = 754

 Score =  123 bits (296), Expect = 5e-27
 Identities = 60/98 (61%), Positives = 70/98 (71%), Gaps = 5/98 (5%)
 Frame = +1

Query: 229 LHFPSCHPH-----FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           LH+ SC  H     FM+QGGDF+  NG GG+SIYG  FEDE+F +KH    +LSMAN G 
Sbjct: 58  LHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGK 117

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           DTNGSQFFITT  T  LDG HVVFG V+ G EVV++IE
Sbjct: 118 DTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIE 155



 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 36/66 (54%), Positives = 45/66 (68%), Gaps = 8/66 (12%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGS 232
           K+  PR FFD+ +++ P G++V EL SDV PKTCENFR LCTGEKG G        YK  
Sbjct: 4   KVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSC 63

Query: 233 IFHRVI 250
           +FHRV+
Sbjct: 64  LFHRVV 69


>UniRef50_P52016 Cluster: Peptidyl-prolyl cis-trans isomerase 8;
           n=3; Caenorhabditis|Rep: Peptidyl-prolyl cis-trans
           isomerase 8 - Caenorhabditis elegans
          Length = 466

 Score =  123 bits (296), Expect = 5e-27
 Identities = 59/97 (60%), Positives = 69/97 (71%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           QG  F      FM+QGGD T+ NGTGG SIYG  F+DEN  LKH  P +LSMAN G DTN
Sbjct: 60  QGSVFHRVIKGFMIQGGDITHGNGTGGYSIYGRTFDDENLALKHKKPYLLSMANRGPDTN 119

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           GSQFFIT+ +   LDG+H VFG V++G+EVVK IE L
Sbjct: 120 GSQFFITSEEVPHLDGKHCVFGEVIKGVEVVKAIENL 156



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 6/59 (10%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG------FGYKGSIFHRVI 250
           R FFD++++  P G+IV  L +   P+T ENFRA CTGE G        Y+GS+FHRVI
Sbjct: 10  RAFFDISINGEPAGRIVFSLWNHCCPRTVENFRAFCTGELGKMNGHYASYQGSVFHRVI 68


>UniRef50_UPI0000F1EBFC Cluster: PREDICTED: hypothetical protein; n=1;
            Danio rerio|Rep: PREDICTED: hypothetical protein - Danio
            rerio
          Length = 2475

 Score =  122 bits (293), Expect = 1e-26
 Identities = 52/95 (54%), Positives = 71/95 (74%)
 Frame = +1

Query: 250  PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
            P FM QGGD T+ +GTGG+SIYG+ FEDE+F ++HTGPG+LSMAN G D+N SQFF+T  
Sbjct: 2369 PDFMCQGGDITHQDGTGGRSIYGHAFEDESFEVRHTGPGLLSMANRGRDSNSSQFFLTLR 2428

Query: 430  KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
            K   LD +HV FG V +GM+V++++  +    G+P
Sbjct: 2429 KAEHLDYKHVAFGFVTDGMQVLRRLAEMGTKEGKP 2463



 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 43/64 (67%), Positives = 49/64 (76%)
 Frame = +2

Query: 83   SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISC 262
            S PRVFFDV VD    G+IV+EL + + PKT ENFRALCTGEKGFGY GSIFHR+IP   
Sbjct: 2313 SNPRVFFDVCVDGEDAGRIVMELFAHIVPKTAENFRALCTGEKGFGYSGSIFHRIIPDFM 2372

Query: 263  CKEG 274
            C+ G
Sbjct: 2373 CQGG 2376


>UniRef50_Q7PQY3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Endopterygota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Anopheles gambiae str. PEST
          Length = 860

 Score =  122 bits (293), Expect = 1e-26
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 1/113 (0%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G+ F      FM+Q GDF+N NGTGG+SIYG  F+DE FTLKH    +LSMAN G 
Sbjct: 72  LHYKGIIFHRVVKDFMIQSGDFSNGNGTGGESIYGGTFDDEEFTLKHDRAFLLSMANRGK 131

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL-GRPLRESL 549
           +TNGSQFFITT     LD  HVVFG+VV G ++V+Q+E L      RPL++++
Sbjct: 132 NTNGSQFFITTQPAPHLDNVHVVFGHVVSGQDLVRQLEQLPVDRNSRPLQDAM 184



 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 37/61 (60%), Positives = 41/61 (67%), Gaps = 8/61 (13%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHRV 247
           R FFDV++   P G+IV EL   V PKTCENFRALCTGEKG G        YKG IFHRV
Sbjct: 23  RCFFDVSLGGLPAGRIVFELFPAVAPKTCENFRALCTGEKGIGQKTGKPLHYKGIIFHRV 82

Query: 248 I 250
           +
Sbjct: 83  V 83


>UniRef50_O43447 Cluster: Peptidyl-prolyl cis-trans isomerase H;
           n=23; Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase
           H - Homo sapiens (Human)
          Length = 177

 Score =  120 bits (288), Expect = 5e-26
 Identities = 51/86 (59%), Positives = 66/86 (76%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM+QGGDF N +GTG  SIY   F DENF L+H+ PG+LSMAN+G  TNG QFFIT  K 
Sbjct: 72  FMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKC 131

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIETL 513
            WLDG+HVVFG +++G+ V+++IE +
Sbjct: 132 DWLDGKHVVFGKIIDGLLVMRKIENV 157



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 33/59 (55%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE-----KGFGYKGSIFHRVI 250
           P VFFDV++    +G++ IEL +DV PKT ENFR  CTGE        GYKGS FHRVI
Sbjct: 11  PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVI 69


>UniRef50_UPI000051A399 Cluster: PREDICTED: similar to
           Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific
           isozyme precursor (PPIase) (Rotamase); n=2;
           Endopterygota|Rep: PREDICTED: similar to Peptidyl-prolyl
           cis-trans isomerase, rhodopsin-specific isozyme
           precursor (PPIase) (Rotamase) - Apis mellifera
          Length = 251

 Score =  119 bits (286), Expect = 8e-26
 Identities = 52/84 (61%), Positives = 63/84 (75%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM+QGGD  N +GTG  SIYG  F+DENF + H  P  +SMANAG +TNG QFFITT+ T
Sbjct: 101 FMIQGGDIENGDGTGSISIYGKTFDDENFEIGHNAPMYVSMANAGKNTNGCQFFITTIPT 160

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIE 507
            WLDG+H VFG V+EG +VV +IE
Sbjct: 161 PWLDGKHTVFGKVIEGQDVVFKIE 184



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 30/54 (55%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALC-TGEKGFGYKGSIFHRVI 250
           +V+ D+ +DD P+G+IVI L SDV PKT +NF  L  TG  G  YK S FHRVI
Sbjct: 45  QVYLDIMIDDHPVGRIVIGLFSDVVPKTTKNFLTLATTGIGGKTYKHSKFHRVI 98


>UniRef50_Q45UE8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Strongylocentrotus purpuratus|Rep: Peptidyl-prolyl
           cis-trans isomerase - Strongylocentrotus purpuratus
           (Purple sea urchin)
          Length = 219

 Score =  118 bits (285), Expect = 1e-25
 Identities = 55/99 (55%), Positives = 74/99 (74%), Gaps = 2/99 (2%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYG-NKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           +FM+QGGDF + +G+G +SIYG + F+DENF L H G G L+MANAG +TNG QF+ITTV
Sbjct: 86  NFMIQGGDFASEDGSGSRSIYGKDHFDDENFNLDHYGAGWLAMANAGPNTNGCQFYITTV 145

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLRE 543
           KT WL+G HVV+G V++G++V+  IE  A     +PL E
Sbjct: 146 KTKWLNGAHVVYGKVLDGLDVLATIENSATDENDKPLTE 184



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 22/53 (41%), Positives = 27/53 (50%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +VFFD+++   P G I + L  DV PKT  NF           Y  S FHRVI
Sbjct: 32  KVFFDISIGGEPAGTIELGLFGDVVPKTVANFLFFADPLSKENYVDSKFHRVI 84


>UniRef50_Q27450 Cluster: Peptidyl-prolyl cis-trans isomerase 1;
           n=7; Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase
           1 - Brugia malayi (Filarial nematode worm)
          Length = 843

 Score =  118 bits (285), Expect = 1e-25
 Identities = 60/111 (54%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F     +FM+QGGDFT  +GTGG+SIYG  F+DE F +KH  P V+SMAN G 
Sbjct: 57  LHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGP 116

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRE 543
           +TNGSQFFITT     L+  HVVFG VV G EVV +IE L   +  RPL +
Sbjct: 117 NTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLAD 167



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 33/61 (54%), Positives = 39/61 (63%), Gaps = 8/61 (13%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHRV 247
           RVF DVT+D    G+IV+EL +D+ P+TC NF  LCTG  G G        YKGS FHRV
Sbjct: 8   RVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRV 67

Query: 248 I 250
           I
Sbjct: 68  I 68


>UniRef50_Q014U0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Ostreococcus|Rep: Peptidyl-prolyl cis-trans isomerase -
           Ostreococcus tauri
          Length = 311

 Score =  118 bits (284), Expect = 1e-25
 Identities = 58/109 (53%), Positives = 70/109 (64%)
 Frame = +1

Query: 211 RLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG 390
           RL  +G  F      F+ QGGDFT  NG GG+S+YG +FEDE F + H   GVLSMAN G
Sbjct: 191 RLTYEGSCFHRIVKGFVCQGGDFTLQNGCGGESVYGEEFEDEAFGISHAEAGVLSMANRG 250

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPL 537
            +TN SQFFITT     LD +HVVFG V+EGM+VV   E +    G+PL
Sbjct: 251 PNTNTSQFFITTAPAPSLDDKHVVFGRVLEGMDVVAACEAVGTESGQPL 299



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 8/69 (11%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG--------FGYKGSIFHRV 247
           + +FDV+V+    G+IV  L     P+TCENFRALCTGE+G          Y+GS FHR+
Sbjct: 143 KCYFDVSVNGKAKGRIVFGLFGLHAPRTCENFRALCTGERGTSGTSGRRLTYEGSCFHRI 202

Query: 248 IPISCCKEG 274
           +    C+ G
Sbjct: 203 VKGFVCQGG 211


>UniRef50_P30414 Cluster: NK-tumor recognition protein; n=55;
           Eukaryota|Rep: NK-tumor recognition protein - Homo
           sapiens (Human)
          Length = 1462

 Score =  118 bits (283), Expect = 2e-25
 Identities = 58/102 (56%), Positives = 70/102 (68%)
 Frame = +1

Query: 208 ERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANA 387
           ++L  +G  F     +FM+QGGDF+  NG GG+SIYG  F+DENF LKH    +LSMAN 
Sbjct: 55  KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANR 114

Query: 388 GADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           G  TNGSQFFITT     LDG HVVFG V+ G EV++QIE L
Sbjct: 115 GKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 156



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 8/67 (11%)
 Frame = +2

Query: 74  GKMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKG 229
           G    P+  FD+ ++  P+G+I+ +L SD+ PKTC+NF  LC+GEKG G        YKG
Sbjct: 2   GAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKG 61

Query: 230 SIFHRVI 250
           S FHRV+
Sbjct: 62  STFHRVV 68


>UniRef50_A7RA48 Cluster: Cyclophilin; n=4; Stichotrichida|Rep:
           Cyclophilin - Oxytricha trifallax (Sterkiella
           histriomuscorum)
          Length = 285

 Score =  117 bits (282), Expect = 2e-25
 Identities = 54/86 (62%), Positives = 65/86 (75%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM+QGGDFT  NG+GG+SIYG  F DENF LKHT  G+LSMANAG +TNGSQFFIT   T
Sbjct: 76  FMMQGGDFTAFNGSGGESIYGRTFPDENFKLKHTQKGLLSMANAGKNTNGSQFFITYAVT 135

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIETL 513
             L+G+H VFG V  G ++ ++IE L
Sbjct: 136 PHLNGKHCVFGKVESGYDICQKIERL 161



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 34/64 (53%), Positives = 42/64 (65%), Gaps = 8/64 (12%)
 Frame = +2

Query: 83  SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG--------FGYKGSIF 238
           S PRVFF++ +   P GKIV+EL  +VTP+T ENFR LCTGE G          +K S+F
Sbjct: 10  SNPRVFFEIEIGGKPQGKIVMELFKNVTPRTAENFRQLCTGESGKRSSNGKVLSFKNSVF 69

Query: 239 HRVI 250
           HRVI
Sbjct: 70  HRVI 73


>UniRef50_A0BG75 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Paramecium tetraurelia|Rep: Peptidyl-prolyl cis-trans
           isomerase - Paramecium tetraurelia
          Length = 166

 Score =  116 bits (280), Expect = 4e-25
 Identities = 50/103 (48%), Positives = 69/103 (66%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNG 405
           G +F  C  +F+ QGGD+   +GTGG SI+GN F+DENF ++H   G++SMAN GA+TNG
Sbjct: 52  GTNFHRCSENFIAQGGDYERGDGTGGTSIWGNYFKDENFNIRHDKRGIVSMANRGANTNG 111

Query: 406 SQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           SQFF T      LDG+HV FG ++ G E++ QI  ++   G P
Sbjct: 112 SQFFFTLTACPQLDGKHVAFGEIISGFEILDQISEISTYGGDP 154



 Score = 35.9 bits (79), Expect = 0.98
 Identities = 21/59 (35%), Positives = 27/59 (45%)
 Frame = +2

Query: 68  NTGKMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHR 244
           N    S    F  + V      +++I L     PKTCENFR LC  +    Y G+ FHR
Sbjct: 3   NKSSKSKKDCFMTMQVGKRQPVQVIIRLFDQQCPKTCENFRKLCQTK----YGGTNFHR 57


>UniRef50_Q6V7K6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=6;
           Trypanosomatidae|Rep: Peptidyl-prolyl cis-trans
           isomerase - Trypanosoma cruzi
          Length = 354

 Score =  116 bits (279), Expect = 6e-25
 Identities = 53/84 (63%), Positives = 62/84 (73%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM+QGGDFT HNGTGG SIYG +F+DENF +     G+L+MANAG +TNGSQFFIT    
Sbjct: 69  FMIQGGDFTKHNGTGGVSIYGERFDDENFDVPCDKAGLLAMANAGPNTNGSQFFITVNPA 128

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIE 507
             L GRHVVFG VV GM  V+ +E
Sbjct: 129 QHLTGRHVVFGKVVRGMNTVRALE 152



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/48 (56%), Positives = 32/48 (66%), Gaps = 9/48 (18%)
 Frame = +2

Query: 134 KIVIELRSDVTPKTCENFRALCTGEKG---------FGYKGSIFHRVI 250
           KI++EL  D+TPKTC NFRALCTG +G           YKGS FHR+I
Sbjct: 19  KILLELFDDITPKTCANFRALCTGNEGKVTDETQIPMTYKGSTFHRII 66


>UniRef50_UPI00003C1FBD Cluster: hypothetical protein UM04137.1;
           n=1; Ustilago maydis 521|Rep: hypothetical protein
           UM04137.1 - Ustilago maydis 521
          Length = 206

 Score =  115 bits (277), Expect = 1e-24
 Identities = 51/85 (60%), Positives = 66/85 (77%)
 Frame = +1

Query: 259 MLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTS 438
           M QGGDF N +GTG +SIYG+KF+DENFTLKH   G+LSMAN+G  TNG QFFIT     
Sbjct: 1   MCQGGDFINADGTGSRSIYGDKFDDENFTLKHDKAGLLSMANSGPGTNGCQFFITAQPCP 60

Query: 439 WLDGRHVVFGNVVEGMEVVKQIETL 513
           +LDG+HVVFG VV+G+  ++++E +
Sbjct: 61  FLDGKHVVFGKVVDGLLTLRKMENV 85


>UniRef50_Q5C1X2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Bilateria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Schistosoma japonicum (Blood fluke)
          Length = 157

 Score =  115 bits (276), Expect = 1e-24
 Identities = 55/100 (55%), Positives = 70/100 (70%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  QG  F      FM+QGGDF+N +GTGG+SIYG  F DE  T +H  P +LSMAN G 
Sbjct: 33  LTYQGSIFHRVIKGFMVQGGDFSNKDGTGGESIYGGTFADECLTTEHDRPFLLSMANRGP 92

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           +TNGSQFFITT     L+G+HVVFG+V+ G +VV++IE +
Sbjct: 93  NTNGSQFFITTAPAPHLNGKHVVFGHVISGEDVVRKIEAV 132


>UniRef50_UPI0000DA2DF2 Cluster: PREDICTED: similar to
           Peptidyl-prolyl cis-trans isomerase A (PPIase)
           (Rotamase) (Cyclophilin A) (Cyclosporin A-binding
           protein) (SP18); n=2; Rattus norvegicus|Rep: PREDICTED:
           similar to Peptidyl-prolyl cis-trans isomerase A
           (PPIase) (Rotamase) (Cyclophilin A) (Cyclosporin
           A-binding protein) (SP18) - Rattus norvegicus
          Length = 318

 Score =  114 bits (275), Expect = 2e-24
 Identities = 52/98 (53%), Positives = 67/98 (68%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P FM QGG+ T HNG GG+SIY  KFE E+  LKHTGPG+LSMAN   +T+GSQFFI T 
Sbjct: 212 PGFMCQGGNVTCHNGAGGRSIYREKFEGEDVILKHTGPGILSMANDEPNTSGSQFFICTA 271

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRE 543
           KT WL G+ VVF    +GM +V+ +E   +  G+  ++
Sbjct: 272 KTEWLGGKGVVFEKAKDGMNIVEAMERFGSRNGKTSKQ 309



 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 36/62 (58%), Positives = 43/62 (69%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P V+F++T D  PLG +  EL +D  PKT ENF AL TGEKGFGYK S FHR+IP   C+
Sbjct: 158 PTVYFNITADGEPLGHVSFELFADNVPKTAENFHALSTGEKGFGYKASSFHRIIPGFMCQ 217

Query: 269 EG 274
            G
Sbjct: 218 GG 219


>UniRef50_Q94611 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Lumbricus rubellus|Rep: Peptidyl-prolyl cis-trans
           isomerase - Lumbricus rubellus (Humus earthworm)
          Length = 223

 Score =  114 bits (275), Expect = 2e-24
 Identities = 53/97 (54%), Positives = 68/97 (70%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           +FM+QGGDFT+ NG GG SIYG  F DENF L H G G L MAN G +TNG+Q++I+TV 
Sbjct: 97  NFMIQGGDFTSQNGYGGLSIYGKYFNDENFKLCHHGFGWLGMANCGPNTNGAQYYISTVD 156

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRE 543
           T WLDG H +FG V+EG  VV+ IE    + G  +++
Sbjct: 157 TPWLDGLHNIFGIVLEGAFVVRAIEKNPTSKGENIKD 193



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 6/59 (10%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG------YKGSIFHRVI 250
           + FFD+++   P+G+IV  L +D+ P T  NF +L  G            K SIFHR I
Sbjct: 37  KAFFDISIGSKPIGRIVFGLFADLCPYTVRNFASLVLGNTTNSDWHITCDKSSIFHRTI 95


>UniRef50_Q4RPL0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Tetraodon nigroviridis|Rep: Peptidyl-prolyl cis-trans
           isomerase - Tetraodon nigroviridis (Green puffer)
          Length = 335

 Score =  113 bits (273), Expect = 3e-24
 Identities = 55/95 (57%), Positives = 63/95 (66%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGDFT   G G  SIYG  F DENF LKH G G +SMANAG DTN
Sbjct: 110 KGTKFHRVIKDFMIQGGDFTV--GDGSHSIYGTTFADENFKLKHIGAGWVSMANAGPDTN 167

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           GSQFFI   +  WLDG+HVVFG V++GM V   +E
Sbjct: 168 GSQFFILATRAPWLDGKHVVFGKVLDGMVVFHTVE 202



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/41 (56%), Positives = 27/41 (65%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG 214
           +VFFDVTV    +G+IVI L  +V P T  NF AL TGE G
Sbjct: 5   QVFFDVTVAGHEVGRIVIGLFGEVVPLTVNNFVALATGEVG 45


>UniRef50_Q9W0Q2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=13;
           Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Drosophila melanogaster (Fruit fly)
          Length = 176

 Score =  113 bits (273), Expect = 3e-24
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD T   G GG SIYG++F DE +  L+HTG G+LSMAN+G DTNGSQFFIT   
Sbjct: 69  FMIQGGDPTG-TGRGGASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAP 127

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQI 504
           T WLDG+H +FG V  GMEVVK+I
Sbjct: 128 TQWLDGKHTIFGRVYTGMEVVKRI 151



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 21/61 (34%), Positives = 30/61 (49%)
 Frame = +2

Query: 119 DAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITAL 298
           +  +G+I +EL     P TC NF  L    +G+ Y   +FHR+I      +G  PT T  
Sbjct: 26  ETSMGEITVELYWKHAPNTCRNFAEL--SRRGY-YNNVVFHRIIR-DFMIQGGDPTGTGR 81

Query: 299 G 301
           G
Sbjct: 82  G 82


>UniRef50_Q5CKI0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Cryptosporidium|Rep: Peptidyl-prolyl cis-trans isomerase
           - Cryptosporidium hominis
          Length = 210

 Score =  113 bits (272), Expect = 4e-24
 Identities = 59/96 (61%), Positives = 66/96 (68%), Gaps = 2/96 (2%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P FM QGGDFTN NGTGGKSIYG+ FEDENF   H    V+SMAN G +TNGSQFFIT  
Sbjct: 92  PGFMAQGGDFTNGNGTGGKSIYGDSFEDENFKFIHES-HVISMANRGPNTNGSQFFITFT 150

Query: 430 KTSWLDGRHVVFGNVV--EGMEVVKQIETLAATLGR 531
            T  LDGRHVVFG +V  E    + +IE L +  GR
Sbjct: 151 PTPHLDGRHVVFGKLVDDESKLTLTKIEQLGSYSGR 186



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 27/62 (43%), Positives = 31/62 (50%), Gaps = 7/62 (11%)
 Frame = +2

Query: 89  PRVFFDVTVD-DAPLGKIVIELRSDVTPKTCENFRALCTGE------KGFGYKGSIFHRV 247
           P V  ++TV  D    K+ I L     PKT  NF +LC G       K   Y GSIFHRV
Sbjct: 31  PSVVVELTVSIDKEESKLRIGLFGVEVPKTANNFYSLCVGGMKDKDGKEMSYIGSIFHRV 90

Query: 248 IP 253
           IP
Sbjct: 91  IP 92


>UniRef50_Q4UI04 Cluster: Cyclophilin peptidyl-prolyl cis-trans
           isomerase protein, putative; n=3; Piroplasmida|Rep:
           Cyclophilin peptidyl-prolyl cis-trans isomerase protein,
           putative - Theileria annulata
          Length = 613

 Score =  113 bits (271), Expect = 5e-24
 Identities = 56/95 (58%), Positives = 70/95 (73%), Gaps = 1/95 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           G  F     +FM+QGGD T  +GTGG+SI+G++FEDE + +LKH  P  LSMAN+G +TN
Sbjct: 496 GCTFHRVIKNFMIQGGDPTG-DGTGGESIWGSEFEDEIHPSLKHDRPFTLSMANSGPNTN 554

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           GSQFFITTV   WLDG+H VFG V  GME+V+ IE
Sbjct: 555 GSQFFITTVPCPWLDGKHTVFGRVTSGMEIVQSIE 589


>UniRef50_Q27716 Cluster: Cyclophilin precursor; n=10;
           Eukaryota|Rep: Cyclophilin precursor - Plasmodium
           falciparum
          Length = 210

 Score =  113 bits (271), Expect = 5e-24
 Identities = 50/91 (54%), Positives = 68/91 (74%), Gaps = 2/91 (2%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM+QGGDF N+NG+G  SIYG  F+DENF +KH   G+LSMAN G +TNG QFFI T K 
Sbjct: 102 FMIQGGDFVNYNGSGCISIYGEHFDDENFDIKHDKEGLLSMANTGPNTNGCQFFIITKKC 161

Query: 436 SWLDGRHVVFGNVV--EGMEVVKQIETLAAT 522
            WLDG++VVFG ++  + + ++K+IE ++ T
Sbjct: 162 EWLDGKNVVFGRIIDNDSLILLKKIENVSVT 192



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 28/61 (45%), Positives = 35/61 (57%), Gaps = 5/61 (8%)
 Frame = +2

Query: 83  SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGF-----GYKGSIFHRV 247
           S P VF D+ + +  LGK   EL  ++ P+T ENFR  CTGE        GYK + FHRV
Sbjct: 39  SNPVVFMDINLGNHFLGKFKFELFQNIVPRTSENFRKFCTGEHKINNLPVGYKNTTFHRV 98

Query: 248 I 250
           I
Sbjct: 99  I 99


>UniRef50_O49605 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Magnoliophyta|Rep: Peptidyl-prolyl cis-trans isomerase -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 224

 Score =  112 bits (270), Expect = 7e-24
 Identities = 54/111 (48%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F      F++QGGD  + +G    SIYG  F DENF ++H+  G+++MAN G 
Sbjct: 96  LHYKGTPFHRIISGFVIQGGDIIHGDGKSSDSIYGGTFPDENFKIQHSHAGMVAMANTGP 155

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL-GRPLRE 543
           D+NGSQFFITTVK SWL+G HVV G V++GM+ V  IE  A T  G+P ++
Sbjct: 156 DSNGSQFFITTVKASWLEGEHVVLGKVIQGMDNVFAIEGGAGTYSGKPRKK 206



 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 7/60 (11%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG-------FGYKGSIFHRVI 250
           RVF DV +D   LG+IVI L   V PKT ENFRALCTGEKG         YKG+ FHR+I
Sbjct: 48  RVFLDVDIDGQRLGRIVIGLYGTVVPKTVENFRALCTGEKGKTSSGKPLHYKGTPFHRII 107


>UniRef50_A5AK94 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Vitis vinifera|Rep: Peptidyl-prolyl cis-trans isomerase
           - Vitis vinifera (Grape)
          Length = 786

 Score =  107 bits (258), Expect(2) = 8e-24
 Identities = 49/82 (59%), Positives = 61/82 (74%)
 Frame = +1

Query: 295 TGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNV 474
           TGG+SIYG KF DENF   H GPG LSMAN+G +TNGSQFF+T  +   LDG+HVVFG V
Sbjct: 111 TGGESIYGGKFADENFKRAHEGPGFLSMANSGPNTNGSQFFMTFKRQPHLDGKHVVFGKV 170

Query: 475 VEGMEVVKQIETLAATLGRPLR 540
           V+G++ +K+IE L    G+P R
Sbjct: 171 VQGIDTLKKIEQLGTGDGKPAR 192



 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 40/66 (60%), Positives = 45/66 (68%), Gaps = 8/66 (12%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGS 232
           K   P VF DV++D  P+ KIVIEL +DV PKT ENFRALCTGEKG G        YKGS
Sbjct: 3   KKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYKGS 62

Query: 233 IFHRVI 250
            FHR+I
Sbjct: 63  FFHRII 68



 Score = 25.4 bits (53), Expect(2) = 8e-24
 Identities = 12/27 (44%), Positives = 14/27 (51%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNG 294
           L  +G  F      FM QGGDF+  NG
Sbjct: 57  LHYKGSFFHRIIKGFMAQGGDFSKGNG 83


>UniRef50_Q23QY9 Cluster: Peptidyl-prolyl cis-trans isomerase,
           cyclophilin-type family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Peptidyl-prolyl cis-trans
           isomerase, cyclophilin-type family protein - Tetrahymena
           thermophila SB210
          Length = 496

 Score =  111 bits (267), Expect = 2e-23
 Identities = 52/95 (54%), Positives = 68/95 (71%), Gaps = 1/95 (1%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           +F +QGGD TN +GTGG SIYG  F DE+ + +HT  G+LSMAN+G +TN SQFFIT   
Sbjct: 73  NFCIQGGDITNGDGTGGFSIYGRHFADEDLSRRHTCAGLLSMANSGRNTNSSQFFITLKA 132

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RP 534
              LDG+HVVFG V++GM++V+QI  +   L  RP
Sbjct: 133 APHLDGKHVVFGQVIDGMDIVRQIAKVPVDLNDRP 167



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 10/78 (12%)
 Frame = +2

Query: 71  TGKMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG----------FG 220
           + K    +V+ D  V   PLG++V EL +D+TPKT ENFR LCTG+ G            
Sbjct: 2   SNKKKAIQVYLDFMVGSKPLGRVVFELFTDLTPKTAENFRGLCTGDYGQSGLSGRNAKLW 61

Query: 221 YKGSIFHRVIPISCCKEG 274
           Y+ S  HR++   C + G
Sbjct: 62  YENSKIHRIVDNFCIQGG 79


>UniRef50_P87051 Cluster: Peptidyl-prolyl cis-trans isomerase ppi1;
           n=7; Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase
           ppi1 - Schizosaccharomyces pombe (Fission yeast)
          Length = 155

 Score =  110 bits (264), Expect = 4e-23
 Identities = 53/94 (56%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           G+ F    P F++QGGD T   G GG SIYG+KF+DE +  L HTG G+LSMANAG +TN
Sbjct: 40  GVIFHRVIPDFVIQGGDPTG-TGRGGTSIYGDKFDDEIHSDLHHTGAGILSMANAGPNTN 98

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
            SQFFIT   T WLDG+H +FG VV G+ V K++
Sbjct: 99  SSQFFITLAPTPWLDGKHTIFGRVVSGLSVCKRM 132



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 29/58 (50%), Positives = 37/58 (63%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           LGKI+IEL ++  PKTC+NF  L   ++G+ Y G IFHRVIP     +G  PT T  G
Sbjct: 10  LGKILIELYTEHAPKTCQNFYTL--AKEGY-YDGVIFHRVIP-DFVIQGGDPTGTGRG 63


>UniRef50_A3A4B4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Oryza sativa|Rep: Peptidyl-prolyl cis-trans isomerase -
           Oryza sativa subsp. japonica (Rice)
          Length = 494

 Score =  109 bits (263), Expect = 5e-23
 Identities = 51/84 (60%), Positives = 64/84 (76%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM QGGDF+N +G+GG+SIYG  FEDENF L+H   G+LSMANAG +TNGSQFFIT    
Sbjct: 71  FMAQGGDFSNGDGSGGESIYGGTFEDENFVLRHDERGLLSMANAGPNTNGSQFFITFKHN 130

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIE 507
           S LD +  VFG ++ G +V+K+IE
Sbjct: 131 SRLDRKSTVFGKLILGNDVLKRIE 154



 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 36/66 (54%), Positives = 43/66 (65%), Gaps = 8/66 (12%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGS 232
           K   P VF DV++ D P  ++V EL +DV P+T ENFRALCTGE G G        YKGS
Sbjct: 3   KKKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYKGS 62

Query: 233 IFHRVI 250
           +FHRVI
Sbjct: 63  LFHRVI 68


>UniRef50_UPI0000D9E752 Cluster: PREDICTED: similar to
           peptidylprolyl isomerase A isoform 1; n=2;
           Catarrhini|Rep: PREDICTED: similar to peptidylprolyl
           isomerase A isoform 1 - Macaca mulatta
          Length = 398

 Score =  109 bits (261), Expect = 9e-23
 Identities = 55/105 (52%), Positives = 65/105 (61%), Gaps = 3/105 (2%)
 Frame = +1

Query: 226 GLHFPSCH---PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGAD 396
           G     CH   P FM +GGDFT HN TGGKSIY  KF+DENF LK  GPG+LS ANAG +
Sbjct: 288 GYRSSHCHRIIPGFMCRGGDFTCHNSTGGKSIYREKFDDENFILKQIGPGILSRANAGPN 347

Query: 397 TNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           TNGSQFF  T  T W       FG V EG+ +V+ +E   +  G+
Sbjct: 348 TNGSQFFTCTAVTEW-------FGEVKEGVIIVEAVERFGSRKGK 385



 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 34/62 (54%), Positives = 40/62 (64%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P VFFD+TV   PL  +  EL +D  PKT ENFR L T EKGFGY+ S  HR+IP   C+
Sbjct: 245 PTVFFDITVQGEPLSCVSFELLADKFPKTEENFRLLSTREKGFGYRSSHCHRIIPGFMCR 304

Query: 269 EG 274
            G
Sbjct: 305 GG 306



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQ 566
           FGS  GKTSK+I + DCGQ
Sbjct: 379 FGSRKGKTSKKIAVADCGQ 397


>UniRef50_Q01FP9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Ostreococcus|Rep: Peptidyl-prolyl cis-trans isomerase -
           Ostreococcus tauri
          Length = 635

 Score =  108 bits (260), Expect = 1e-22
 Identities = 61/111 (54%), Positives = 73/111 (65%), Gaps = 2/111 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGADTN 402
           G+ F     +FM+Q GD    +GTGG SI+G +FEDE    LKH  P  +SMANAG +TN
Sbjct: 518 GIVFHRVIKNFMIQTGDPLG-DGTGGHSIWGGEFEDEIVRDLKHDRPFTVSMANAGPNTN 576

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLRESLS 552
           GSQFFITTV T WLDG+H VFG V  G +VVK IE      G RPL E++S
Sbjct: 577 GSQFFITTVATPWLDGKHTVFGRVTRGSDVVKAIECAKCDKGDRPL-ETIS 626



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           LG I ++  ++  PKTCENF    T  +   Y G +FHRVI
Sbjct: 488 LGDIHVDFFTNECPKTCENF---STHARNGYYDGIVFHRVI 525


>UniRef50_Q23GA6 Cluster: Peptidyl-prolyl cis-trans isomerase,
           cyclophilin-type family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Peptidyl-prolyl cis-trans
           isomerase, cyclophilin-type family protein - Tetrahymena
           thermophila SB210
          Length = 635

 Score =  108 bits (260), Expect = 1e-22
 Identities = 56/107 (52%), Positives = 73/107 (68%), Gaps = 2/107 (1%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITT 426
           P+FM+Q G     +GTGG+SI+G +FEDE +  LKH   G LSMANAG +TNGSQFFIT 
Sbjct: 527 PNFMIQTG-CPKGDGTGGESIWGGEFEDEFHPKLKHDKAGTLSMANAGPNTNGSQFFITC 585

Query: 427 VKTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRESLSKTVV 564
             T WLD +H VFG V +GM++V+QI T       RPL++   +T+V
Sbjct: 586 NPTEWLDNKHTVFGRVTKGMDIVQQIATAKKDKFDRPLKDIKIRTIV 632



 Score = 35.9 bits (79), Expect = 0.98
 Identities = 20/41 (48%), Positives = 22/41 (53%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           G I +EL   + PKT ENF    T  K   Y   IFHRVIP
Sbjct: 490 GDIEVELYDKLVPKTVENF---VTHSKNGYYNNLIFHRVIP 527


>UniRef50_Q010G5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Ostreococcus|Rep: Peptidyl-prolyl cis-trans isomerase -
           Ostreococcus tauri
          Length = 252

 Score =  108 bits (259), Expect = 2e-22
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +1

Query: 211 RLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNK-FEDE--NFTLKHTGPGVLSMA 381
           R+  +G+ F  C   FM+QGGDF + NG GG+S  G K F+D+     LKH   GVLSM 
Sbjct: 124 RMCYEGVRFHRCVRGFMMQGGDFQHQNGAGGESALGKKTFKDDVGGLKLKHDARGVLSMG 183

Query: 382 NAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESLSKTV 561
           N G ++N SQFFIT      LDG+HVVFG ++EGMEV+  IE   A     + E  +K+V
Sbjct: 184 NTGKNSNTSQFFITFGPCKQLDGKHVVFGKIIEGMEVLDMIEEECAVAPGGMSEEPTKSV 243

Query: 562 V 564
           V
Sbjct: 244 V 244



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 8/56 (14%)
 Frame = +2

Query: 107 VTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHRVI 250
           +  + A   ++V EL  +  P  CENF+ LC G +G          Y+G  FHR +
Sbjct: 81  IETEPATKTRMVFELFDERAPLACENFKMLCLGTRGTSKESGARMCYEGVRFHRCV 136


>UniRef50_Q5A2Z0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Saccharomycetales|Rep: Peptidyl-prolyl cis-trans
           isomerase - Candida albicans (Yeast)
          Length = 229

 Score =  108 bits (259), Expect = 2e-22
 Identities = 57/99 (57%), Positives = 66/99 (66%), Gaps = 3/99 (3%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGN--KFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           FM+Q GDF    G GG S   N  KF+DENF LKH     LSMANAG +TNGSQFFITT 
Sbjct: 110 FMIQSGDFEYGQGYGGYSPTHNNGKFDDENFELKHDRKYRLSMANAGKNTNGSQFFITTA 169

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLRE 543
            T WLDG HVVFG V++G +VV  IE +    G RP++E
Sbjct: 170 LTKWLDGAHVVFGEVLDGKDVVDYIENVKTGRGDRPVKE 208



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/53 (54%), Positives = 36/53 (67%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +V+FDV  D   +G+I I L   V PKT ENFR LCTGE G  Y+ ++FHRVI
Sbjct: 55  KVYFDVEEDGKSIGRITIGLFGTVVPKTVENFRVLCTGELGPSYENTVFHRVI 107


>UniRef50_UPI0000D55F9D Cluster: PREDICTED: similar to
           peptidylprolyl isomerase D; n=1; Tribolium
           castaneum|Rep: PREDICTED: similar to peptidylprolyl
           isomerase D - Tribolium castaneum
          Length = 353

 Score =  107 bits (258), Expect = 2e-22
 Identities = 52/101 (51%), Positives = 71/101 (70%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P FM+QGGD T  +GTGG+SIYG+ F+DENFTL H   G++ MAN G ++N SQF+ITTV
Sbjct: 74  PLFMVQGGDITTKDGTGGESIYGDTFDDENFTLLHEEEGMVGMANNGPNSNNSQFYITTV 133

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESLS 552
             S LDG +VVFG V +G  ++K++  +      PL E++S
Sbjct: 134 PCSHLDGTNVVFGIVRKGFNIIKEMGEVPRNGDTPL-ENIS 173



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 37/78 (47%), Positives = 46/78 (58%), Gaps = 7/78 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHRV 247
           P VF D++   A  G++VIEL  D  PKT ENFRALCTGEKG G       +K +IFHRV
Sbjct: 13  PVVFLDISFGPAKAGRVVIELFKDKVPKTAENFRALCTGEKGIGKHGKPLHFKNTIFHRV 72

Query: 248 IPISCCKEGTSPTITALG 301
           +P+   + G   T    G
Sbjct: 73  VPLFMVQGGDITTKDGTG 90


>UniRef50_Q09637 Cluster: Peptidyl-prolyl cis-trans isomerase 9;
           n=4; Caenorhabditis|Rep: Peptidyl-prolyl cis-trans
           isomerase 9 - Caenorhabditis elegans
          Length = 309

 Score =  107 bits (258), Expect = 2e-22
 Identities = 56/116 (48%), Positives = 71/116 (61%), Gaps = 1/116 (0%)
 Frame = +1

Query: 205 RERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMAN 384
           + RL  +   F      FM+QGGD T  +G GG SIYG  F+DE F LKH+ P +LSMAN
Sbjct: 52  KARLHYKQNEFHRIVKKFMIQGGDITEGDGRGGFSIYGRYFDDEKFKLKHSRPYLLSMAN 111

Query: 385 AGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRESL 549
            G ++N SQFFITT      +G+HVVFG VV+G  VV  I+ LA     +PL + L
Sbjct: 112 KGPNSNSSQFFITTAAAPHCNGKHVVFGEVVKGQNVVDYIDNLAVDDKSKPLAKVL 167



 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 30/61 (49%), Positives = 39/61 (63%), Gaps = 8/61 (13%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG--------FGYKGSIFHRV 247
           RVF D++VD+  +G+I I L  +  PKTCENFRALCTGE G          YK + FHR+
Sbjct: 6   RVFLDISVDENLIGRIEIRLFVEDAPKTCENFRALCTGEVGMTPNNKARLHYKQNEFHRI 65

Query: 248 I 250
           +
Sbjct: 66  V 66


>UniRef50_P0C1I9 Cluster: Peptidyl-prolyl cis-trans isomerase cyp11;
           n=1; Rhizopus oryzae|Rep: Peptidyl-prolyl cis-trans
           isomerase cyp11 - Rhizopus oryzae (Rhizopus delemar)
          Length = 338

 Score =  107 bits (258), Expect = 2e-22
 Identities = 54/98 (55%), Positives = 64/98 (65%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F      FM QGGDFT+  G GG+SIYG  F DE+F+ KH   G+LSMAN G 
Sbjct: 54  LHYKGSIFHRIIKGFMCQGGDFTHRTGKGGESIYGANFPDESFSRKHDTHGLLSMANRGP 113

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           +T  SQFFITT  T  LDG+HVVFG VV G  VV+ +E
Sbjct: 114 NTQTSQFFITTRPTPHLDGKHVVFGRVVSGYNVVEMME 151



 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 42/70 (60%), Positives = 48/70 (68%), Gaps = 8/70 (11%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHR 244
           PRVFFD+ VD   +G+IVIEL +D  PKT ENFRALCTGEKG G        YKGSIFHR
Sbjct: 4   PRVFFDIDVDGNRIGRIVIELFADQVPKTAENFRALCTGEKGIGKVSNMPLHYKGSIFHR 63

Query: 245 VIPISCCKEG 274
           +I    C+ G
Sbjct: 64  IIKGFMCQGG 73


>UniRef50_O66105 Cluster: Probable peptidyl-prolyl cis-trans
           isomerase; n=21; Bacteria|Rep: Probable peptidyl-prolyl
           cis-trans isomerase - Treponema pallidum
          Length = 215

 Score =  107 bits (257), Expect = 3e-22
 Identities = 59/95 (62%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADT 399
           QGL F      FM+QGGD    NGTGG    G +F DE +  L+H  PGVLSMANAG  T
Sbjct: 85  QGLTFHRVIKDFMIQGGD-PQGNGTGGP---GYQFPDECDPALRHDSPGVLSMANAGPGT 140

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
           NGSQFFIT V T WLDG+H VFG VVEGMEVV  I
Sbjct: 141 NGSQFFITHVATPWLDGKHTVFGKVVEGMEVVHAI 175


>UniRef50_Q8W4D0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=8;
           cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase - Arabidopsis thaliana (Mouse-ear cress)
          Length = 631

 Score =  107 bits (256), Expect = 4e-22
 Identities = 53/85 (62%), Positives = 66/85 (77%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD    +GTGG+SI+G +FEDE + +L+H  P  LSMANAG +TNGSQFFITTV 
Sbjct: 524 FMIQTGDPLG-DGTGGQSIWGREFEDEFHKSLRHDRPFTLSMANAGPNTNGSQFFITTVA 582

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIE 507
           T WLD +H VFG VV+GM+VV+ IE
Sbjct: 583 TPWLDNKHTVFGRVVKGMDVVQGIE 607


>UniRef50_A5DJZ6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Pichia guilliermondii|Rep: Peptidyl-prolyl cis-trans
           isomerase - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 272

 Score =  107 bits (256), Expect = 4e-22
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGN-KFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD+ N +GTGG+S++   KF DENF +KH   G LSMANAG +TNG+QFFITT +
Sbjct: 105 FMIQGGDYENGDGTGGRSVFETAKFPDENFVVKHNKLGRLSMANAGPNTNGAQFFITTKE 164

Query: 433 TS-WLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRE 543
              WLDG HVVFG +V G + ++++  +     RP  E
Sbjct: 165 DCLWLDGIHVVFGQLVGGFDTLQKLNVVETDHDRPKEE 202



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           LG + + L  ++ P T +NF  L     G+GYK + FHR+I
Sbjct: 62  LGFLELALFGELVPITVDNFVKLSNQTFGYGYKEAKFHRII 102


>UniRef50_P0C1I3 Cluster: Peptidyl-prolyl cis-trans isomerase H;
           n=7; cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase H - Rhizopus oryzae (Rhizopus delemar)
          Length = 178

 Score =  107 bits (256), Expect = 4e-22
 Identities = 49/88 (55%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYG-NKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGDF   +GTG   IYG ++F DENF  KHTG G+LSMAN+G ++NG QFFIT   
Sbjct: 72  FMVQGGDFIKGDGTGAMCIYGGDRFADENFIEKHTGAGLLSMANSGPNSNGCQFFITCDA 131

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLA 516
             +LDG+HVVFG +V+G+  +++IE +A
Sbjct: 132 CDFLDGKHVVFGRLVDGLLTLRKIENVA 159



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 5/65 (7%)
 Frame = +2

Query: 71  TGKMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE---KGF--GYKGSI 235
           + ++  P VFFD+++ D P+G++ +EL SD+ P+T ENFR LCTGE    G   GYK  +
Sbjct: 5   SNQVERPVVFFDISIGDVPVGRMKMELFSDIVPRTAENFRQLCTGEYKRNGVPQGYKNCL 64

Query: 236 FHRVI 250
           FHRVI
Sbjct: 65  FHRVI 69


>UniRef50_P15425 Cluster: Peptidyl-prolyl cis-trans isomerase,
           rhodopsin-specific isozyme precursor; n=5; Diptera|Rep:
           Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific
           isozyme precursor - Drosophila melanogaster (Fruit fly)
          Length = 237

 Score =  107 bits (256), Expect = 4e-22
 Identities = 50/96 (52%), Positives = 62/96 (64%), Gaps = 2/96 (2%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTL--KHTGPGVLSMANAGADT 399
           G  F      F++QGGD  N +GTG  SIYG+ F DE+  L  +H  PG L MAN G DT
Sbjct: 74  GSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDT 133

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           NG QF++TTV   WLDG+H VFG V+EGM+ +  IE
Sbjct: 134 NGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIE 169



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALC-TGEKGFGYKGSIFHRVI 250
           R++ DV  +  P+G+I   L   + PKT  NFR +C  G  G  Y GS FHRV+
Sbjct: 28  RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVV 81


>UniRef50_Q6MRB4 Cluster: Peptidyl-prolyl cis-trans isomerase
           precursor; n=2; Bacteria|Rep: Peptidyl-prolyl cis-trans
           isomerase precursor - Bdellovibrio bacteriovorus
          Length = 211

 Score =  106 bits (255), Expect = 5e-22
 Identities = 62/115 (53%), Positives = 72/115 (62%), Gaps = 3/115 (2%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE--NFTLKHTGPGVLSMANAGADT 399
           GL F      FM+QGG      GTGG    G +FEDE      KH  PG+LSMANAG +T
Sbjct: 97  GLTFHRVIKDFMIQGGCPLG-TGTGGP---GFRFEDEFPAGAPKHDKPGILSMANAGPNT 152

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE-TLAATLGRPLRESLSKTV 561
           NGSQFF+TTV T WLDGRH VFG VVEGM+VVK IE +    + RP+   + K V
Sbjct: 153 NGSQFFVTTVPTPWLDGRHTVFGEVVEGMDVVKSIENSKTGAMDRPVEPIVIKHV 207


>UniRef50_A4HE26 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Leishmania braziliensis|Rep: Peptidyl-prolyl cis-trans
           isomerase - Leishmania braziliensis
          Length = 182

 Score =  106 bits (255), Expect = 5e-22
 Identities = 61/145 (42%), Positives = 73/145 (50%), Gaps = 3/145 (2%)
 Frame = +2

Query: 83  SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISC 262
           S P+V+ D+ +     G++ +EL +D  PKT ENFRALCTGEKGFGY G  FHR    SC
Sbjct: 12  SNPKVWMDIEIGGQSAGRVTMELFADAVPKTAENFRALCTGEKGFGYSGCPFHRGSQSSC 71

Query: 263 CKEGTSPTITALGESPSTAISLKTRIS---PLSTLDLASSPWLMPVLILMVXXXXXXXXX 433
            +  T   +TAL  SPST I+L    S   P +T       W MPV              
Sbjct: 72  ARVATLLLVTALAASPSTVINLMMNPSLARPANTSARERCRWPMPVPTRTALSSSCARRP 131

Query: 434 XXGWMADMLSLGMLLKAWKLSSRLR 508
             GW A  LSL    KA K S R R
Sbjct: 132 RAGWTASTLSLARSWKATKSSRRWR 156


>UniRef50_Q96BP3 Cluster: Peptidylprolyl isomerase domain and WD
           repeat-containing protein 1; n=51; cellular
           organisms|Rep: Peptidylprolyl isomerase domain and WD
           repeat-containing protein 1 - Homo sapiens (Human)
          Length = 646

 Score =  106 bits (255), Expect = 5e-22
 Identities = 52/87 (59%), Positives = 65/87 (74%), Gaps = 1/87 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD T   G GG+SI+G +FEDE + TL+H  P  LSMANAG++TNGSQFFIT V 
Sbjct: 540 FMIQTGDPTG-TGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVP 598

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETL 513
           T WLD +H VFG V +GMEVV++I  +
Sbjct: 599 TPWLDNKHTVFGRVTKGMEVVQRISNV 625


>UniRef50_A0BD35 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Paramecium tetraurelia|Rep: Peptidyl-prolyl cis-trans
           isomerase - Paramecium tetraurelia
          Length = 473

 Score =  106 bits (254), Expect = 6e-22
 Identities = 46/84 (54%), Positives = 62/84 (73%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           + ++QGGD  N++GTGG SIY   F DENF+ +H   G+LSMAN G +TN SQFFIT   
Sbjct: 70  NMLIQGGDIINNDGTGGASIYSQTFVDENFSRRHACAGLLSMANRGRNTNNSQFFITLKP 129

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQI 504
              LDG+HVVFG V++G+EV+K++
Sbjct: 130 CPHLDGKHVVFGQVIDGIEVIKRV 153



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 23/42 (54%), Positives = 29/42 (69%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG 214
           P+VF D  +     G+++ EL +DVTPKT ENFR LCTGE G
Sbjct: 5   PQVFLDFQIGTQAAGRVIFELFNDVTPKTAENFRGLCTGEYG 46


>UniRef50_Q9Y3C6 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           1; n=37; cellular organisms|Rep: Peptidyl-prolyl
           cis-trans isomerase-like 1 - Homo sapiens (Human)
          Length = 166

 Score =  106 bits (254), Expect = 6e-22
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           G  F      FM+QGGD T   G GG SIYG +FEDE +  LK TG G+L+MANAG DTN
Sbjct: 50  GTKFHRIIKDFMIQGGDPTG-TGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTN 108

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
           GSQFF+T   T WLDG+H +FG V +G+ +V ++
Sbjct: 109 GSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRV 142



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 24/61 (39%), Positives = 33/61 (54%)
 Frame = +2

Query: 119 DAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITAL 298
           +  +G IV+EL     PKTC+NF  L    +G+ Y G+ FHR+I      +G  PT T  
Sbjct: 17  ETSMGIIVLELYWKHAPKTCKNFAEL--ARRGY-YNGTKFHRIIK-DFMIQGGDPTGTGR 72

Query: 299 G 301
           G
Sbjct: 73  G 73


>UniRef50_A5BS03 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Vitis vinifera|Rep: Peptidyl-prolyl cis-trans isomerase
           - Vitis vinifera (Grape)
          Length = 345

 Score =  105 bits (252), Expect = 1e-21
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 2/94 (2%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G+ F      FM+QGGD +  NGTGG+SIYG KFEDENF LKH   G+LSMAN+GA
Sbjct: 54  LHYKGVCFHRVIRGFMIQGGDISAGNGTGGESIYGLKFEDENFELKHERKGMLSMANSGA 113

Query: 394 DTNGSQFFITTVKTSWLDGRHVV--FGNVVEGME 489
           +TNGSQFFITT +TS LD   ++   G + EG++
Sbjct: 114 NTNGSQFFITTTRTSHLDVNVLIADCGEIPEGVD 147



 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 8/65 (12%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSI 235
           M  PR + D+++ +   G++V+EL +D+ P+T ENFRALCTGEKG G        YKG  
Sbjct: 1   MGRPRCYLDISIGEELEGRVVVELYNDIVPRTAENFRALCTGEKGIGPNTGVPLHYKGVC 60

Query: 236 FHRVI 250
           FHRVI
Sbjct: 61  FHRVI 65


>UniRef50_Q6CGQ3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Yarrowia lipolytica|Rep: Peptidyl-prolyl cis-trans
           isomerase - Yarrowia lipolytica (Candida lipolytica)
          Length = 385

 Score =  105 bits (252), Expect = 1e-21
 Identities = 49/92 (53%), Positives = 63/92 (68%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           +F +QGGD    +GTGG SIYG++F+DENF   H  P VLSMANAG ++N SQFF+T   
Sbjct: 64  NFAIQGGDIVYGDGTGGTSIYGDQFDDENFVHNHAEPFVLSMANAGPNSNKSQFFVTLKG 123

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAATLG 528
           +  LDG+HV FG VV G  V++Q+E L    G
Sbjct: 124 SPHLDGKHVAFGKVVAGKSVLRQLEELDTAPG 155



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 20/39 (51%), Positives = 25/39 (64%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEK 211
           V+ D  V   P+G++V EL  D TP T  NFRALC G+K
Sbjct: 5   VYMDFAVGGEPVGRVVFELFDD-TPLTSANFRALCKGDK 42


>UniRef50_A5DY13 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Saccharomycetales|Rep: Peptidyl-prolyl cis-trans
           isomerase - Lodderomyces elongisporus (Yeast)
           (Saccharomyces elongisporus)
          Length = 276

 Score =  104 bits (250), Expect = 2e-21
 Identities = 52/95 (54%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFI-TTVK 432
           FM+QGG   N++G GGKSIYG  F DENF LKH   G LSMANAG +TNG QFFI  T K
Sbjct: 102 FMIQGG---NYDGQGGKSIYGGSFNDENFDLKHDKLGRLSMANAGQNTNGGQFFILDTEK 158

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPL 537
           T  LDG+HVVFG +++G + + +I +      RP+
Sbjct: 159 TPHLDGKHVVFGQLIDGFDTLDKISSTDVVDSRPV 193



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +2

Query: 92  RVFFDVTVDDAP---LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           ++ F ++   +P   LGK+ + L  +  P T +NF  L    +G+GY+   FHR+I
Sbjct: 44  KITFTISQGKSPAKKLGKLTLALFGETVPITVDNFYQLSAMTRGYGYQDCEFHRII 99


>UniRef50_Q5KKX7 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           1; n=19; Eukaryota|Rep: Peptidyl-prolyl cis-trans
           isomerase-like 1 - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 174

 Score =  103 bits (248), Expect = 3e-21
 Identities = 53/114 (46%), Positives = 74/114 (64%), Gaps = 2/114 (1%)
 Frame = +1

Query: 208 ERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMAN 384
           ER    G+ F    P+FM+QGGD T   G GG SIYG++F DE +  L+  G G+L+MAN
Sbjct: 39  ERGYYNGVIFHRIIPNFMIQGGDPTG-TGRGGTSIYGDRFADEIHPELRFVGAGILAMAN 97

Query: 385 AGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL-GRPLRE 543
           +G +TNGSQFFIT   T +LDG+H +FG V  GM+ ++++E +      RP+ E
Sbjct: 98  SGPNTNGSQFFITCAPTPYLDGKHTIFGRVSSGMKTIQRLEAVRTDKDDRPVEE 151



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 26/61 (42%), Positives = 34/61 (55%)
 Frame = +2

Query: 119 DAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITAL 298
           D  +G   +EL +   PKTC NF  L   E+G+ Y G IFHR+IP +   +G  PT T  
Sbjct: 12  DTSVGSFTVELYTAHAPKTCNNFAKL--AERGY-YNGVIFHRIIP-NFMIQGGDPTGTGR 67

Query: 299 G 301
           G
Sbjct: 68  G 68


>UniRef50_A7P5P2 Cluster: Chromosome chr4 scaffold_6, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr4 scaffold_6, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 758

 Score =  103 bits (246), Expect = 6e-21
 Identities = 52/107 (48%), Positives = 69/107 (64%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F       M+QGGDF   +G+GG+SIYG KF DE+  LKH GPG+LSM+ A  
Sbjct: 57  LHYKGSFFHRIIKGSMVQGGDFLRRDGSGGESIYGGKFPDESPRLKHDGPGLLSMSVADR 116

Query: 394 DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           DT GSQF +T      LD ++VVFG +V+G EV+K+IE++    G P
Sbjct: 117 DTVGSQFIVTFSANHHLDRKYVVFGKLVQGHEVLKRIESVGDEEGIP 163



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 39/74 (52%), Positives = 47/74 (63%), Gaps = 8/74 (10%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGS 232
           K   P V+ DV++D  P+ ++V EL SDV PKT ENFRALCTGEKG G        YKGS
Sbjct: 3   KKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGS 62

Query: 233 IFHRVIPISCCKEG 274
            FHR+I  S  + G
Sbjct: 63  FFHRIIKGSMVQGG 76


>UniRef50_Q7Q137 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Anopheles gambiae str. PEST|Rep: Peptidyl-prolyl
           cis-trans isomerase - Anopheles gambiae str. PEST
          Length = 300

 Score =  103 bits (246), Expect = 6e-21
 Identities = 44/95 (46%), Positives = 62/95 (65%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGD  + +G G  S+YG  F+DEN  + HT  G ++MAN G +TN
Sbjct: 183 KGSRFHRVIQKFMIQGGDVVSGDGHGAISMYGKYFDDENLKINHTCSGFIAMANRGPNTN 242

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           G QF+ITT+   WLDG+H +FG V++G  VV ++E
Sbjct: 243 GCQFYITTLPAPWLDGKHTIFGKVLDGQAVVHKVE 277



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 27/54 (50%), Positives = 36/54 (66%), Gaps = 1/54 (1%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE-KGFGYKGSIFHRVI 250
           +V+ DV++D   +G+I I +  +  PKT  NFR LCT +  GF YKGS FHRVI
Sbjct: 138 QVYMDVSIDGEKIGRITIGMFGEEAPKTVANFRQLCTKDVDGFSYKGSRFHRVI 191


>UniRef50_Q7RHT4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=6;
           Plasmodium|Rep: Peptidyl-prolyl cis-trans isomerase -
           Plasmodium yoelii yoelii
          Length = 765

 Score =  102 bits (244), Expect = 1e-20
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGADTNGSQFFITTV 429
           HFM+Q GD    +GTGG+SI+G++FEDE F  L H+ P ++SMAN G +TNGSQFFITTV
Sbjct: 658 HFMIQTGD-PGGDGTGGESIWGSEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTV 716

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIE 507
              WLD +H VFG V +G +VV  IE
Sbjct: 717 PCPWLDFKHTVFGKVTQGTKVVLDIE 742


>UniRef50_UPI000065E7F5 Cluster: Peptidyl-prolyl cis-trans
           isomerase, mitochondrial precursor (EC 5.2.1.8) (PPIase)
           (Rotamase) (Cyclophilin F).; n=1; Takifugu rubripes|Rep:
           Peptidyl-prolyl cis-trans isomerase, mitochondrial
           precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin
           F). - Takifugu rubripes
          Length = 121

 Score =  101 bits (242), Expect = 2e-20
 Identities = 44/68 (64%), Positives = 51/68 (75%)
 Frame = +2

Query: 68  NTGKMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRV 247
           + G    P VF DV  DD PLG+I+IEL +DV PKT ENFRALCTG+ GFGYKGS+FHRV
Sbjct: 22  SVGSTENPTVFLDVEADDEPLGRIIIELNADVVPKTAENFRALCTGQYGFGYKGSVFHRV 81

Query: 248 IPISCCKE 271
           IP   C+E
Sbjct: 82  IPEFMCQE 89


>UniRef50_Q6CBT5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Yarrowia lipolytica|Rep: Peptidyl-prolyl cis-trans
           isomerase - Yarrowia lipolytica (Candida lipolytica)
          Length = 638

 Score =  101 bits (241), Expect = 2e-20
 Identities = 51/85 (60%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD  + +GTGG+SI+G  FEDE +    H  P  LSMANAG +TNGSQFFITT  
Sbjct: 533 FMIQGGD-PDGDGTGGQSIWGKNFEDEFSKEYTHDQPFTLSMANAGKNTNGSQFFITTEP 591

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIE 507
           T WLD +H VFG V  G  VVK IE
Sbjct: 592 TPWLDNKHTVFGRVTGGKSVVKDIE 616



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 19/41 (46%), Positives = 22/41 (53%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           LG I + L     PK C NF  LC    G+ Y  +IFHRVI
Sbjct: 493 LGDITVTLFPQAAPKACANFSELC--RIGY-YDSTIFHRVI 530


>UniRef50_Q7M8J1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Epsilonproteobacteria|Rep: Peptidyl-prolyl cis-trans
           isomerase - Wolinella succinogenes
          Length = 181

 Score =  100 bits (240), Expect = 3e-20
 Identities = 54/108 (50%), Positives = 70/108 (64%), Gaps = 2/108 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           GL F      FMLQGGD T   GTGG+SI+G  FEDE          G+L+MAN+G ++N
Sbjct: 66  GLIFHRVIKRFMLQGGDPTG-TGTGGESIWGKPFEDEIALGYAFDREGLLAMANSGPNSN 124

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE-TLAATLGRPLRE 543
           GSQFFITT +T WL+G+H +FG V +G +VV++IE T      RP +E
Sbjct: 125 GSQFFITTARTPWLNGKHTIFGEVSKGFDVVRRIEYTETDRSDRPKKE 172


>UniRef50_UPI00005A1932 Cluster: PREDICTED: similar to
           peptidylprolyl isomerase A isoform 1; n=1; Canis lupus
           familiaris|Rep: PREDICTED: similar to peptidylprolyl
           isomerase A isoform 1 - Canis familiaris
          Length = 227

 Score =  100 bits (239), Expect = 4e-20
 Identities = 45/65 (69%), Positives = 51/65 (78%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P FM QGGDFT H+GTG K+IYG KF+DENFTLK  GPG+LSMANAG +TN
Sbjct: 156 KGSCFHRIIPGFMCQGGDFTRHDGTGDKTIYGEKFDDENFTLKPAGPGILSMANAGPNTN 215

Query: 403 GSQFF 417
           GSQFF
Sbjct: 216 GSQFF 220



 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P VFFD+ VD  PL ++  EL +D  PKT ENF AL TGEKGFGYKGS FHR+IP   C+
Sbjct: 111 PTVFFDIPVDSEPLSRVSFELFADQVPKTAENFHALSTGEKGFGYKGSCFHRIIPGFMCQ 170

Query: 269 EG 274
            G
Sbjct: 171 GG 172


>UniRef50_Q6BSZ1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Debaryomyces hansenii|Rep: Peptidyl-prolyl cis-trans
           isomerase - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 636

 Score =   99 bits (238), Expect = 5e-20
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD    NGTGG+S +G   +DE N  L+H+ P ++SMAN+G +TNGSQFFITT K
Sbjct: 530 FMIQAGDPLG-NGTGGESYWGGYIKDEFNSLLRHSKPFMVSMANSGPNTNGSQFFITTEK 588

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETL 513
             WLD +H +FG V +G E VK IE +
Sbjct: 589 APWLDNKHTIFGEVTDGFEAVKSIEDI 615



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 22/41 (53%), Positives = 29/41 (70%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           LG I ++L +++ PKT ENF  LC  EKG+ Y  +IFHRVI
Sbjct: 490 LGDIKLKLFNELVPKTTENFIKLC--EKGY-YNSTIFHRVI 527


>UniRef50_Q8IXY8 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           6; n=20; Euteleostomi|Rep: Peptidyl-prolyl cis-trans
           isomerase-like 6 - Homo sapiens (Human)
          Length = 311

 Score = 99.5 bits (237), Expect = 7e-20
 Identities = 46/92 (50%), Positives = 60/92 (65%)
 Frame = +1

Query: 262 LQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSW 441
           +QGGD     G  G+SIYG  FEDENF++ H   GVL MAN G  +NGSQF+IT   T +
Sbjct: 207 IQGGDIVYGKGDNGESIYGPTFEDENFSVPHNKRGVLGMANKGRHSNGSQFYITLQATPY 266

Query: 442 LDGRHVVFGNVVEGMEVVKQIETLAATLGRPL 537
           LD + V FG ++EG EV+KQ+E +     RP+
Sbjct: 267 LDRKFVAFGQLIEGTEVLKQLELVPTQNERPI 298



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 7/59 (11%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHRVI 250
           VF D+ +D +P+G+++ EL  DV PKTC+NF+ LCTG+ GF        YK SIFHR++
Sbjct: 144 VFLDICIDSSPIGRLIFELYCDVCPKTCKNFQVLCTGKAGFSQRGIRLHYKNSIFHRIV 202


>UniRef50_Q6BUC1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Debaryomyces hansenii|Rep: Peptidyl-prolyl cis-trans
           isomerase - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 285

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 46/83 (55%), Positives = 57/83 (68%), Gaps = 3/83 (3%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNK--FEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           FM+Q GD+    G GG S+Y NK  F DENF LKH   G +SMAN G +TNG QFFITT 
Sbjct: 111 FMIQTGDYQFGEGYGGHSVYNNKGRFRDENFKLKHNKQGRMSMANGGPNTNGGQFFITTK 170

Query: 430 -KTSWLDGRHVVFGNVVEGMEVV 495
            + SWLDG+HVVFG ++ G + +
Sbjct: 171 DECSWLDGKHVVFGQIINGFDTL 193


>UniRef50_UPI0000DA3F53 Cluster: PREDICTED: similar to
           peptidylprolyl isomerase D; n=1; Rattus norvegicus|Rep:
           PREDICTED: similar to peptidylprolyl isomerase D -
           Rattus norvegicus
          Length = 223

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 49/94 (52%), Positives = 65/94 (69%)
 Frame = +1

Query: 259 MLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTS 438
           M+QGGDF+N NGTGG+S+YG KFEDENF   H        ANAG +TNGSQF ITTV T 
Sbjct: 102 MIQGGDFSNQNGTGGESMYGEKFEDENF---H--------ANAGPNTNGSQFLITTVPTP 150

Query: 439 WLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLR 540
            +DG+ V+FG V++G+ V + +E +    G P++
Sbjct: 151 HVDGKRVLFGQVIKGLGVARMLENVEVN-GEPVK 183



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 28/51 (54%), Positives = 37/51 (72%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRV 247
           VFFDV +    +G+IV+EL +D+ PKT ENF ALCTGEK  G + + FHR+
Sbjct: 48  VFFDVDIVGEQVGQIVLELFADIVPKTAENFHALCTGEKDTGTEPNPFHRI 98


>UniRef50_UPI0000447DE0 Cluster: PREDICTED: similar to novel
           cyclophilin protein; n=1; Gallus gallus|Rep: PREDICTED:
           similar to novel cyclophilin protein - Gallus gallus
          Length = 231

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 46/91 (50%), Positives = 61/91 (67%)
 Frame = +1

Query: 262 LQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSW 441
           +QGGD T   G GG+SIYG  FEDEN+ + H G GVL MAN G  +NGSQF+IT     +
Sbjct: 128 IQGGDITG-KGDGGESIYGPTFEDENYAIPHKGRGVLGMANKGRHSNGSQFYITLQPVPY 186

Query: 442 LDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           LD + V FG ++EG EV++++ET+     RP
Sbjct: 187 LDKKCVAFGQLIEGTEVLQRLETVPTHNERP 217



 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 7/59 (11%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTG-------EKGFGYKGSIFHRVI 250
           V+ D+ +++ P+G ++ EL SDV PKTCENFRALC G        +   YK S FHR++
Sbjct: 65  VYLDIAIEEQPIGTLLFELFSDVCPKTCENFRALCEGGVMSPSSGQELTYKNSCFHRLV 123


>UniRef50_Q7QKK5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Culicidae|Rep: Peptidyl-prolyl cis-trans isomerase -
           Anopheles gambiae str. PEST
          Length = 382

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 55/110 (50%), Positives = 68/110 (61%), Gaps = 1/110 (0%)
 Frame = +1

Query: 211 RLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG 390
           RL  +G  F      FM QGGD  + NGTGG+SIYG  FEDENFTL H   G +SMAN G
Sbjct: 69  RLHYKGSPFHRVKSLFMSQGGDIVHFNGTGGESIYGKTFEDENFTLLHE-DGAVSMANLG 127

Query: 391 -ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPL 537
            A TN SQFFIT+ +   L+G +VV G V+ G  +V ++E  +   G PL
Sbjct: 128 KAHTNNSQFFITSGECPHLNGTNVVVGYVIRGGGIVGEMERHSNDDGDPL 177



 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 35/61 (57%), Positives = 42/61 (68%), Gaps = 8/61 (13%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHR 244
           P V+ DV V +  +G+IVIELR+DV P+T ENFRALCTGE+G          YKGS FHR
Sbjct: 20  PLVYLDVKVGEESVGRIVIELRADVVPRTAENFRALCTGERGIAPDTGTRLHYKGSPFHR 79

Query: 245 V 247
           V
Sbjct: 80  V 80


>UniRef50_A3LNY3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Pichia stipitis|Rep: Peptidyl-prolyl cis-trans isomerase
           - Pichia stipitis (Yeast)
          Length = 261

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 50/98 (51%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGN-KFEDENFTLKHTGPGVLSMANAGADTNGSQFFIT-T 426
           +FM+QGGDF   +G GG SI+   KF+DENF + H   G +SMANAG DTNGSQFFIT T
Sbjct: 107 NFMIQGGDFQFGDGRGGHSIFEKGKFKDENFEINHNKKGRVSMANAGKDTNGSQFFITNT 166

Query: 427 VKTSWLDGRHVVFGNVVEGMEVVKQIETLAAT-LGRPL 537
              ++LDG+HVVFG V+ G + +  +  +      RPL
Sbjct: 167 DDCTFLDGKHVVFGQVIGGFDTLAAVSAVKTNDKNRPL 204



 Score = 36.7 bits (81), Expect = 0.56
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +2

Query: 116 DDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           D   LG+I + +     PKT  NF  L     G+GY+  +FHR+I
Sbjct: 61  DSKILGEITMGMFGKTVPKTVFNFVKLANMTHGYGYERVLFHRII 105


>UniRef50_A3GI64 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Pichia stipitis|Rep: Peptidyl-prolyl cis-trans isomerase
           - Pichia stipitis (Yeast)
          Length = 571

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 48/87 (55%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD    +GTGG+S +G+ FEDE N  L H+ P ++SMANAG +TNGSQFFITT K
Sbjct: 465 FMIQTGDPLG-DGTGGESAWGSHFEDEFNPNLSHSKPFMVSMANAGPNTNGSQFFITTEK 523

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETL 513
           T +LD +H +FG V  G +VV+ IE +
Sbjct: 524 TPFLDNKHTIFGEVYVGFDVVRSIEEM 550


>UniRef50_Q0UY21 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Pezizomycotina|Rep: Peptidyl-prolyl cis-trans isomerase
           - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 589

 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 49/94 (52%), Positives = 62/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD    +GTGG+SI+G +F DE +  ++H  P VLSMANAG  TN SQFFITT K
Sbjct: 485 FMIQTGDPLG-DGTGGESIWGKEFADEFSKEVRHDRPYVLSMANAGPGTNASQFFITTEK 543

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
             WLD +H +FG  V GM+VV +IE       +P
Sbjct: 544 APWLDDKHTIFGRAVAGMDVVHKIENAKVYKEKP 577


>UniRef50_P0C1J1 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           2; n=1; Rhizopus oryzae|Rep: Peptidyl-prolyl cis-trans
           isomerase-like 2 - Rhizopus oryzae (Rhizopus delemar)
          Length = 533

 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 54/104 (51%), Positives = 65/104 (62%), Gaps = 2/104 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD T   G GG+SI+   F DE   TLKH   GVLSMAN G DTNGSQFFIT   
Sbjct: 334 FMIQGGDPTG-TGKGGESIWKRYFPDEIKTTLKHDARGVLSMANRGKDTNGSQFFITYAA 392

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRESLSKTV 561
              LDG H VFG VV G++V+ ++E++      RP RE   K +
Sbjct: 393 APHLDGLHTVFGKVVGGLDVLSKLESIPVDEKDRPEREIKIKQI 436



 Score = 35.9 bits (79), Expect = 0.98
 Identities = 25/57 (43%), Positives = 29/57 (50%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I +EL SD  PKTC NF  L   + G+ Y   IFHR I      +G  PT T  G
Sbjct: 295 GNINVELFSDKKPKTCHNFIEL--AKTGY-YNDVIFHRNIK-KFMIQGGDPTGTGKG 347


>UniRef50_A7S5B9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 300

 Score = 95.9 bits (228), Expect = 9e-19
 Identities = 41/86 (47%), Positives = 57/86 (66%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P+  +QGGD     G GG+S+YG  FEDE+F++ H   GV+ MAN G  TNGSQF+IT  
Sbjct: 187 PNGWIQGGDIEGGRGIGGESVYGPLFEDEDFSVAHNRRGVVGMANKGRHTNGSQFYITLQ 246

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIE 507
              W+D ++V FG V+EG+ V+  +E
Sbjct: 247 PAPWMDTKYVAFGQVIEGLNVLDVLE 272



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 10/63 (15%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTG--EKG--------FGYKGSIFHR 244
           V+FD+ V    +G+++IEL SD  P+TC NF++L  G  E+           YK SI H 
Sbjct: 125 VYFDIAVGAKSIGRLIIELYSDRLPRTCGNFKSLIAGNLEESERHDPPLKLRYKDSILHG 184

Query: 245 VIP 253
           ++P
Sbjct: 185 IVP 187


>UniRef50_O74942 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Schizosaccharomyces pombe|Rep: Peptidyl-prolyl cis-trans
           isomerase - Schizosaccharomyces pombe (Fission yeast)
          Length = 610

 Score = 95.9 bits (228), Expect = 9e-19
 Identities = 47/86 (54%), Positives = 61/86 (70%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           +FM+QGGD    +GTGG+SI+   FEDE +  LKH  P  +SMAN+G +TNGSQFFITT 
Sbjct: 502 NFMIQGGDPLG-DGTGGESIWKKDFEDEISPNLKHDRPFTVSMANSGPNTNGSQFFITTD 560

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIE 507
            T WLDG+H +F     G++VV +IE
Sbjct: 561 LTPWLDGKHTIFARAYAGLDVVHRIE 586


>UniRef50_Q8SQZ8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Encephalitozoon cuniculi|Rep: Peptidyl-prolyl cis-trans
           isomerase - Encephalitozoon cuniculi
          Length = 200

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNK-FEDENFTLKHTGPGVLSMANAGADTNGSQFFITT 426
           P FM+QGGD    NG+G  SIY  + F DENF + H   G LSMAN G  TNGSQFFIT 
Sbjct: 84  PGFMMQGGDVVMGNGSGSISIYNAEPFSDENFEIAHDSIGKLSMANRGPHTNGSQFFITF 143

Query: 427 VKTSWLDGRHVVFGNVV-EGMEVVKQIETLAATLGRPL 537
            K   LDG+HVVFGNV  E + +++ I+ +     RP+
Sbjct: 144 DKQHHLDGKHVVFGNVSGECLSLIRDIQKIDIDRDRPV 181



 Score = 39.5 bits (88), Expect = 0.080
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 4/45 (8%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENF----RALCTGEKGFGYKGSIFHRVIP 253
           G+I  EL  D+TPKT  NF    +    G K + Y+  +FHR+IP
Sbjct: 40  GRITFELYWDITPKTARNFYEFVKGTEIGGKYYKYENGLFHRIIP 84


>UniRef50_Q6CU04 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Kluyveromyces lactis|Rep: Peptidyl-prolyl cis-trans
           isomerase - Kluyveromyces lactis (Yeast) (Candida
           sphaerica)
          Length = 306

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 48/82 (58%), Positives = 57/82 (69%), Gaps = 2/82 (2%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P FM+QGG+   H   G  SIYG  F+DENF LKH  PG LSMAN+G +TN  QFFITT 
Sbjct: 106 PGFMIQGGNVLPH--VGPFSIYGYAFDDENFNLKHDRPGRLSMANSGPNTNACQFFITTS 163

Query: 430 KT--SWLDGRHVVFGNVVEGME 489
           +T    LDG+HVVFG V+ G+E
Sbjct: 164 ETPLEHLDGKHVVFGQVISGLE 185



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 20/45 (44%), Positives = 22/45 (48%), Gaps = 8/45 (17%)
 Frame = +2

Query: 143 IELRSDVTPKTCENFRALCTGEKG--------FGYKGSIFHRVIP 253
           IEL   V P T  NF  L  G KG          YK +IFHR+IP
Sbjct: 62  IELYGTVVPLTVNNFNELARGVKGQLGDKIIDISYKKTIFHRIIP 106


>UniRef50_A1AVY1 Cluster: Peptidylprolyl isomerase precursor; n=1;
           Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)|Rep: Peptidylprolyl isomerase precursor -
           Ruthia magnifica subsp. Calyptogena magnifica
          Length = 333

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 52/95 (54%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           GL F     +F++QGGD    NGTGG    G +F DE    LKH   G+LSMAN+G +TN
Sbjct: 73  GLKFHRVIDNFIVQGGD-PKGNGTGGP---GYQFIDEITDDLKHDDGGILSMANSGPNTN 128

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           GSQFFIT     WLDG+H VFG VVEGM VV +I+
Sbjct: 129 GSQFFITYKAAPWLDGKHTVFGRVVEGMNVVNRIK 163


>UniRef50_Q9NJS4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Schistosoma mansoni|Rep: Peptidyl-prolyl cis-trans
           isomerase - Schistosoma mansoni (Blood fluke)
          Length = 181

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 43/102 (42%), Positives = 62/102 (60%)
 Frame = +1

Query: 211 RLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG 390
           ++  +G  F     +  +QGGD   + G  G+SIYG  FEDE F +KH   G+LSMAN+G
Sbjct: 74  KMNYKGTKFFRLVKNGWIQGGDILYNRGDDGRSIYGPVFEDEXFIIKHDRRGILSMANSG 133

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLA 516
             TNGSQF IT     W+D  +V FG+V+EG   + ++E ++
Sbjct: 134 RHTNGSQFLITLAPAEWMDNHYVAFGSVIEGSLTLDKMEEVS 175



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSI 235
           V   ++VD    G +++EL SD+ P+TCENFR+LCTGE G   K  +
Sbjct: 24  VSMHISVDGEKCGILLLELYSDIVPRTCENFRSLCTGEYGVIKKNEV 70


>UniRef50_A0DTP4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=4;
           cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase - Paramecium tetraurelia
          Length = 637

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 51/108 (47%), Positives = 66/108 (61%), Gaps = 2/108 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           GL F      FM+Q G     NGTGG+SI+G +F+DE +  L+H  P  +SMANAG +TN
Sbjct: 522 GLIFHRVQQGFMIQTG-CPKGNGTGGESIWGGEFQDEFHPELRHDKPFTVSMANAGPNTN 580

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI-ETLAATLGRPLRE 543
            SQFFIT   T WLD +H +FG V +GM +V QI E       +PL +
Sbjct: 581 TSQFFITVCPTPWLDDKHTIFGRVYKGMNIVVQISEVETDDFDKPLND 628



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 19/39 (48%), Positives = 24/39 (61%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRV 247
           G+I I L  + TPKT ENF  +   + G+ Y G IFHRV
Sbjct: 493 GEIYINLFPNETPKTVENF--IQHSKNGY-YDGLIFHRV 528


>UniRef50_Q4N6R7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Theileria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Theileria parva
          Length = 217

 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 40/73 (54%), Positives = 55/73 (75%)
 Frame = +1

Query: 262 LQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSW 441
           LQGGDF   +GTG  SIYG+ F+DENF++KH   G++SM+N G +TNG QFF  T +  W
Sbjct: 112 LQGGDFAKGDGTGCISIYGSCFDDENFSVKHDKLGIISMSNTGPNTNGCQFFFITKECDW 171

Query: 442 LDGRHVVFGNVVE 480
           LDG++V FG++V+
Sbjct: 172 LDGKNVAFGSLVD 184



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 5/59 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEK-----GFGYKGSIFHRVI 250
           P VF D+++    LG++ IEL +D  PKTCENFR  CTGE        GYKG+ F +VI
Sbjct: 26  PVVFMDISLGSQYLGRLKIELFADKVPKTCENFRKFCTGEHKQNMVPVGYKGTKFSKVI 84


>UniRef50_Q9U1Q3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Caenorhabditis|Rep: Peptidyl-prolyl cis-trans isomerase
           - Caenorhabditis elegans
          Length = 629

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 55/112 (49%), Positives = 71/112 (63%), Gaps = 4/112 (3%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGA-DT 399
           GL F      FM+Q GD  +  GTGG+SI+G  FEDE +  L+H  P  +SMANAG  +T
Sbjct: 512 GLTFHRVIKSFMIQTGD-PSGKGTGGESIWGEDFEDEFHPRLRHDKPFKVSMANAGGGNT 570

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAA--TLGRPLRESL 549
           NGSQFFIT     WLDG++ +FG V  GM VV++I  ++     GRP RES+
Sbjct: 571 NGSQFFITVCPADWLDGKNTLFGEVTAGMSVVQRINQVSTFERSGRP-RESI 621



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 20/40 (50%), Positives = 21/40 (52%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           G I I L  D  PKT ENF   CT  +   Y G  FHRVI
Sbjct: 483 GDITIRLFGDECPKTVENF---CTHSRRGYYNGLTFHRVI 519


>UniRef50_UPI0001552A97 Cluster: PREDICTED: similar to
           Peptidylprolyl isomerase D (cyclophilin D); n=2; Mus
           musculus|Rep: PREDICTED: similar to Peptidylprolyl
           isomerase D (cyclophilin D) - Mus musculus
          Length = 358

 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 48/105 (45%), Positives = 65/105 (61%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      F++ GGDF+N      K+I+G K ED++F  K    G+LSMANA  D N
Sbjct: 147 KGCPFHGIIKKFIIHGGDFSNQ-----KNIFGEKLEDKHFHYKPDQEGLLSMANADPDEN 201

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPL 537
           GSQ+FITTV T   DG+HVVFG V++G+ V + +E + A  G  L
Sbjct: 202 GSQYFITTVLTPHSDGKHVVFGQVIKGLGVARVLENVEAPAGATL 246


>UniRef50_A6SGG7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Botryotinia fuckeliana B05.10
          Length = 753

 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 50/115 (43%), Positives = 72/115 (62%), Gaps = 2/115 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           G+ F     +FM+QGGD T  +G GG SI+G  F+DE +  L H   GV+SMAN G +TN
Sbjct: 541 GVSFHRNIRNFMIQGGDPTG-SGKGGSSIWGKNFQDEFDGPLTHDSRGVMSMANKGKNTN 599

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRESLSKTVV 564
            SQFFIT  +   LD +H +FG VV GM+V+ ++E +      RP+++ + + VV
Sbjct: 600 SSQFFITYKEAKHLDRKHTIFGRVVGGMDVLSKLEKVEVDDKSRPIKDIVMENVV 654


>UniRef50_A2Y8V7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Oryza sativa subsp. indica (Rice)
          Length = 160

 Score = 93.1 bits (221), Expect = 6e-18
 Identities = 51/98 (52%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD T   G GG SI+G KF DE   +LKH   GV+SMAN+G +TNGSQFFIT  K
Sbjct: 49  FMIQGGDPTG-TGKGGTSIWGKKFADEFRESLKHNARGVMSMANSGPNTNGSQFFITYAK 107

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLRE 543
              L+G + VF  V+ G EV+  +E      G RPL E
Sbjct: 108 QPHLNGHYTVFAKVIHGFEVLDLMEKAQTGPGDRPLAE 145



 Score = 39.9 bits (89), Expect = 0.060
 Identities = 26/58 (44%), Positives = 31/58 (53%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           LG I  E+  D  P+T ENF ALC    G+ Y G+IFHR I      +G  PT T  G
Sbjct: 9   LGDIKCEVFCDQAPRTAENFLALCA--SGY-YDGTIFHRNIK-GFMIQGGDPTGTGKG 62


>UniRef50_Q23AP4 Cluster: Peptidyl-prolyl cis-trans isomerase,
           cyclophilin-type family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Peptidyl-prolyl cis-trans
           isomerase, cyclophilin-type family protein - Tetrahymena
           thermophila SB210
          Length = 554

 Score = 93.1 bits (221), Expect = 6e-18
 Identities = 46/96 (47%), Positives = 63/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           G+ F      FM+QGGD T   G GG+SI+G KFEDE +  ++H+ PG+LSMAN+G +TN
Sbjct: 349 GIKFHRLVKDFMIQGGDPTG-TGRGGESIFGYKFEDEFHAKIRHSKPGILSMANSGPNTN 407

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIET 510
            SQFFIT  + +WLD +H  FG V+     + +I T
Sbjct: 408 ASQFFITLGECAWLDEQHNAFGEVIGNQLTLHKINT 443



 Score = 38.3 bits (85), Expect = 0.18
 Identities = 23/58 (39%), Positives = 32/58 (55%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           +G+I   + ++  PKT ENF  LC  EKG+ Y G  FHR++      +G  PT T  G
Sbjct: 319 IGEIQCMIHANFVPKTSENFLELC--EKGY-YNGIKFHRLVK-DFMIQGGDPTGTGRG 372


>UniRef50_A7D6E7 Cluster: Peptidylprolyl isomerase; n=1; Halorubrum
           lacusprofundi ATCC 49239|Rep: Peptidylprolyl isomerase -
           Halorubrum lacusprofundi ATCC 49239
          Length = 234

 Score = 93.1 bits (221), Expect = 6e-18
 Identities = 47/84 (55%), Positives = 61/84 (72%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD    +G GG    G +F+DE +  L H GPG+LSMAN+G +TNGSQFFIT   
Sbjct: 131 FMIQGGD-PQESGRGGP---GYQFDDEFHDDLTHDGPGILSMANSGPNTNGSQFFITLDA 186

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQI 504
           T  LDG+H VFG V++GM+VV++I
Sbjct: 187 TPHLDGKHAVFGQVIDGMDVVEEI 210


>UniRef50_Q4IBK5 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           2; n=12; Pezizomycotina|Rep: Peptidyl-prolyl cis-trans
           isomerase-like 2 - Gibberella zeae (Fusarium
           graminearum)
          Length = 588

 Score = 93.1 bits (221), Expect = 6e-18
 Identities = 50/116 (43%), Positives = 71/116 (61%), Gaps = 2/116 (1%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADT 399
           +G+ F    P+FM+QGGD  + +G GG+S++G  F+DE +  + H G G LSMAN G +T
Sbjct: 360 KGVAFHRNIPNFMIQGGD-PSGSGRGGQSVWGKYFDDEFDGPMTHNGRGTLSMANKGKNT 418

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAAT-LGRPLRESLSKTVV 564
           N SQFF     T  LD +H VFG VVE + V+ ++E +      RPL + L K +V
Sbjct: 419 NSSQFFFAYKPTPHLDRKHTVFGKVVENINVLSKMENVPTDGSNRPLNKILIKDIV 474


>UniRef50_UPI00015B61FF Cluster: PREDICTED: similar to CG8336-PC;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG8336-PC - Nasonia vitripennis
          Length = 366

 Score = 92.7 bits (220), Expect = 8e-18
 Identities = 46/111 (41%), Positives = 67/111 (60%), Gaps = 1/111 (0%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG- 390
           L  +G +F    P  M+QGGD  N +G+ G+SIYG +FEDE+  L H   G+LSM N G 
Sbjct: 57  LHYKGSYFHKVVPLSMIQGGDIVNFDGSSGESIYGPRFEDEDLKLPHNEEGLLSMVNEGK 116

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRE 543
            +TN SQF IT      L+  +VVFG V++G+ +VK+ + L     +P+ +
Sbjct: 117 PNTNSSQFVITLAPCPQLNNTNVVFGKVIKGIGLVKEFKELPLDNDKPIEK 167



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 7/69 (10%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHRV 247
           P VF DV +    +G+IVIEL  D  PKT ENFRALCTGEKG G       YKGS FH+V
Sbjct: 8   PIVFLDVAIAGEKIGRIVIELYKDKVPKTVENFRALCTGEKGIGRNGKPLHYKGSYFHKV 67

Query: 248 IPISCCKEG 274
           +P+S  + G
Sbjct: 68  VPLSMIQGG 76


>UniRef50_UPI000038C9B9 Cluster: COG0652: Peptidyl-prolyl cis-trans
           isomerase (rotamase) - cyclophilin family; n=1; Nostoc
           punctiforme PCC 73102|Rep: COG0652: Peptidyl-prolyl
           cis-trans isomerase (rotamase) - cyclophilin family -
           Nostoc punctiforme PCC 73102
          Length = 189

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 54/120 (45%), Positives = 72/120 (60%), Gaps = 8/120 (6%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGD-------FTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMA 381
           G+ F    P FM+Q GD         +  GTGG    G +FEDE +  L+HTG G+LSMA
Sbjct: 68  GVRFHRVIPDFMIQCGDPLSRYLDTASRWGTGGP---GYQFEDEFHPELRHTGAGILSMA 124

Query: 382 NAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESLSKTV 561
           NAG  TNGSQ+FIT   T  LD +H VFG VV+G+++V +I  +  T  RP +E + + V
Sbjct: 125 NAGRGTNGSQWFITEAPTPHLDNKHSVFGEVVQGLDIVNKIANVPTTRDRPNQEVVLQKV 184



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 24/55 (43%), Positives = 28/55 (50%), Gaps = 13/55 (23%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALC----------TGEKGFG---YKGSIFHRVIP 253
           LG+IV+ L  + TP T +NF  L           TGE G G   Y G  FHRVIP
Sbjct: 22  LGEIVVRLEEERTPNTVKNFVGLATGTIDWKDPKTGESGKGTPAYDGVRFHRVIP 76


>UniRef50_Q8I621 Cluster: Peptidyl-prolyl cis-trans isomerase; n=6;
           Aconoidasida|Rep: Peptidyl-prolyl cis-trans isomerase -
           Plasmodium falciparum (isolate 3D7)
          Length = 226

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 44/97 (45%), Positives = 57/97 (58%), Gaps = 1/97 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG-ADTNGSQFFITTVK 432
           FM QGGDF   NG GG+SIYG  F +E F  KH+  G+LSM       TN SQFF+T   
Sbjct: 69  FMFQGGDFNFGNGYGGESIYGQYFRNEKFIYKHSKRGILSMCQTRIKHTNNSQFFVTFKS 128

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRE 543
             WLD RHVV G++  G + +  IE     +G+P ++
Sbjct: 129 CPWLDKRHVVLGHLEYGFDTLSFIEEQGTLIGKPKKQ 165



 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 28/61 (45%), Positives = 35/61 (57%), Gaps = 7/61 (11%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIFHRV 247
           PRVF D+ +     G+++ EL  D  P TCENFR LCTGE G G       YK S  HR+
Sbjct: 6   PRVFLDIAIGGRNAGRMIFELFMDKLPITCENFRCLCTGETGLGYYLKPRWYKNSPIHRI 65

Query: 248 I 250
           +
Sbjct: 66  V 66


>UniRef50_Q55F01 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase - Dictyostelium discoideum AX4
          Length = 635

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 49/85 (57%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD     G GG SI+  +FEDE N  L+H  P  LSMANAG +TNGSQFFITTV 
Sbjct: 518 FMIQTGD-PQGTGYGGDSIWKKEFEDEFNRNLRHDRPFTLSMANAGPNTNGSQFFITTVP 576

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIE 507
            + LD +H VFG V +G EVV  IE
Sbjct: 577 VTRLDNKHTVFGRVYKGTEVVTAIE 601



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 22/41 (53%), Positives = 22/41 (53%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           LG I I L  D  PKT ENF    T  K   Y G IFHRVI
Sbjct: 478 LGDIHIMLYPDECPKTVENF---TTHSKNNYYNGVIFHRVI 515


>UniRef50_A0DHQ7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Paramecium tetraurelia|Rep: Peptidyl-prolyl cis-trans
           isomerase - Paramecium tetraurelia
          Length = 186

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 44/108 (40%), Positives = 62/108 (57%)
 Frame = +1

Query: 211 RLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG 390
           +L  + + F   + +FM  GGD  N +GTG  SIYG  F+ E    KH   G++SM N G
Sbjct: 66  KLNFKDVPFHKVYSNFMALGGDILNKDGTGQCSIYGPTFKAEPKRFKHDQRGLISMFNDG 125

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
               GSQFF T    SW+DG H VFG +VE   ++ ++E +++T G P
Sbjct: 126 NGNIGSQFFFTFTDCSWVDGLHSVFGKIVEDYSILDELEKISSTNGAP 173



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 5/56 (8%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG-----FGYKGSIFHRV 247
           VF D+ +      +++I+L  D  PKTCENFRALCTGEK        +K   FH+V
Sbjct: 22  VFLDIKIGTEKPKRVIIKLFYDEMPKTCENFRALCTGEKSNPYVKLNFKDVPFHKV 77


>UniRef50_Q38FI6 Cluster: Cyclophilin type peptidyl-prolyl cis-trans
           isomerase, putative; n=4; Trypanosoma|Rep: Cyclophilin
           type peptidyl-prolyl cis-trans isomerase, putative -
           Trypanosoma brucei
          Length = 318

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 40/84 (47%), Positives = 53/84 (63%)
 Frame = +1

Query: 262 LQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSW 441
           + GGD +  NG GG SIYG  F +E++ + H   GVL M N G DTN S F+IT     W
Sbjct: 211 VMGGDISGGNGRGGYSIYGRYFPNESYAIPHDRVGVLGMCNDGGDTNASSFYITMKAMQW 270

Query: 442 LDGRHVVFGNVVEGMEVVKQIETL 513
           ++GR+V FG VV+G+EVV  I  +
Sbjct: 271 MNGRYVAFGRVVDGLEVVHAIHAV 294



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = +2

Query: 98  FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE 208
           + ++++ +   G++  EL S V P TC NF  LC G+
Sbjct: 144 WMEISIGEMVHGRVTFELYSRVVPHTCSNFWHLCKGD 180


>UniRef50_Q55JJ2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Filobasidiella neoformans|Rep: Peptidyl-prolyl cis-trans
           isomerase - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 526

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 48/89 (53%), Positives = 56/89 (62%), Gaps = 3/89 (3%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFT---LKHTGPGVLSMANAGADTNGSQFFITT 426
           FM+QGGDFT   G GG+SIYG  FEDE       +    G+L MAN G +TNGSQ+FIT 
Sbjct: 69  FMIQGGDFTKKTGAGGESIYGAPFEDERLNGEGCEVDTKGLLVMANRGPNTNGSQYFITL 128

Query: 427 VKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
                L G+HVVFG VV GME V+ I  L
Sbjct: 129 AAAPHLTGKHVVFGRVVFGMEHVETIGQL 157



 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 8/62 (12%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHR 244
           PRVFFD  V   PLG++V EL ++V PKT ENFRALCTGEKG          YK SI HR
Sbjct: 5   PRVFFDFAVAGQPLGRVVFELYANVVPKTAENFRALCTGEKGISPISSLPLHYKNSIVHR 64

Query: 245 VI 250
           VI
Sbjct: 65  VI 66


>UniRef50_A4RTS6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Ostreococcus lucimarinus CCE9901
          Length = 533

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 53/108 (49%), Positives = 63/108 (58%), Gaps = 3/108 (2%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE--NFTLKHTGPGVLSMANAGADT 399
           G+ F      FMLQGGD T   G GG  I+G KF DE      +H   GVLSMAN+G +T
Sbjct: 332 GVKFHRSIKRFMLQGGDPTG-TGRGGHCIWGEKFADEIKGNPHRHDERGVLSMANSGKNT 390

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLR 540
           NGSQFFIT      LD +H VFG VV GME + +IE +      RPL+
Sbjct: 391 NGSQFFITYNAAPHLDNKHTVFGRVVGGMETLARIEEVECDAADRPLK 438



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 28/57 (49%), Positives = 31/57 (54%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G + IEL  D TP+TCENF  L   EKGF Y G  FHR I      +G  PT T  G
Sbjct: 303 GDLNIELHCDKTPRTCENFITL--AEKGF-YDGVKFHRSIK-RFMLQGGDPTGTGRG 355


>UniRef50_A3U9L4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=9;
           Bacteria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Croceibacter atlanticus HTCC2559
          Length = 378

 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 50/100 (50%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENF-TLKHTGPGVLSMANAGADTN 402
           GL F      FM+QGGD     G GG    G KF DE   +L H   G+LSMAN+G +TN
Sbjct: 80  GLIFHRVIKDFMIQGGD-PEGTGRGGP---GYKFPDETTESLAHNDKGILSMANSGPNTN 135

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAAT 522
           GSQFF+T   T WLDGRH +FG V+ G EVV  I  +  T
Sbjct: 136 GSQFFVTLKATPWLDGRHTIFGKVMIGQEVVDTIGKVETT 175


>UniRef50_Q5ALM7 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 104

 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 44/71 (61%), Positives = 52/71 (73%)
 Frame = -1

Query: 533 GLPRVAAKVSICLTTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGPV 354
           G+P    ++SI LTTS PSTT PKTTCLPS+Q   TVVMKNW+PLV  PALA++  PG  
Sbjct: 31  GVPLEVPQLSIFLTTSNPSTTSPKTTCLPSNQGHGTVVMKNWDPLVFGPALAIDNKPGLS 90

Query: 353 CLRVKFSSSNL 321
           C  +KFSS NL
Sbjct: 91  CFLMKFSSLNL 101


>UniRef50_Q5KAW8 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           2; n=2; Filobasidiella neoformans|Rep: Peptidyl-prolyl
           cis-trans isomerase-like 2 - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 573

 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 51/103 (49%), Positives = 63/103 (61%), Gaps = 5/103 (4%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENF---TLKHTGPGVLSMANAGADTNGSQFFI 420
           P FM+QGGD T   G GG+S +G  F DE+      KH   GVLSMAN+G  TNGSQFF 
Sbjct: 360 PGFMVQGGDPTG-TGRGGESYWGEPFRDEHGEKGAYKHDSRGVLSMANSGPRTNGSQFFF 418

Query: 421 TTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG--RPLRE 543
           T   T  LDG+H VFG +V G E + +IE +    G  RP+R+
Sbjct: 419 TFRPTPHLDGKHTVFGKLVGGEETLDKIERVNVRPGGDRPVRD 461



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 22/57 (38%), Positives = 27/57 (47%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G + +EL  D  PKT  NF  L    K   Y   +FHR+IP     +G  PT T  G
Sbjct: 323 GPLNVELHGDRAPKTVYNFVQLAKAGK---YDNVVFHRLIP-GFMVQGGDPTGTGRG 375


>UniRef50_Q8BUY4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=30;
           Eumetazoa|Rep: Peptidyl-prolyl cis-trans isomerase - Mus
           musculus (Mouse)
          Length = 531

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 48/102 (47%), Positives = 65/102 (63%), Gaps = 3/102 (2%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           +F++QGGD T   GTGG+S +G  F+DE    L HTG GVLSMAN+G +TN SQFFIT  
Sbjct: 327 NFVIQGGDPTG-TGTGGESFWGKPFKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFITFR 385

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAA--TLGRPLRESL 549
             ++LD +H +FG VV G + +  +E + +     RP  E L
Sbjct: 386 SCAYLDKKHTIFGRVVGGFDTLTAMENVESDPKTDRPKEEVL 427



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 27/57 (47%), Positives = 35/57 (61%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G + +EL  D+TPKTCENF  LC  +K + Y G+IFHR I  +   +G  PT T  G
Sbjct: 289 GDLNLELHCDLTPKTCENFIKLC--KKQY-YDGTIFHRSIR-NFVIQGGDPTGTGTG 341


>UniRef50_Q26DW5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Flavobacteria bacterium BBFL7|Rep: Peptidyl-prolyl
           cis-trans isomerase - Flavobacteria bacterium BBFL7
          Length = 385

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 53/116 (45%), Positives = 71/116 (61%), Gaps = 4/116 (3%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENF-TLKHTGPGVLSMANAGADTN 402
           GL F      FM+QGGD+T   GTG  ++ G KF+ E   TL H   G+LSMANAG +TN
Sbjct: 82  GLLFHRVMKDFMIQGGDYT---GTGSGNV-GYKFDQEIVDTLNHNAKGILSMANAGPNTN 137

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL---AATLGRPLRESLSKTV 561
           G+QFFI   +T +L+G++ VFG VVEG+ V+  I  +   A    RP+ E   +TV
Sbjct: 138 GTQFFIMHKETPFLNGKYNVFGKVVEGLAVIDSIAAVPVNAQANNRPIDEVKMQTV 193


>UniRef50_A7AVW0 Cluster: Peptidyl-prolyl isomerase; n=1; Babesia
           bovis|Rep: Peptidyl-prolyl isomerase - Babesia bovis
          Length = 248

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 47/98 (47%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANA-GADTNGSQFFITT 426
           P FM QGG+F   N  GG+SIYG    DE+F   H+  GVL MA     ++NGSQF+IT 
Sbjct: 70  PGFMCQGGNFNTGNSYGGESIYGQYMADESFAYMHSKRGVLGMAKTRHKNSNGSQFYITF 129

Query: 427 VKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLR 540
              S LD + VVFG++  G EV+  IE   + LGRP R
Sbjct: 130 KPCSHLDNKMVVFGHLEYGQEVLDAIEEQGSMLGRPKR 167



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 36/81 (44%), Positives = 45/81 (55%), Gaps = 7/81 (8%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIF 238
           M  PRVF DV++     G++V EL  D  P TCENFRALCTGE G G       YK +  
Sbjct: 6   MPNPRVFLDVSIGGRNAGRMVFELFMDKLPYTCENFRALCTGETGLGYYLRPRWYKDTPI 65

Query: 239 HRVIPISCCKEGTSPTITALG 301
           HR++P   C+ G   T  + G
Sbjct: 66  HRIVPGFMCQGGNFNTGNSYG 86


>UniRef50_Q9H2H8 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           3; n=44; Eukaryota|Rep: Peptidyl-prolyl cis-trans
           isomerase-like 3 - Homo sapiens (Human)
          Length = 161

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 47/87 (54%), Positives = 60/87 (68%), Gaps = 1/87 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD T   G GG SI+G KFEDE +  LKH   GV+SMAN G +TNGSQFFIT  K
Sbjct: 49  FMVQTGDPTG-TGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGK 107

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETL 513
              LD ++ VFG V++G+E + ++E L
Sbjct: 108 QPHLDMKYTVFGKVIDGLETLDELEKL 134



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 27/58 (46%), Positives = 31/58 (53%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           +G I IE+  + TPKTCENF ALC       Y G IFHR I     + G  PT T  G
Sbjct: 9   VGDIKIEVFCERTPKTCENFLALCASNY---YNGCIFHRNIKGFMVQTG-DPTGTGRG 62


>UniRef50_P52017 Cluster: Peptidyl-prolyl cis-trans isomerase 10;
           n=21; Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase
           10 - Caenorhabditis elegans
          Length = 161

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 44/87 (50%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD T H+G GG+SI+G  FEDE  + LKH   G +SMAN G D+N SQFFIT  K
Sbjct: 49  FMVQTGDPT-HSGKGGESIWGGPFEDEFVSALKHDSRGCVSMANNGPDSNRSQFFITYAK 107

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETL 513
            + LD ++ +FG V++G + +++IET+
Sbjct: 108 QAHLDMKYTLFGKVIDGFDTLEEIETI 134



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 26/57 (45%), Positives = 29/57 (50%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I IEL  D  PK CENF ALC  +    Y G IFHR I     + G  PT +  G
Sbjct: 10  GDIKIELYVDDAPKACENFLALCASDY---YNGCIFHRNIKDFMVQTG-DPTHSGKG 62


>UniRef50_A7BSP0 Cluster: Peptidylprolyl isomerase domain and WD
           repeat-containing protein 1; n=1; Beggiatoa sp. PS|Rep:
           Peptidylprolyl isomerase domain and WD repeat-containing
           protein 1 - Beggiatoa sp. PS
          Length = 345

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 44/84 (52%), Positives = 57/84 (67%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKS-IYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD T   GTGG   ++ ++F  +   L+H  PG+LSMAN G +TNGSQFFIT   
Sbjct: 93  FMVQTGDPTG-TGTGGPGFVFADEFHPK---LQHNKPGILSMANRGPNTNGSQFFITLKP 148

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQI 504
           T WLD  H +FG VVEGM++V +I
Sbjct: 149 TEWLDNHHTIFGEVVEGMDIVAKI 172


>UniRef50_A4ASR7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Bacteria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Flavobacteriales bacterium HTCC2170
          Length = 386

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 49/110 (44%), Positives = 67/110 (60%), Gaps = 2/110 (1%)
 Frame = +1

Query: 199 HWRERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENF-TLKHTGPGVLS 375
           +++++    G+ F      FM+QGGD T    TG     G KF+DE   +LKH   G+LS
Sbjct: 71  NFKDKKYFDGVIFHRVMKDFMIQGGDPTGTGTTGP----GYKFKDEFVDSLKHDRAGLLS 126

Query: 376 MANAGA-DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAAT 522
           MAN G  +TNGSQFFIT   T WLDGRH +FG ++ GM+V+  I  +A +
Sbjct: 127 MANPGPPNTNGSQFFITHKATPWLDGRHTIFGELITGMDVLDSIANVATS 176


>UniRef50_A6G1Z4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Plesiocystis pacifica SIR-1|Rep: Peptidyl-prolyl
           cis-trans isomerase - Plesiocystis pacifica SIR-1
          Length = 191

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 55/118 (46%), Positives = 72/118 (61%), Gaps = 6/118 (5%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAG---- 390
           G+ F     +FM+QGGD T   GTG +   G  F+DE +   +H GPGVLSMANAG    
Sbjct: 73  GVIFHRVIANFMIQGGDRT---GTG-RGRPGYTFDDECSPEARHDGPGVLSMANAGRRGQ 128

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI-ETLAATLGRPLRESLSKTV 561
           + TNGSQFF+T   T  LDG+H VFG V+EGM +V+ I +T      RP+ E   +T+
Sbjct: 129 SGTNGSQFFVTLRATPHLDGKHTVFGRVIEGMAIVEAIGQTATGDRDRPVDEVRIETI 186


>UniRef50_Q13356 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           2; n=21; Bilateria|Rep: Peptidyl-prolyl cis-trans
           isomerase-like 2 - Homo sapiens (Human)
          Length = 520

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 43/88 (48%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           +F++QGGD T   GTGG+S +G  F+DE    L HTG G+LSMAN+G ++N SQFFIT  
Sbjct: 327 NFVIQGGDPTG-TGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFR 385

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETL 513
             ++LD +H +FG VV G +V+  +E +
Sbjct: 386 SCAYLDKKHTIFGRVVGGFDVLTAMENV 413



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 27/57 (47%), Positives = 33/57 (57%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G + +EL  D+TPKTCENF  LC   K   Y G+IFHR I  +   +G  PT T  G
Sbjct: 289 GDLNLELHCDLTPKTCENFIRLC---KKHYYDGTIFHRSIR-NFVIQGGDPTGTGTG 341


>UniRef50_Q4AGQ3 Cluster: Peptidylprolyl isomerase precursor; n=1;
           Chlorobium phaeobacteroides BS1|Rep: Peptidylprolyl
           isomerase precursor - Chlorobium phaeobacteroides BS1
          Length = 555

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 47/96 (48%), Positives = 64/96 (66%), Gaps = 2/96 (2%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q G   N NGTGG    G  F+DE +  L+H  PG+LSMAN+G +TNGSQ+FIT   
Sbjct: 77  FMIQDG-CPNGNGTGGP---GYTFDDEFHPDLRHDEPGILSMANSGPNTNGSQYFITVEP 132

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQI-ETLAATLGRPL 537
           T+WLD  H +FG +++GM+VV  I E   ++  +PL
Sbjct: 133 TAWLDDVHSIFGKIIDGMDVVYAISEVETSSSDKPL 168


>UniRef50_A5DNZ6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Pichia guilliermondii|Rep: Peptidyl-prolyl cis-trans
           isomerase - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 578

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD    +GTGG S +   F DE +  L H+ P ++SMANAG +TN SQFFITTV 
Sbjct: 472 FMIQTGD-PKGDGTGGDSSFRGDFNDEFHPDLSHSQPYMVSMANAGPNTNRSQFFITTVS 530

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIE 507
              LD +H VFG VVEG EVV+ IE
Sbjct: 531 APHLDNKHTVFGRVVEGKEVVQAIE 555


>UniRef50_Q5UXK8 Cluster: Peptidyl-prolyl cis-trans isomerase
           slr1251; n=5; Halobacteriaceae|Rep: Peptidyl-prolyl
           cis-trans isomerase slr1251 - Haloarcula marismortui
           (Halobacterium marismortui)
          Length = 209

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 50/105 (47%), Positives = 66/105 (62%), Gaps = 2/105 (1%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSI-YGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           +FM+Q GD T   G GG    + ++F DE   L H GPGVLSMAN+G +TNGSQFFIT  
Sbjct: 105 NFMIQMGDPTG-TGRGGPGYSFDDEFHDE---LSHDGPGVLSMANSGPNTNGSQFFITLD 160

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLRESLSKTV 561
               LDG+H VFG V++GM+VV+ I ++       P  E L ++V
Sbjct: 161 AQPHLDGKHAVFGKVIDGMDVVESIGSVDTDRNDAPTEEMLLESV 205


>UniRef50_Q9RXR9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Deinococcus|Rep: Peptidyl-prolyl cis-trans isomerase -
           Deinococcus radiodurans
          Length = 193

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 52/103 (50%), Positives = 61/103 (59%), Gaps = 2/103 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE--NFTLKHTGPGVLSMANAGADT 399
           G+ F      FM Q GD T   G GG    G KFEDE      +H+G GVLSMANAG  T
Sbjct: 81  GIKFHRVIDGFMAQTGDPTG-TGMGGP---GYKFEDEFAGNHHRHSGKGVLSMANAGPGT 136

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG 528
           NGSQFFIT   T  LD RH VFG VVEG++V+ +I  +   +G
Sbjct: 137 NGSQFFITFTATPHLDNRHTVFGKVVEGLDVLDRITRIQPGMG 179


>UniRef50_Q5WV81 Cluster: Peptidyl-prolyl cis-trans isomerase; n=4;
           Legionella pneumophila|Rep: Peptidyl-prolyl cis-trans
           isomerase - Legionella pneumophila (strain Lens)
          Length = 188

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 48/96 (50%), Positives = 58/96 (60%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNG 405
           GL+F      FM+QGGD    NGTGG    G  F++EN       PGVL+MANAG +TNG
Sbjct: 76  GLNFHRVIAGFMIQGGDPLG-NGTGGP---GYTFDNENTNASFNKPGVLAMANAGPNTNG 131

Query: 406 SQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           SQFFIT   T  L G + VFG V+ G EVV +I  +
Sbjct: 132 SQFFITVAPTPELQGNYNVFGQVISGQEVVDKISKM 167


>UniRef50_A3J1I4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Bacteria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Flavobacteria bacterium BAL38
          Length = 336

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 51/94 (54%), Positives = 60/94 (63%), Gaps = 1/94 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGADTN 402
           GL F      FM+QGG     +GTG     G KF+DE    LKH+  G+LSMANAG  TN
Sbjct: 78  GLKFHRVIADFMIQGG-CPKGDGTGDP---GYKFDDEFVADLKHSEKGILSMANAGPATN 133

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
           GSQFFIT   T  LDG+H VFG+VV G+EVV +I
Sbjct: 134 GSQFFITHRATPHLDGKHTVFGHVVSGIEVVDKI 167


>UniRef50_UPI0000F346D2 Cluster: UPI0000F346D2 related cluster; n=2;
           Bos taurus|Rep: UPI0000F346D2 UniRef100 entry - Bos
           Taurus
          Length = 236

 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 46/97 (47%), Positives = 60/97 (61%), Gaps = 2/97 (2%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLS--MANAGADTNGSQFFIT 423
           P F+  GGDFTNHNGTGGKSIYG KF+DENF LKHTGP +LS    + G+ TN S FF +
Sbjct: 129 PQFVCPGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPDILSDVAGSPGSWTNISFFFSS 188

Query: 424 TVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
              T +L   +   G + +   V+K  +   +  G+P
Sbjct: 189 C--TDYLKSYYKFQGKINKIYIVLKPAKAQGSKDGKP 223



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 26/67 (38%), Positives = 34/67 (50%), Gaps = 3/67 (4%)
 Frame = +2

Query: 83  SLPRVF---FDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           S PRV      + V   P  K  + +++       ENFR LCT EKGFG+  S FHR++P
Sbjct: 71  SSPRVHRPCLPIQVGQRPTSKHSLLMKAPFPFSAPENFRCLCTHEKGFGFSSS-FHRIVP 129

Query: 254 ISCCKEG 274
              C  G
Sbjct: 130 QFVCPGG 136


>UniRef50_Q2L6V8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Caenorhabditis elegans|Rep: Peptidyl-prolyl cis-trans
           isomerase - Caenorhabditis elegans
          Length = 174

 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 39/80 (48%), Positives = 48/80 (60%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKE 271
           +VF D+T D APLGK+V EL ++  PKTCENF  LCTG  GFGYK  +F+RVIP  C   
Sbjct: 4   KVFMDITADGAPLGKLVFELNTEKCPKTCENFVKLCTGPPGFGYKNCVFYRVIPTFCACS 63

Query: 272 GTSPTITALGESPSTAISLK 331
           G   T  A  +   +    K
Sbjct: 64  GDFETQNARRDGGKSTFGTK 83



 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 43/106 (40%), Positives = 60/106 (56%), Gaps = 4/106 (3%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGT--GGKSIYGNK-FEDENFTLKHTGPGVLSMANAG-ADTNGSQFF 417
           P F    GDF   N    GGKS +G K F+DENF + H   G+L M N G  +TN S+F+
Sbjct: 57  PTFCACSGDFETQNARRDGGKSTFGTKYFDDENFEILHDKKGILGMDNYGWENTNSSRFY 116

Query: 418 ITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESLSK 555
           +T  +T W++  HV FG +VEG +V+  IE L    G   ++  +K
Sbjct: 117 VTFRETPWMNRFHVAFGELVEGFDVLDAIENLGILEGNGPQQGRTK 162


>UniRef50_A7AUF8 Cluster: Peptidyl-prolyl cis-trans isomerase 4;
           n=1; Babesia bovis|Rep: Peptidyl-prolyl cis-trans
           isomerase 4 - Babesia bovis
          Length = 524

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 58/126 (46%), Positives = 72/126 (57%), Gaps = 16/126 (12%)
 Frame = +1

Query: 235 FPSCHPHFMLQGGDFTNHNGTGGKSIYGNK-------------FEDE-NFTLKHTGPGVL 372
           F  C P+FM+QGGD T   G+GG+S +  +             F+DE + TL H G GVL
Sbjct: 332 FHRCVPNFMIQGGDPTG-TGSGGESAFYTRAQKNNPNEVVPKYFKDEFDNTLFHVGAGVL 390

Query: 373 SMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLR-ES 546
           SMAN G  TNGSQFFIT      LD RH VFG VV G +++K+ E L      RPL+   
Sbjct: 391 SMANKGKHTNGSQFFITFNTCDHLDNRHTVFGKVVGGTDILKKWEKLKIDDDERPLKPPK 450

Query: 547 LSKTVV 564
           L KTV+
Sbjct: 451 LIKTVI 456



 Score = 39.9 bits (89), Expect = 0.060
 Identities = 24/57 (42%), Positives = 31/57 (54%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I + L SD  P TC+NF   C  E G+ Y  +IFHR +P +   +G  PT T  G
Sbjct: 300 GDINLMLHSDRVPMTCDNFLQHC--EDGY-YDNTIFHRCVP-NFMIQGGDPTGTGSG 352


>UniRef50_Q012P6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Ostreococcus|Rep: Peptidyl-prolyl cis-trans isomerase -
           Ostreococcus tauri
          Length = 265

 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 38/61 (62%), Positives = 45/61 (73%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKE 271
           + FFD+T+     G+IV+E+R DVTPKT ENFR LCTGE GFGYK S FHRVIP   C+ 
Sbjct: 184 KCFFDITIGGEAAGRIVMEIRGDVTPKTGENFRQLCTGEAGFGYKDSPFHRVIPGFMCQG 243

Query: 272 G 274
           G
Sbjct: 244 G 244



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/25 (80%), Positives = 22/25 (88%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNK 324
           P FM QGGDFTN +GTGGKSI+GNK
Sbjct: 237 PGFMCQGGDFTNRSGTGGKSIFGNK 261


>UniRef50_UPI0000E462A1 Cluster: PREDICTED: similar to LOC495937
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to LOC495937 protein -
           Strongylocentrotus purpuratus
          Length = 260

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 37/73 (50%), Positives = 47/73 (64%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P+  +QGGD     G GG+SI+G  FEDENF++KH   G+L M N G  TNGSQF+IT  
Sbjct: 188 PNGWVQGGDILYGKGDGGESIHGPVFEDENFSVKHNARGILGMGNKGRHTNGSQFYITCQ 247

Query: 430 KTSWLDGRHVVFG 468
              W+D + V FG
Sbjct: 248 PAPWMDSKFVAFG 260



 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 9/62 (14%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKG---------FGYKGSIFHRV 247
           V+FDVTVD   +G+++ EL +D  P+TCENFRALCTGEKG         F Y  S+FHR+
Sbjct: 127 VYFDVTVDGEKIGRLLFELFTDQCPRTCENFRALCTGEKGQKTDDTLMKFHYLESLFHRI 186

Query: 248 IP 253
           +P
Sbjct: 187 VP 188


>UniRef50_Q9VT21 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Sophophora|Rep: Peptidyl-prolyl cis-trans isomerase -
           Drosophila melanogaster (Fruit fly)
          Length = 383

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 44/108 (40%), Positives = 63/108 (58%), Gaps = 1/108 (0%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG- 390
           L  +G  F      F++Q GD   ++G+ G+SIYG  F+DENF L H   GV+SMAN G 
Sbjct: 64  LHYKGTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGK 123

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
            ++N SQFFI+      L+G +VV G V+ G+ +V ++E      G P
Sbjct: 124 PNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDP 171



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 32/73 (43%), Positives = 45/73 (61%), Gaps = 7/73 (9%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSI 235
           K + P V+ D+++     G+++IELR DV PKT ENFRALCTGE G G       YKG+ 
Sbjct: 11  KSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTK 70

Query: 236 FHRVIPISCCKEG 274
           FH++  +   + G
Sbjct: 71  FHKIKRVFVVQSG 83


>UniRef50_UPI0000D55828 Cluster: PREDICTED: similar to
           Peptidyl-prolyl cis-trans isomerase 7 (PPIase)
           (Rotamase) (Cyclophilin-7); n=1; Tribolium
           castaneum|Rep: PREDICTED: similar to Peptidyl-prolyl
           cis-trans isomerase 7 (PPIase) (Rotamase)
           (Cyclophilin-7) - Tribolium castaneum
          Length = 361

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 44/96 (45%), Positives = 55/96 (57%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           P   L+ GD T   G GG SIYG  F +E   LKHT PGVLSM       N S+F IT  
Sbjct: 249 PGRFLETGDITKGTGRGGVSIYGKYFAEEGHMLKHTKPGVLSMVRVRKHDNNSRFCITFT 308

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPL 537
           K   LD ++VVFG +V G E + +IE    ++G+PL
Sbjct: 309 KMEQLDMQNVVFGYIVRGAENLFKIEGYGRSIGKPL 344



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 3/58 (5%)
 Frame = +2

Query: 89  PRVFFDVTVDDAP-LGKIVIELRSDVTPKTCENFRALCTGE--KGFGYKGSIFHRVIP 253
           PR F +  V + P LG++ IEL  D  P T +NF ++C GE  +   YK    +R++P
Sbjct: 192 PRCFLEFQVLNGPVLGRVEIELYHDHVPVTVQNFLSICCGENKQNLSYKNCPINRIVP 249


>UniRef50_Q8KRN2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=7;
           Flavobacteriales|Rep: Peptidyl-prolyl cis-trans
           isomerase - Cytophaga johnsonae (Flavobacterium
           johnsoniae)
          Length = 372

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 48/94 (51%), Positives = 60/94 (63%), Gaps = 1/94 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGADTN 402
           GL F      FM+QGGD  + NG+GG    G  F+DE    LK    GVL+MAN+G  TN
Sbjct: 92  GLKFHRVINDFMIQGGD-PDGNGSGGP---GFSFKDEFVDDLKFEKGGVLAMANSGPATN 147

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
           GSQFFIT   T WL+G+H +FG+VV GM+ V +I
Sbjct: 148 GSQFFITHKDTPWLNGKHTIFGHVVSGMDNVNKI 181


>UniRef50_Q6C7K2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Yarrowia lipolytica|Rep: Peptidyl-prolyl cis-trans
           isomerase - Yarrowia lipolytica (Candida lipolytica)
          Length = 479

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 44/79 (55%), Positives = 51/79 (64%), Gaps = 3/79 (3%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLK---HTGPGVLSMANAGADTNGSQFFIT 423
           HFM+QGGD T   G+GG+SI+G  F DE  T     H   GVLSMAN G  TN SQFFIT
Sbjct: 294 HFMIQGGDPTG-TGSGGESIFGKTFRDECGTFNPHTHDSRGVLSMANRGKGTNSSQFFIT 352

Query: 424 TVKTSWLDGRHVVFGNVVE 480
             +   LDG+H VFG VV+
Sbjct: 353 YSRAPHLDGKHTVFGRVVD 371


>UniRef50_A2Z3I5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Oryza sativa|Rep: Peptidyl-prolyl cis-trans isomerase -
           Oryza sativa subsp. indica (Rice)
          Length = 194

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 49/116 (42%), Positives = 65/116 (56%), Gaps = 1/116 (0%)
 Frame = +1

Query: 199 HWRERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSM 378
           H  + L  +G  F    P FM+QGGD    +G G                      V++M
Sbjct: 82  HKGKSLHYKGSRFHRIIPGFMIQGGDIVRGDGKGS---------------------VIAM 120

Query: 379 ANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL-GRPLRE 543
           AN+G D+NGSQF+ITT+KTSWLDG HVVFG V++GM+ V  IE  A T  G+P ++
Sbjct: 121 ANSGPDSNGSQFYITTIKTSWLDGEHVVFGRVIQGMDYVYAIEGGAGTYNGKPRKK 176



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 38/71 (53%), Positives = 46/71 (64%), Gaps = 11/71 (15%)
 Frame = +2

Query: 74  GKMSLP----RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG------- 220
           G++ LP    RV+ DV +D   +G+IVI L  DV PKT  NFRALCTGE+G G       
Sbjct: 29  GEVRLPAVTNRVYLDVEIDGQHIGRIVIGLYGDVVPKTVANFRALCTGEEGIGHKGKSLH 88

Query: 221 YKGSIFHRVIP 253
           YKGS FHR+IP
Sbjct: 89  YKGSRFHRIIP 99


>UniRef50_Q1VV59 Cluster: Peptidyl-prolyl cis-trans isomerase; n=14;
           Bacteria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Psychroflexus torquis ATCC 700755
          Length = 349

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 48/83 (57%), Positives = 54/83 (65%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FM+QGGD     G GG      +F DE  ++     GVLSMANAGADTNGSQFFIT V T
Sbjct: 90  FMIQGGDPLG-TGQGGPEY---EFADEIDSVLTHKKGVLSMANAGADTNGSQFFITLVPT 145

Query: 436 SWLDGRHVVFGNVVEGMEVVKQI 504
             LDG+H VFG +V GMEVV  I
Sbjct: 146 PHLDGKHSVFGELVVGMEVVDSI 168


>UniRef50_Q09928 Cluster: Peptidyl-prolyl cis-trans isomerase cyp8;
           n=2; Schizosaccharomyces pombe|Rep: Peptidyl-prolyl
           cis-trans isomerase cyp8 - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 516

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 42/85 (49%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD  +  G GG+SI+G  F+DE    LKH   G++SMAN G +TNGSQFFI    
Sbjct: 324 FMIQGGD-PSGTGRGGQSIWGKPFKDEFCNPLKHDDRGIISMANRGKNTNGSQFFILYGP 382

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIE 507
              LD +H +FG VV G+ V+  +E
Sbjct: 383 AKHLDNKHTIFGRVVGGLNVLDALE 407


>UniRef50_Q6E7C4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Oikopleura dioica|Rep: Peptidyl-prolyl cis-trans
           isomerase - Oikopleura dioica (Tunicate)
          Length = 198

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 39/70 (55%), Positives = 47/70 (67%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           FMLQ GD  N +GTG  SIYG+ F+DENF LKH     +SMAN G +TNG QFF+   + 
Sbjct: 91  FMLQAGDIINQDGTGSISIYGDTFDDENFDLKHYDEQWVSMANNGPNTNGCQFFVLYDEA 150

Query: 436 SWLDGRHVVF 465
            +LD  HVVF
Sbjct: 151 RFLDDEHVVF 160


>UniRef50_A4RXD7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Ostreococcus lucimarinus CCE9901|Rep: Peptidyl-prolyl
           cis-trans isomerase - Ostreococcus lucimarinus CCE9901
          Length = 157

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 44/92 (47%), Positives = 56/92 (60%), Gaps = 3/92 (3%)
 Frame = +1

Query: 247 HPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA---DTNGSQFF 417
           +P   + GGDFT  +    +SIYG  F+DENF LKH GPGVL+M N G      NGSQF 
Sbjct: 51  YPSNWIVGGDFTKLD----ESIYGAYFDDENFNLKHGGPGVLTMHNDGGGEPGRNGSQFM 106

Query: 418 ITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           +T      LD RHV FG V+EG ++V  ++ L
Sbjct: 107 LTLDAKPQLDNRHVAFGQVIEGYDIVYALQKL 138



 Score = 37.1 bits (82), Expect = 0.43
 Identities = 21/55 (38%), Positives = 32/55 (58%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           P+ F ++      LG++V E++ DV P T +NF  LC  E G  Y G++F +V P
Sbjct: 2   PQCFLELRAGGYYLGRVVFEVKEDVAPITAKNFAQLC--EYGC-YAGTMF-KVYP 52


>UniRef50_A4H346 Cluster: Cyclophilin type peptidyl-prolyl cis-trans
           isomerase, putative; n=3; Leishmania|Rep: Cyclophilin
           type peptidyl-prolyl cis-trans isomerase, putative -
           Leishmania braziliensis
          Length = 337

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 38/85 (44%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query: 262 LQGGDFTN-HNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTS 438
           + GGD T  H+G GG S YG  F DE + + H   GVL M N G  T+ S F+IT    S
Sbjct: 229 VMGGDVTGAHSGNGGYSCYGRCFPDETYAVPHDAAGVLGMCNDGPHTSSSTFYITRRPMS 288

Query: 439 WLDGRHVVFGNVVEGMEVVKQIETL 513
           W++G++V FG V++GM VV  I  +
Sbjct: 289 WMNGKYVAFGRVMDGMHVVDAIHAV 313



 Score = 35.9 bits (79), Expect = 0.98
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 98  FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTG 205
           + DV+V    +G+I  EL + V P TC+NF  LC G
Sbjct: 152 WMDVSVSGMAVGRIWFELYTAVAPLTCKNFCELCRG 187


>UniRef50_UPI0000EBC5E4 Cluster: PREDICTED: similar to peptidyl-Pro
           cis trans isomerase; n=2; Bos taurus|Rep: PREDICTED:
           similar to peptidyl-Pro cis trans isomerase - Bos taurus
          Length = 134

 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 36/58 (62%), Positives = 44/58 (75%)
 Frame = +1

Query: 358 GPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GPG+LS ANAG +TNGSQFF  T KT WLDG+HVVFG V EGM+VV+ +E   +  G+
Sbjct: 64  GPGILSTANAGPNTNGSQFFTCTAKTEWLDGKHVVFGKVKEGMDVVEAMERFGSRNGK 121



 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 36/60 (60%), Positives = 43/60 (71%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P VFF++ VD  PLG++  EL +D  PKT EN  AL TGEKGFGYKGS FHR+IP   C+
Sbjct: 4   PTVFFNIAVDGEPLGRVSFELFADKVPKTAENVHALRTGEKGFGYKGSCFHRIIPGFMCQ 63



 Score = 36.7 bits (81), Expect = 0.56
 Identities = 15/20 (75%), Positives = 17/20 (85%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQI 569
           FGS +GKTSK+I I DCGQI
Sbjct: 115 FGSRNGKTSKKITIADCGQI 134


>UniRef50_A2YY42 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Oryza sativa (indica cultivar-group)|Rep:
           Peptidyl-prolyl cis-trans isomerase - Oryza sativa
           subsp. indica (Rice)
          Length = 190

 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 43/66 (65%), Positives = 48/66 (72%), Gaps = 1/66 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           F++QGGD T   G GG+SIYG KFEDE    LKHTG G+LSMANAG +TNGSQFFIT   
Sbjct: 58  FIVQGGDPTG-TGRGGESIYGAKFEDEIRPELKHTGAGILSMANAGPNTNGSQFFITLAP 116

Query: 433 TSWLDG 450
              LDG
Sbjct: 117 CQSLDG 122



 Score = 36.7 bits (81), Expect = 0.56
 Identities = 26/81 (32%), Positives = 37/81 (45%)
 Frame = +2

Query: 104 DVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSP 283
           +VT++ + +G   IE+     PKTC NF  L    +G+ Y   IFHR+I      +G  P
Sbjct: 11  EVTLETS-MGAFTIEMYYKHAPKTCRNFLEL--SRRGY-YDNVIFHRIIK-DFIVQGGDP 65

Query: 284 TITALGESPSTAISLKTRISP 346
           T T  G         +  I P
Sbjct: 66  TGTGRGGESIYGAKFEDEIRP 86


>UniRef50_Q5CKV3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=4;
           Cryptosporidium|Rep: Peptidyl-prolyl cis-trans isomerase
           - Cryptosporidium hominis
          Length = 169

 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 46/109 (42%), Positives = 68/109 (62%), Gaps = 6/109 (5%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGA----DTNGSQFFI 420
           F++QGGD T   G GG+SIYG  F+DE +  LK+   G+LSMA+ GA    +TNGSQFFI
Sbjct: 49  FIIQGGDPTG-TGKGGESIYGRYFDDEIYPELKYDRRGILSMASKGASKKPNTNGSQFFI 107

Query: 421 TTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG-RPLRESLSKTVV 564
           T      L+G +V+FG +++G E +  +E   +    +P+ E + K +V
Sbjct: 108 TYSSLPQLNGEYVIFGRLIDGFETLNALENCPSDKSHKPIDEIIIKDIV 156


>UniRef50_Q7RXA6 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           2; n=2; Sordariales|Rep: Peptidyl-prolyl cis-trans
           isomerase-like 2 - Neurospora crassa
          Length = 597

 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 46/107 (42%), Positives = 62/107 (57%), Gaps = 3/107 (2%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           +FM+QGGD  +  G GG SI+G  FEDE      H+  G++SMAN G +TN SQFFIT  
Sbjct: 377 NFMIQGGD-PSGTGRGGSSIWGKNFEDEFEGPNTHSARGIVSMANKGKNTNSSQFFITYR 435

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAATLG--RPLRESLSKTVV 564
             S LD +H +F  V+EG +         AT G  RPL + + K ++
Sbjct: 436 PASHLDRKHTIFAKVIEGQDTTLTAMENVATDGSDRPLNKIVIKDMI 482


>UniRef50_Q7ZWA6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Danio rerio|Rep: Peptidyl-prolyl cis-trans isomerase -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 486

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 42/82 (51%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +1

Query: 271 GDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLD 447
           GD T   GTGG+S +G  F+DE    L HTG G+LSMAN+G +TN SQFFIT    ++LD
Sbjct: 289 GDPTG-TGTGGESFWGKPFKDEFRPNLSHTGRGILSMANSGPNTNKSQFFITFRSCAYLD 347

Query: 448 GRHVVFGNVVEGMEVVKQIETL 513
            +H VFG VV G+E +  +E +
Sbjct: 348 RKHSVFGRVVGGLETLSAMENV 369


>UniRef50_A3ERA5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=4;
           Bacteria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Leptospirillum sp. Group II UBA
          Length = 218

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 46/98 (46%), Positives = 60/98 (61%), Gaps = 1/98 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           GL F     +FM+QGGD    NGTGG    G +F+DE + +   +  GVL+MANAG +TN
Sbjct: 102 GLVFHRVIKNFMIQGGDPLG-NGTGGP---GYQFDDEIDASRDFSHKGVLAMANAGPNTN 157

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLA 516
           GSQFFIT     WL+G + +FG VV G  V  +I  +A
Sbjct: 158 GSQFFITVAPAPWLNGNYSIFGQVVSGQSVADKISEVA 195


>UniRef50_Q4P555 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           2; n=1; Ustilago maydis|Rep: Peptidyl-prolyl cis-trans
           isomerase-like 2 - Ustilago maydis (Smut fungus)
          Length = 582

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 49/105 (46%), Positives = 63/105 (60%), Gaps = 7/105 (6%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDE---NFTLKHTGPGVLSMANAGADTNGSQFFI 420
           P FM+QGGD T   G GG SI+ + F DE       KH   GVLSMAN G DTN SQFFI
Sbjct: 339 PGFMIQGGDPTG-TGRGGSSIWNSNFRDEFNEPGAFKHDTRGVLSMANKGKDTNASQFFI 397

Query: 421 TTVKTSWLDGRHVVFGNVVEGME--VVKQIETLAATLG--RPLRE 543
           T      LDG+H VFG +V+G +   + ++E + +  G  RPL++
Sbjct: 398 TYRGVPHLDGKHTVFGRLVDGDKDATLTKMEQVPSEQGTDRPLKK 442



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 24/59 (40%), Positives = 29/59 (49%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALGES 307
           G + +EL     PKTC NF  LC   K   Y  ++FHR IP     +G  PT T  G S
Sbjct: 302 GALNLELHCGKAPKTCFNFLQLCKHGK---YDDTLFHRNIP-GFMIQGGDPTGTGRGGS 356


>UniRef50_UPI0000DBEFB8 Cluster: similar to peptidylprolyl isomerase
           A (cyclophilin A)) (predicted) (RGD1564569_predicted),
           mRNA; n=1; Rattus norvegicus|Rep: similar to
           peptidylprolyl isomerase A (cyclophilin A)) (predicted)
           (RGD1564569_predicted), mRNA - Rattus norvegicus
          Length = 206

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 48/107 (44%), Positives = 62/107 (57%), Gaps = 1/107 (0%)
 Frame = +1

Query: 190 CPVHWRER-LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPG 366
           C V   E+    +G  F    P F+ QGGDFT+H+GTGGKSIYG K E  N  LK   P 
Sbjct: 82  CAVSIEEKGFGYKGSSFHRIIPGFVGQGGDFTHHDGTGGKSIYGRKSEGGNSILKQI-PS 140

Query: 367 VLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           +  MANAG ++NGS   + T K+  LDG+  V+G   EGM  V  ++
Sbjct: 141 IFFMANAGPNSNGSH-LVCTAKSECLDGKRGVWGK-REGMSFVDAMQ 185



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 23/46 (50%), Positives = 30/46 (65%)
 Frame = +2

Query: 116 DDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           +D  LG +  ++ +D   KT E F A+   EKGFGYKGS FHR+IP
Sbjct: 58  NDRHLGHVSFKIFADKASKTAETFCAVSIEEKGFGYKGSSFHRIIP 103


>UniRef50_Q019H4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Ostreococcus tauri|Rep: Peptidyl-prolyl cis-trans
           isomerase - Ostreococcus tauri
          Length = 295

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = +1

Query: 298 GGKSIYGNKFEDENFTLKHTGPGVLSMANAGADT---NGSQFFITTVKTSWLDGRHVVFG 468
           GG+SIYG  F+DEN+ LKH+G GVL+M N G +    NGSQF IT  K + LD RHV FG
Sbjct: 148 GGQSIYGAYFDDENYDLKHSGAGVLTMHNNGGEVPGQNGSQFMITFDKKNQLDDRHVAFG 207

Query: 469 NVVEGMEVVKQIETL 513
            ++EG +V   ++ L
Sbjct: 208 QIIEGYDVFCALQKL 222



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 24/55 (43%), Positives = 32/55 (58%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           PR FFD+      LGK+V E++ D  P T +NF  LC  E G  Y G++F +V P
Sbjct: 61  PRCFFDLRAGGYYLGKVVFEIKEDACPITAKNFMQLC--EYGC-YAGTMF-KVYP 111


>UniRef50_A3E4E6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Karlodinium micrum|Rep: Peptidyl-prolyl cis-trans
           isomerase - Karlodinium micrum (Dinoflagellate)
          Length = 265

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 44/103 (42%), Positives = 58/103 (56%), Gaps = 1/103 (0%)
 Frame = +1

Query: 232 HFPSCHPHFMLQGGDFTNHNGTG-GKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGS 408
           +F    P   + GGD  +  G G G SIYG  F DENF ++    G L+M N G +TNGS
Sbjct: 111 YFHQIKPGCCVVGGDTISGVGKGRGLSIYGEAFPDENFDMEFLRDGDLAMINWGKNTNGS 170

Query: 409 QFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPL 537
            F IT        G HVVFG V++GM+VV+++  L    GRP+
Sbjct: 171 IFMITLSSQRQYYGHHVVFGTVMKGMKVVREMGELGTRTGRPV 213



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 4/81 (4%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTG----EKGFGYKGSIFHRVIPIS 259
           +VF D+ + +   G++ I L S   P TCENF  LC G    +K  GY+ + FH++ P  
Sbjct: 60  KVFLDIAIGNTYAGRVKIGLYSKTVPLTCENFLQLCKGYQVKDKLIGYRNTYFHQIKP-G 118

Query: 260 CCKEGTSPTITALGESPSTAI 322
           CC  G   TI+ +G+    +I
Sbjct: 119 CCVVG-GDTISGVGKGRGLSI 138


>UniRef50_Q4DJN9 Cluster: Putative uncharacterized protein; n=2;
            Trypanosoma cruzi|Rep: Putative uncharacterized protein -
            Trypanosoma cruzi
          Length = 937

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 51/119 (42%), Positives = 69/119 (57%), Gaps = 6/119 (5%)
 Frame = +1

Query: 226  GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKH--TGPGV--LSMANAGA 393
            GL F    P FM+QGG     +G+GGKS++G +FEDE        + P V  L MAN G 
Sbjct: 812  GLTFHRVVPGFMIQGGCPVG-DGSGGKSVFGERFEDEGMNAMDFFSYPSVYWLCMANCGP 870

Query: 394  DTNGSQFFITTVKTS-WLDGRHVVFGNVVEGMEVVKQI-ETLAATLGRPLRESLSKTVV 564
            +TN SQFFIT  + + WL+G+H VFG VV G  VV+ I +T      +P+   + + VV
Sbjct: 871  NTNESQFFITVGEVAPWLNGKHTVFGFVVSGKPVVRAIVQTARDDDDKPIAPVVIRRVV 929



 Score = 33.1 bits (72), Expect = 6.9
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           G I++ L  +  PK   NF  L   ++GF Y G  FHRV+P
Sbjct: 783 GTIIVRLLPNFAPKAVVNFVGLA--QEGF-YNGLTFHRVVP 820


>UniRef50_P77949 Cluster: Peptidyl-prolyl cis-trans isomerase B;
           n=12; cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase B - Streptomyces chrysomallus
          Length = 175

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 51/109 (46%), Positives = 66/109 (60%), Gaps = 6/109 (5%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD    NGTGG    G KF DE +  L  T P +L+MANAG  TNGSQFF+T   
Sbjct: 68  FMIQGGDPLG-NGTGGP---GYKFADEFHPELGFTQPYLLAMANAGPGTNGSQFFLTVSP 123

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETLAAT-----LGRPLRESLSKTVV 564
           T+WL G+H +FG  V G    K ++ +AAT       RPL + + ++VV
Sbjct: 124 TAWLTGKHTIFGE-VSGEAGRKVVDAIAATPTNPRTDRPLEDVVIESVV 171


>UniRef50_Q9LIK6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Arabidopsis thaliana|Rep: Peptidyl-prolyl cis-trans
           isomerase - Arabidopsis thaliana (Mouse-ear cress)
          Length = 232

 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 37/65 (56%), Positives = 47/65 (72%), Gaps = 7/65 (10%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSIF 238
           M+ P+VFFD+TVD  P G+IVIEL +D+TP+T ENFR LCTGE+G G       YKGS F
Sbjct: 1   MANPKVFFDLTVDGKPAGRIVIELFADLTPRTAENFRGLCTGERGIGKCGKPIHYKGSTF 60

Query: 239 HRVIP 253
             ++P
Sbjct: 61  DHIVP 65



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 39/100 (39%), Positives = 54/100 (54%), Gaps = 2/100 (2%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHT-GPGVLSMANAG 390
           +  +G  F    P  M  GGD    N    + I+  + +DE F L H  GPG++SMA   
Sbjct: 53  IHYKGSTFDHIVPDLMWCGGDIIFEN----EPIHSEELDDEYFILNHEDGPGIISMA--- 105

Query: 391 ADTNGSQFFITTVKTSW-LDGRHVVFGNVVEGMEVVKQIE 507
            D+NGSQF I        +DG HVV G VVEG+++++ IE
Sbjct: 106 -DSNGSQFQIHMKDYGLQVDGDHVVIGKVVEGLDLMRNIE 144


>UniRef50_A6DKQ5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Lentisphaera araneosa HTCC2155|Rep: Peptidyl-prolyl
           cis-trans isomerase - Lentisphaera araneosa HTCC2155
          Length = 216

 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 50/121 (41%), Positives = 73/121 (60%), Gaps = 10/121 (8%)
 Frame = +1

Query: 229 LHFPSCHPHFMLQGG-DFTNHN-------GTGGKSIYGNKFEDENFT-LKHTGPGVLSMA 381
           +HF      FM QGG  ++  N       GTGG    G  F +E    L+H+  G+LSMA
Sbjct: 84  MHFHRVIRGFMAQGGCPYSRSNDKTRKRPGTGGP---GYSFNNETHPQLRHSQKGILSMA 140

Query: 382 NAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL-GRPLRESLSKT 558
           N+G  TNGSQFFI   ++S+L+G + VFG V+EG++V+ +IE + A   G PL+E ++ +
Sbjct: 141 NSGPHTNGSQFFILFKESSFLNGSYNVFGRVIEGLDVLDKIEAIGAQRDGFPLKEKVTFS 200

Query: 559 V 561
           V
Sbjct: 201 V 201


>UniRef50_A0H3N0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Chloroflexus|Rep: Peptidyl-prolyl cis-trans isomerase -
           Chloroflexus aggregans DSM 9485
          Length = 161

 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 49/96 (51%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE--NFTLKHTGPGVLSMANAGADT 399
           GL F      F++QGGD T   G+GG    G +F DE     L H   GV+SMANAG +T
Sbjct: 57  GLTFHRVIKDFVIQGGDPTGR-GSGGP---GYRFPDEVKGNPLTHEA-GVISMANAGPNT 111

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           NGSQFFIT      L+GRH VFG VV GM+VV  I+
Sbjct: 112 NGSQFFITHTPQPHLNGRHTVFGRVVSGMDVVYAIQ 147


>UniRef50_A0BH25 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Paramecium tetraurelia|Rep: Peptidyl-prolyl cis-trans
           isomerase - Paramecium tetraurelia
          Length = 489

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 41/82 (50%), Positives = 50/82 (60%), Gaps = 1/82 (1%)
 Frame = +1

Query: 235 FPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQ 411
           F    P+FM+QGGD T   G GGKS+YG  FEDE +  L     G+L+ +N G +TN SQ
Sbjct: 49  FHRLFPNFMIQGGDPTG-TGEGGKSMYGQPFEDEFHSRLTFCTRGILAYSNEGPNTNESQ 107

Query: 412 FFITTVKTSWLDGRHVVFGNVV 477
           FFIT     WL  RH +FG VV
Sbjct: 108 FFITLDSCPWLQKRHTIFGMVV 129



 Score = 34.3 bits (75), Expect = 3.0
 Identities = 25/74 (33%), Positives = 35/74 (47%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPIS 259
           M  P+    + +D +  G++ IEL     PK C NF  LC    G+ Y    FHR+ P +
Sbjct: 1   MQFPQTSGKIIMDTSH-GELEIELWCKEVPKGCRNFIQLCL--NGY-YDNCRFHRLFP-N 55

Query: 260 CCKEGTSPTITALG 301
              +G  PT T  G
Sbjct: 56  FMIQGGDPTGTGEG 69


>UniRef50_Q8C6U1 Cluster: 0 day neonate lung cDNA, RIKEN full-length
           enriched library, clone:E030024N20 product:hypothetical
           protein, full insert sequence; n=2; Murinae|Rep: 0 day
           neonate lung cDNA, RIKEN full-length enriched library,
           clone:E030024N20 product:hypothetical protein, full
           insert sequence - Mus musculus (Mouse)
          Length = 121

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 35/77 (45%), Positives = 55/77 (71%)
 Frame = -3

Query: 519 GCQSLNLLDNFHAFNNIPKDNMSAIQPGGLDSGDEELGTISISTGISHGEDARSSVLKGE 340
           G ++L+   N HAF ++PKD+M AIQP  L S D++LGT+ + + I HG+DAR+ +L+ E
Sbjct: 29  GSKTLHDFHNVHAFFHLPKDHMLAIQPFSLGSADKKLGTVCVWSSICHGQDARTCMLQDE 88

Query: 339 ILVFKLIAVDGLSPSAV 289
           +L+ K + VDG + SA+
Sbjct: 89  VLILKFLPVDGPAASAM 105


>UniRef50_Q486E3 Cluster: Peptidyl-prolyl cis-trans isomerase,
           cyclophilin-type; n=2; Alteromonadales|Rep:
           Peptidyl-prolyl cis-trans isomerase, cyclophilin-type -
           Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
           (Vibriopsychroerythus)
          Length = 219

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 48/109 (44%), Positives = 62/109 (56%), Gaps = 3/109 (2%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSI-YGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITT 426
           P FM QGGD T   G G     Y  +FE E   + H+  G LSMANAG  T+GSQFF+T 
Sbjct: 110 PGFMAQGGDPTG-TGAGNPGYKYDGEFEGE---IGHSEAGTLSMANAGPGTDGSQFFLTF 165

Query: 427 VKTSWLDGRHVVFGNVVEGME-VVKQIETLAATLGRPLRE-SLSKTVVR 567
           + T +LDG+H VFG VV   E  + +IE L    GR +    ++K  +R
Sbjct: 166 IPTPFLDGKHTVFGKVVADPENSLAKIEALGTRNGRTMEAVKINKASIR 214


>UniRef50_A7AR76 Cluster: Peptidyl-prolyl cis-trans isomerase,
           putative; n=1; Babesia bovis|Rep: Peptidyl-prolyl
           cis-trans isomerase, putative - Babesia bovis
          Length = 508

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 1/102 (0%)
 Frame = +1

Query: 205 RERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMAN 384
           R+ L   G    S  P   L+ GDF  +NG GG S++G  F +   T +H+  G+LS+  
Sbjct: 52  RKSLSYTGCRVYSVVPGSHLECGDFEFNNGEGGSSVFGGFFREPANTRRHSHAGLLSLKR 111

Query: 385 AGADTNGSQFFITTVKTSWLDGR-HVVFGNVVEGMEVVKQIE 507
            G +  GSQF+IT  +   LD + H VFG VVEGME V+ +E
Sbjct: 112 MGTNGFGSQFYITFGRNHQLDNQHHYVFGRVVEGMEFVRAVE 153



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTG 205
           R FFD+ +     G++V +   D   +  ENF++LCTG
Sbjct: 5   RAFFDIGIGANLSGRVVFDFFDDSGERVLENFQSLCTG 42


>UniRef50_UPI00015B5D99 Cluster: PREDICTED: similar to
           peptidyl-prolyl cis-trans isomerase f, ppif; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to
           peptidyl-prolyl cis-trans isomerase f, ppif - Nasonia
           vitripennis
          Length = 397

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 42/111 (37%), Positives = 61/111 (54%), Gaps = 1/111 (0%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIY-GNKFEDENFTLKHTGPGVLSMANAG 390
           L  +G  F      +  QGGD T  NG GG SIY  N   D+N+TL+H+ PGVLS  +  
Sbjct: 237 LSYRGTPFHRILSGYWCQGGDVTKFNGIGGASIYEDNTVLDDNYTLQHSRPGVLSTCSDD 296

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPLRE 543
             T  S+F +T      +D + VVFG VV+G++ + ++E      G+PL +
Sbjct: 297 KKTFDSKFNLTFRPLRTIDDKKVVFGRVVKGIQNLFKLEAYGTKFGKPLEK 347



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 2/73 (2%)
 Frame = +2

Query: 89  PRVFFDVTV--DDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISC 262
           PR FFD+ +   + PLG+IVIEL +D  P  C NF A C G  G  Y+G+ FHR++    
Sbjct: 193 PRCFFDLELAQSNLPLGRIVIELYADYVPLICANFEAFCKGHNGLSYRGTPFHRILSGYW 252

Query: 263 CKEGTSPTITALG 301
           C+ G       +G
Sbjct: 253 CQGGDVTKFNGIG 265


>UniRef50_O82646 Cluster: Peptidyl-prolyl cis-trans isomerase; n=4;
           core eudicotyledons|Rep: Peptidyl-prolyl cis-trans
           isomerase - Arabidopsis thaliana (Mouse-ear cress)
          Length = 510

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 39/77 (50%), Positives = 53/77 (68%), Gaps = 2/77 (2%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGA-DTNGSQFFIT 423
           P F++QGGD T  +GTGG SIYG  F DE +  L+ +  G+++MANA + ++NGSQFF T
Sbjct: 59  PGFLVQGGDPTG-SGTGGDSIYGGVFADEFHSRLRFSHRGIVAMANASSPNSNGSQFFFT 117

Query: 424 TVKTSWLDGRHVVFGNV 474
             K  WLD +H +FG V
Sbjct: 118 LDKCDWLDKKHTIFGKV 134



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 22/57 (38%), Positives = 30/57 (52%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I +EL     PK+  NF  LC   +G+ +  +IFHRVIP     +G  PT +  G
Sbjct: 22  GPIDVELWPKEAPKSVRNFVQLCL--EGY-FDNTIFHRVIP-GFLVQGGDPTGSGTG 74


>UniRef50_A7TG12 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 317

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 44/94 (46%), Positives = 55/94 (58%), Gaps = 2/94 (2%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           L  +G  F    P+ M+ GGD       G  S++G  F DENF LKH  PG LSMAN G 
Sbjct: 96  LGYKGTKFTEVVPNGMILGGDVIPE--IGPFSVHGPGFPDENFFLKHDRPGRLSMANTGP 153

Query: 394 DTNGSQFFITT--VKTSWLDGRHVVFGNVVEGME 489
           D+N  +FFI+T     + LD R+VVFG VV G+E
Sbjct: 154 DSNNCKFFISTKVEPATELDNRNVVFGQVVSGLE 187


>UniRef50_Q7UQJ9 Cluster: Probable cyclophilin type peptidylprolyl
           isomerase; n=2; Bacteria|Rep: Probable cyclophilin type
           peptidylprolyl isomerase - Rhodopirellula baltica
          Length = 1541

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 45/97 (46%), Positives = 59/97 (60%), Gaps = 1/97 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           GL F      F++QGGD T   GTGG ++    F+DE +  L+H   GVLS A +  DTN
Sbjct: 289 GLIFHRVVNGFVIQGGDPTG-TGTGGSNL--GDFDDEFHPDLQHNRTGVLSFAKSSDDTN 345

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
            SQFFIT V+T +LD  H VFG +VEG +V + I  +
Sbjct: 346 DSQFFITEVETDFLDFNHSVFGQLVEGEDVREAISNM 382


>UniRef50_UPI0000D5687A Cluster: PREDICTED: similar to CG10907-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG10907-PA - Tribolium castaneum
          Length = 449

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           F+ QGGD  N +GTGG+SIYG  F+DE +  L+ T  G+L+MAN G D NGSQFF T   
Sbjct: 61  FIAQGGD-PNGDGTGGESIYGEPFKDEFHQRLRFTRRGLLAMANGGKDDNGSQFFFTLGA 119

Query: 433 TSWLDGRHVVFGNV 474
           T  L  +H +FG +
Sbjct: 120 TPELQDKHTIFGKI 133



 Score = 39.5 bits (88), Expect = 0.080
 Identities = 20/41 (48%), Positives = 27/41 (65%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +G I +EL +  TPKTC NF  LC   +G+ Y  +IFHRV+
Sbjct: 21  VGDIDVELWAKETPKTCRNFIQLCL--EGY-YDNTIFHRVV 58


>UniRef50_A3ZZ38 Cluster: Peptidyl-prolyl cis-trans isomerase; n=5;
           cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase - Blastopirellula marina DSM 3645
          Length = 473

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 43/94 (45%), Positives = 53/94 (56%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNG 405
           GL F     +FM QGGD    +GTGG   Y    E      +    G LSMA+AG DT G
Sbjct: 348 GLSFHRVLENFMAQGGD-PKGDGTGGPG-YNIFCECYKPNFRRHFSGTLSMAHAGRDTGG 405

Query: 406 SQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           SQFF+T   T  LDG+H  FG V+EGM+V+  I+
Sbjct: 406 SQFFLTFRPTPGLDGKHTAFGRVIEGMDVLTDIQ 439



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 26/55 (47%), Positives = 33/55 (60%)
 Frame = +2

Query: 86  LPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           LPRV   +T D    G+IVIEL  +  P+T  NF +L   +KGF Y G  FHRV+
Sbjct: 309 LPRV--RLTTDK---GEIVIELFENEAPQTVANFISLV--KKGF-YDGLSFHRVL 355


>UniRef50_UPI00015B5F55 Cluster: PREDICTED: similar to
           ENSANGP00000020743; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000020743 - Nasonia
           vitripennis
          Length = 469

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 39/74 (52%), Positives = 48/74 (64%), Gaps = 1/74 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGADTNGSQFFITTVK 432
           F++QGGD T   G GG+SIYG  F+DE  T L+    G+L+MANAG D NGSQFF T   
Sbjct: 61  FIVQGGDPTG-TGEGGESIYGAPFKDEFHTRLRFCRRGLLAMANAGKDDNGSQFFFTLAA 119

Query: 433 TSWLDGRHVVFGNV 474
           T  L  +H +FG V
Sbjct: 120 TPELQNKHTIFGKV 133



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 24/58 (41%), Positives = 31/58 (53%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           +G I +EL +   PK C NF  LC   +G+ Y  +IFHRVI      +G  PT T  G
Sbjct: 21  IGDIDLELWTKEAPKACRNFIQLCM--EGY-YDNTIFHRVIK-GFIVQGGDPTGTGEG 74


>UniRef50_UPI000023E0CF Cluster: hypothetical protein FG00940.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG00940.1 - Gibberella zeae PH-1
          Length = 178

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 45/95 (47%), Positives = 55/95 (57%), Gaps = 7/95 (7%)
 Frame = +1

Query: 250 PHFMLQGGDFTN----HNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQF 414
           P FM Q G         N  GG+SI+G  FEDE    L+H   GVLSMAN G  TNGSQF
Sbjct: 58  PKFMAQTGAPATPNPPENPKGGRSIWGGAFEDEIRPALRHGARGVLSMANKGPGTNGSQF 117

Query: 415 FITTVKTSWLDGRHVVFGNVV--EGMEVVKQIETL 513
           FIT  K   LDG + VFG V+  EG+  + ++E +
Sbjct: 118 FITFDKAPHLDGLNTVFGRVIGDEGLATLAKMEAV 152


>UniRef50_Q9VTN7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=6;
           Endopterygota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Drosophila melanogaster (Fruit fly)
          Length = 502

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 36/74 (48%), Positives = 51/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           F++QGGD  N +GTGG+SIYG  F+DE +  L++T  G++ MAN+G D NGSQFF T   
Sbjct: 61  FIVQGGD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAP 119

Query: 433 TSWLDGRHVVFGNV 474
           T  L  ++ +FG +
Sbjct: 120 TPELQNKNTLFGKI 133



 Score = 33.5 bits (73), Expect = 5.2
 Identities = 18/41 (43%), Positives = 25/41 (60%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +G I IEL +   PK C NF  LC   +G+ YK + FHR++
Sbjct: 21  VGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLV 58


>UniRef50_UPI00005A4697 Cluster: PREDICTED: similar to
           peptidylprolyl isomerase E; n=1; Canis lupus
           familiaris|Rep: PREDICTED: similar to peptidylprolyl
           isomerase E - Canis familiaris
          Length = 133

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 31/48 (64%), Positives = 41/48 (85%)
 Frame = +1

Query: 364 GVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           G+LSMA++G +TNGSQFF+T  K  WLDG+HVVFG V EG++V++QIE
Sbjct: 85  GLLSMASSGPNTNGSQFFLTCDKMDWLDGKHVVFGEVTEGLDVLRQIE 132


>UniRef50_Q4N4R0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Theileria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Theileria parva
          Length = 517

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 49/112 (43%), Positives = 60/112 (53%), Gaps = 16/112 (14%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGN--------------KFEDENF--TLKHT 357
           G  F  C   FM+Q GD TN  G GG+S +                K+  + F  TL H 
Sbjct: 332 GCEFFRCVQDFMIQTGDPTN-TGLGGESSFYRRNKLNSPDNSQVIPKYLTDEFDNTLYHV 390

Query: 358 GPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           G GV+SMAN G +TNGSQFFIT      LD RH VFG VV G+E++K+   L
Sbjct: 391 GIGVVSMANKGKNTNGSQFFITFNTCEHLDNRHSVFGKVVGGLEILKKWNNL 442


>UniRef50_Q7P4Y1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Fusobacterium nucleatum|Rep: Peptidyl-prolyl cis-trans
           isomerase - Fusobacterium nucleatum subsp. vincentii
           ATCC 49256
          Length = 173

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 43/97 (44%), Positives = 59/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSI-YGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           GL F      FM+QGGD T   G GG    +G++F++    +     G+L+MANAG +TN
Sbjct: 47  GLKFHRVIEDFMIQGGDPTG-TGAGGPGYQFGDEFKEG---IVFNKKGLLAMANAGPNTN 102

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVV--EGMEVVKQIE 507
           GSQFFIT V T WL+ +H +FG VV  +  +VV  I+
Sbjct: 103 GSQFFITHVPTEWLNYKHTIFGEVVSEKDQDVVDNIK 139


>UniRef50_Q01C80 Cluster: Chromosome 03 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 03 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 362

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 34/88 (38%), Positives = 54/88 (61%)
 Frame = -3

Query: 519 GCQSLNLLDNFHAFNNIPKDNMSAIQPGGLDSGDEELGTISISTGISHGEDARSSVLKGE 340
           G    + LD+ HA  +  +D +  ++P       EEL  + +   + HG+DAR+ VL+ E
Sbjct: 206 GANGFDGLDDVHALGHGAEDGVLTVEPARGGRAQEELRAVRVRARVRHGQDARAGVLERE 265

Query: 339 ILVFKLIAVDGLSPSAVMVGEVPSLQHE 256
           +L+ +L+AVDGL+  AV+VGEV +L HE
Sbjct: 266 VLIRELVAVDGLATRAVVVGEVAALAHE 293


>UniRef50_Q7RKZ9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=7;
           Plasmodium|Rep: Peptidyl-prolyl cis-trans isomerase -
           Plasmodium yoelii yoelii
          Length = 285

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 38/97 (39%), Positives = 55/97 (56%)
 Frame = +1

Query: 247 HPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITT 426
           +P   L GG+  N     G SIYG KF DENF ++    G +++ N G  +N SQF IT 
Sbjct: 119 YPGIGLIGGNVLNDKE--GLSIYGKKFPDENFDMEFVQDGDVALYNQGPHSNTSQFIITF 176

Query: 427 VKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRPL 537
                L   +VV G V++GM++++ IET+   LG P+
Sbjct: 177 APMPILHKHNVVIGTVLKGMDIIRTIETMGTKLGNPM 213



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 4/57 (7%)
 Frame = +2

Query: 95  VFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTG----EKGFGYKGSIFHRVIP 253
           VFFD+ V++  +G+++I L SD  P + ENF  L  G    +K  GY+ +  H++ P
Sbjct: 64  VFFDIAVENKYIGRVLIGLYSDQVPLSVENFIQLSEGYKVKDKYIGYRNTYIHKIYP 120


>UniRef50_Q4QBK2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=6;
           Trypanosomatidae|Rep: Peptidyl-prolyl cis-trans
           isomerase - Leishmania major
          Length = 229

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 42/112 (37%), Positives = 60/112 (53%), Gaps = 4/112 (3%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENF---TLKHTGPGVLSMAN 384
           L  +G  F    P F++QGGD    +G    S++G  F DE+F     KH  PG + MA+
Sbjct: 74  LYYKGTPFHRIIPGFVMQGGDILTKDGRSNVSVFGYPFPDESFEGKAGKHL-PGTVGMAH 132

Query: 385 AGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAAT-LGRPL 537
           +G + NGSQFF    +   LD + VV G V+ G E+V Q+  L  +  G P+
Sbjct: 133 SGPNQNGSQFFFNLGRNEQLDRKFVVVGQVLGGWEIVNQVVKLCGSRCGTPV 184



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 5/60 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-----YKGSIFHRVIP 253
           P V+FD+T +   LG++ +EL  DV P+T ENFR+LCTGE+G+G     YKG+ FHR+IP
Sbjct: 27  PVVYFDITAEGDALGRVSVELFRDVVPRTSENFRSLCTGERGYGQCLLYYKGTPFHRIIP 86


>UniRef50_Q2RZV1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Bacteria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Salinibacter ruber (strain DSM 13855)
          Length = 706

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 38/96 (39%), Positives = 53/96 (55%)
 Frame = +1

Query: 217 RLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGAD 396
           R  G+ F    P+F++QGGDF   +G GG   +      E   + H   G + MA+AG D
Sbjct: 599 RYDGVPFHRVVPNFVVQGGDFARRDGFGGPGFF---LRTEATRIGHRR-GTIGMASAGTD 654

Query: 397 TNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
           T GSQFF++      LDG +  FG V +GMEVV ++
Sbjct: 655 TEGSQFFVSHSMQPHLDGSYTAFGRVTDGMEVVDRL 690


>UniRef50_Q6L1D0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=6;
           cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase - Picrophilus torridus
          Length = 151

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 40/86 (46%), Positives = 51/86 (59%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           F++QGGD T   G GG    G   +DE         G +SMANAG +T GSQFFI  V  
Sbjct: 50  FVIQGGDPTG-TGMGGP---GYTIKDEFTNHNRNDRGTISMANAGPNTGGSQFFINLVNN 105

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIETL 513
           ++LD +H VFG V+ GM+VV +I  L
Sbjct: 106 NYLDKKHPVFGKVINGMDVVDKIGNL 131



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 28/57 (49%), Positives = 31/57 (54%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I IEL  D  P T  NFR L   E GF Y G+IFHRVI      +G  PT T +G
Sbjct: 11  GNIEIELFEDDMPVTAGNFRKLV--ESGF-YNGTIFHRVIK-DFVIQGGDPTGTGMG 63


>UniRef50_Q8WUA2 Cluster: Peptidyl-prolyl cis-trans isomerase-like
           4; n=28; Eukaryota|Rep: Peptidyl-prolyl cis-trans
           isomerase-like 4 - Homo sapiens (Human)
          Length = 492

 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 41/92 (44%), Positives = 58/92 (63%), Gaps = 9/92 (9%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NF-------TLKHTGPGVLSMANAGADTNGSQ 411
           F++Q GD T   G GG+SI+G  + D+ +F        +KH   G +SM N G+D +GSQ
Sbjct: 49  FIIQTGDPTG-TGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQ 107

Query: 412 FFITTVKT-SWLDGRHVVFGNVVEGMEVVKQI 504
           F ITT +   +LDG H VFG V EGM+++K+I
Sbjct: 108 FLITTGENLDYLDGVHTVFGEVTEGMDIIKKI 139


>UniRef50_A3XNT1 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Bacteria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Leeuwenhoekiella blandensis MED217
          Length = 392

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 54/140 (38%), Positives = 72/140 (51%), Gaps = 20/140 (14%)
 Frame = +1

Query: 202 WRERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSM 378
           ++++    GL F      FM+QGGD  N  G+GG    G KF DE +  LKH   GVLSM
Sbjct: 72  YKKKPYFDGLKFHRIIKDFMIQGGD-PNGTGSGGP---GYKFHDEFSPELKHDTIGVLSM 127

Query: 379 ANAGADTNGSQFFITTVKTSWLDGR----------------HVVFGNVVEGMEVVK---Q 501
           AN+G  TNGSQFFIT   T  LDG                 H VFG ++ G +V+K   +
Sbjct: 128 ANSGYGTNGSQFFITDAPTPHLDGYDAEDNLKNCENPQIGCHTVFGQLILGFDVLKAITE 187

Query: 502 IETLAATLGRPLRESLSKTV 561
           +E      G+P+R    ++V
Sbjct: 188 VEMKDPRRGKPMRPVTMESV 207


>UniRef50_Q6UX04 Cluster: Serologically defined colon cancer antigen
           10, isoform CRA_b; n=43; Eumetazoa|Rep: Serologically
           defined colon cancer antigen 10, isoform CRA_b - Homo
           sapiens (Human)
          Length = 472

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITT 426
           P F++QGGD T   G+GG+SIYG  F+DE +  L+    G+++MANAG+  NGSQFF T 
Sbjct: 59  PGFIVQGGDPTG-TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTL 117

Query: 427 VKTSWLDGRHVVFGNV 474
            +   L+ +H +FG V
Sbjct: 118 GRADELNNKHTIFGKV 133



 Score = 39.9 bits (89), Expect = 0.060
 Identities = 25/57 (43%), Positives = 28/57 (49%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I IEL S   PK C NF  LC       Y  +IFHRV+P     +G  PT T  G
Sbjct: 22  GDIDIELWSKEAPKACRNFIQLCLEAY---YDNTIFHRVVP-GFIVQGGDPTGTGSG 74


>UniRef50_Q9RT72 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Deinococcus|Rep: Peptidyl-prolyl cis-trans isomerase -
           Deinococcus radiodurans
          Length = 350

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 43/100 (43%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGD-------FTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMAN 384
           G  F      FM QGGD        ++  GTGG    G +F +E  +L     GVL+MAN
Sbjct: 228 GTRFHRVIEGFMAQGGDPQSADTALSDRWGTGGP---GYQFANERSSLTFNRAGVLAMAN 284

Query: 385 AGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
           AG DTNGSQFFIT   T +L+G + +FG V  GM+ V ++
Sbjct: 285 AGPDTNGSQFFITFGPTEFLNGGYTIFGQVDSGMDAVNKL 324


>UniRef50_UPI00006CAF6D Cluster: peptidyl-prolyl cis-trans
           isomerase, cyclophilin-type family protein; n=1;
           Tetrahymena thermophila SB210|Rep: peptidyl-prolyl
           cis-trans isomerase, cyclophilin-type family protein -
           Tetrahymena thermophila SB210
          Length = 931

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 38/103 (36%), Positives = 59/103 (57%), Gaps = 1/103 (0%)
 Frame = +1

Query: 208 ERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANA 387
           +RL  +   F +   +  +QGG F+       +SI+G  FEDEN+ +KH  PG++ MAN 
Sbjct: 264 QRLTYKNTLFHAIQKNAFIQGGAFSEFEKD--ESIFGPTFEDENYAIKHDQPGIVGMANQ 321

Query: 388 GA-DTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           G   TN SQF+IT       D ++V FG VV GM+ ++++  +
Sbjct: 322 GVPHTNASQFYITLGAQPDKDQKYVAFGLVVYGMKYLRKLNKI 364



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 6/44 (13%)
 Frame = +2

Query: 134 KIVIELRSDVTPKTCENFRALCTG----EKG--FGYKGSIFHRV 247
           +I+I+L S + PKTC NF  LC G     KG    YK ++FH +
Sbjct: 233 RIIIQLNSKIMPKTCLNFYQLCQGNFKNSKGQRLTYKNTLFHAI 276


>UniRef50_Q9XXI7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Caenorhabditis|Rep: Peptidyl-prolyl cis-trans isomerase
           - Caenorhabditis elegans
          Length = 483

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 42/87 (48%), Positives = 52/87 (59%), Gaps = 3/87 (3%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADT 399
           +G  F     +F+LQGGD T   GTGG+SIYG  F+DE +  LK    G++ MANAG D 
Sbjct: 50  KGTVFHRLVKNFILQGGDPTA-TGTGGESIYGKPFKDEIHQRLKFNRRGIVGMANAGRDD 108

Query: 400 NGSQFFITTVK--TSWLDGRHVVFGNV 474
           NGSQFF T        LD +H +FG V
Sbjct: 109 NGSQFFFTIGDRGAPELDKKHTIFGKV 135



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I IEL +   P  C NF  LC       YKG++FHR++  +   +G  PT T  G
Sbjct: 22  GDIEIELWTKEAPLACRNFIQLCMENY---YKGTVFHRLVK-NFILQGGDPTATGTG 74


>UniRef50_Q1IW71 Cluster: Peptidylprolyl isomerase precursor; n=1;
           Deinococcus geothermalis DSM 11300|Rep: Peptidylprolyl
           isomerase precursor - Deinococcus geothermalis (strain
           DSM 11300)
          Length = 254

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 44/107 (41%), Positives = 59/107 (55%), Gaps = 8/107 (7%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHN-------GTGGKSIYGNKFEDE-NFTLKHTGPGVLSMA 381
           GL F      FM Q GD  + +       GTGG    G +F DE    L    PG+L+MA
Sbjct: 125 GLRFHRVIDGFMAQTGDPKSADEAKKAEWGTGGP---GYQFADEFRSKLTFDSPGILAMA 181

Query: 382 NAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAAT 522
           N+G  TNGSQFFIT   T +L+GRH +FG V+ G +V+ ++   + T
Sbjct: 182 NSGPATNGSQFFITFAPTDFLNGRHTIFGKVISGDDVLDKLTRTSDT 228


>UniRef50_Q0SAE5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=20;
           cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase - Rhodococcus sp. (strain RHA1)
          Length = 209

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 48/106 (45%), Positives = 60/106 (56%), Gaps = 4/106 (3%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSI-YGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD T   G GG    +G++F  E   L+     +L+MANAG  TNGSQFFITT  
Sbjct: 105 FMIQGGDPTG-TGAGGPGYKFGDEFHPE---LQFDRAYILAMANAGPGTNGSQFFITTGP 160

Query: 433 TSWLDGRHVVFGNVV--EGMEVVKQIETLAA-TLGRPLRESLSKTV 561
           T  L+ RH +FG VV  E  +VV  I T A     RPL   +  +V
Sbjct: 161 TPHLNRRHTIFGEVVDEESKKVVDAISTTATDRADRPLEPVVINSV 206



 Score = 33.1 bits (72), Expect = 6.9
 Identities = 26/69 (37%), Positives = 30/69 (43%), Gaps = 12/69 (17%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFG------------YKGSIFHRVIPISCCKEG 274
           G I I L  +  PKT ENF  L  G K +             Y G+IFHRVI      +G
Sbjct: 51  GDIKIALFGNHAPKTVENFVGLADGSKDYSTANAGGTDSGPFYDGAIFHRVID-GFMIQG 109

Query: 275 TSPTITALG 301
             PT T  G
Sbjct: 110 GDPTGTGAG 118


>UniRef50_Q9SUV0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=5;
           Magnoliophyta|Rep: Peptidyl-prolyl cis-trans isomerase -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 857

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 37/74 (50%), Positives = 45/74 (60%), Gaps = 8/74 (10%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGS 232
           K   P+VF DV++D  P   +V EL  +V PKT ENFRALCTGEKG G        YKGS
Sbjct: 3   KKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGS 62

Query: 233 IFHRVIPISCCKEG 274
            FHR++  S  + G
Sbjct: 63  FFHRIMKGSSAQAG 76



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 34/92 (36%), Positives = 47/92 (51%), Gaps = 2/92 (2%)
 Frame = +1

Query: 265 QGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWL 444
           Q GDF N NGT G+SIY  KF           PG  +     A  N + F IT  +   L
Sbjct: 74  QAGDFVNRNGTAGESIYAGKF-----------PGWFTT----AIFNSNLFTITLARYESL 118

Query: 445 DG--RHVVFGNVVEGMEVVKQIETLAATLGRP 534
           D    +VVFG +++G E++K+IE +    G+P
Sbjct: 119 DSLLNNVVFGKLIQGKEILKKIERVGDEEGKP 150


>UniRef50_Q1ING9 Cluster: Peptidylprolyl isomerase precursor; n=4;
           cellular organisms|Rep: Peptidylprolyl isomerase
           precursor - Acidobacteria bacterium (strain Ellin345)
          Length = 266

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 43/94 (45%), Positives = 58/94 (61%), Gaps = 1/94 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTN 402
           G  F    P+FM+QGGD     GTG     G KF+DE N  L    P  L+MAN+GA+TN
Sbjct: 121 GTQFHRVIPNFMVQGGD---PMGTG-MGDPGYKFKDEFNSDLNFDRPARLAMANSGANTN 176

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 504
           GSQFFIT V T  L+ +H +FG   + +++V+Q+
Sbjct: 177 GSQFFITEVPTPHLNQKHTIFGQ-CDNVDLVQQM 209


>UniRef50_A0JQU3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=20;
           cellular organisms|Rep: Peptidyl-prolyl cis-trans
           isomerase - Arthrobacter sp. (strain FB24)
          Length = 181

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 47/110 (42%), Positives = 62/110 (56%), Gaps = 8/110 (7%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGAD----TNGSQFFI 420
           FM+Q GD     G GG    G KF+DE +  L    P  L+MANAG      TNGSQFFI
Sbjct: 71  FMIQAGDPLGR-GVGGP---GYKFDDEIHPELTFNEPYKLAMANAGIQMGKGTNGSQFFI 126

Query: 421 TTVKTSWLDGRHVVFGNVV--EGMEVVKQIETLAATLG-RPLRESLSKTV 561
           TT+ T WL G+H +FG V   E  +VV  IE +   +G RP+ + +  ++
Sbjct: 127 TTIPTDWLQGKHSIFGEVADEESKKVVDAIEGVRTGMGDRPVEDVVINSI 176



 Score = 33.9 bits (74), Expect = 4.0
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 13/54 (24%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFG-------------YKGSIFHRVI 250
           LG IV+ L  +  PKT +NF  L TGE+ +              Y G+IFHR+I
Sbjct: 15  LGDIVVNLFGNHAPKTVKNFVGLATGEQAWTHPETGEDKTGTPLYNGTIFHRII 68


>UniRef50_A2DEW6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Trichomonas vaginalis G3|Rep: Peptidyl-prolyl cis-trans
           isomerase - Trichomonas vaginalis G3
          Length = 554

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 38/89 (42%), Positives = 55/89 (61%), Gaps = 3/89 (3%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFTL---KHTGPGVLSMANAGADTNGSQFFITT 426
           F +Q GD T  +G GG+SI+G  F+DEN        +   ++ MAN G +TNGSQFFITT
Sbjct: 444 FCIQMGDPTG-SGIGGESIWGGYFDDENLDNVINNFSEAWMVGMANEGKNTNGSQFFITT 502

Query: 427 VKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
                L+G+H  +G +V G E +++I T+
Sbjct: 503 NPAPSLNGKHTCWGRLVSGKETIQKIMTV 531


>UniRef50_A0DRH4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Paramecium tetraurelia|Rep: Peptidyl-prolyl cis-trans
           isomerase - Paramecium tetraurelia
          Length = 201

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 34/88 (38%), Positives = 49/88 (55%)
 Frame = +1

Query: 292 GTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGN 471
           G  G SIYG  F DEN+ +KH   G+L+ +N   ++N + F IT     WLD + V FG 
Sbjct: 86  GALGGSIYGKTFPDENYRIKHDRVGLLTTSNPKINSNDAGFIITLGPAEWLDKKSVAFGE 145

Query: 472 VVEGMEVVKQIETLAATLGRPLRESLSK 555
           V+ G++ V+ IE L    G P +  + K
Sbjct: 146 VIYGLQHVRAIEKLGGLSGAPKKSVVIK 173



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 4/61 (6%)
 Frame = +2

Query: 83  SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTG----EKGFGYKGSIFHRVI 250
           +L RVFFDV V   PLG+IV +L  ++ PKT  NF  +  G     K   Y+ +  H+++
Sbjct: 19  ALTRVFFDVEVSGNPLGRIVFQLFDNIAPKTATNFLRIAQGVQVDGKKLHYQDTQIHKIL 78

Query: 251 P 253
           P
Sbjct: 79  P 79


>UniRef50_A2WRT5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Oryza sativa|Rep: Peptidyl-prolyl cis-trans isomerase -
           Oryza sativa subsp. indica (Rice)
          Length = 499

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 2/75 (2%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGAD-TNGSQFFITTV 429
           F++QGGD T  +GTGG+SIYG  F DE  T L+    G+++ ANAG   +NGSQFFI+  
Sbjct: 61  FLVQGGDPTG-SGTGGESIYGAPFADEFHTRLRFNHRGLVACANAGTPHSNGSQFFISLD 119

Query: 430 KTSWLDGRHVVFGNV 474
           +  WLD ++ +FG V
Sbjct: 120 RCDWLDKKNTIFGKV 134



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 23/57 (40%), Positives = 30/57 (52%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G + IEL     PK   NF  LC   +G+ Y G++FHRVI  S   +G  PT +  G
Sbjct: 22  GPLDIELWPKEAPKAVRNFVQLCL--EGY-YDGTLFHRVIK-SFLVQGGDPTGSGTG 74


>UniRef50_Q4DVC9 Cluster: Peptidyl-prolyl cis-trans isomerase; n=3;
           Trypanosoma|Rep: Peptidyl-prolyl cis-trans isomerase -
           Trypanosoma cruzi
          Length = 325

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 45/112 (40%), Positives = 60/112 (53%), Gaps = 6/112 (5%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGK--SIYG-NKFEDENFTLKHTGPGVLSMANAGA 393
           +G +F    P F +QGGD T     G    S +G   F DEN   +    G+L MAN G 
Sbjct: 121 RGTYFHKIIPAFCVQGGDLTMRVNKGANHFSSFGWGWFSDENKRRRLNEVGLLLMANNGP 180

Query: 394 DTNGSQFFITT--VKTSWLDGRHVVFGNVVEGM-EVVKQIETLAATLGRPLR 540
           ++NGSQFFITT   +   L+GRHV FG VV G+ E ++++       G P R
Sbjct: 181 NSNGSQFFITTSDSEEKALNGRHVCFGRVVRGLDEFLREVAPYGEINGNPSR 232



 Score = 39.5 bits (88), Expect = 0.080
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 13/60 (21%)
 Frame = +2

Query: 134 KIVIELRSDVTPKTCENFRALCTGE----KGFG---------YKGSIFHRVIPISCCKEG 274
           +I  EL  D +PK C NFR LC G+    KG           Y+G+ FH++IP  C + G
Sbjct: 78  RIEFELFDDESPKACANFRHLCAGQSTSRKGQTYCYQGLTPCYRGTYFHKIIPAFCVQGG 137


>UniRef50_Q388S5 Cluster: Cyclophilin type peptidyl-prolyl cis-trans
            isomerase, putative; n=1; Trypanosoma brucei|Rep:
            Cyclophilin type peptidyl-prolyl cis-trans isomerase,
            putative - Trypanosoma brucei
          Length = 913

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 45/97 (46%), Positives = 55/97 (56%), Gaps = 5/97 (5%)
 Frame = +1

Query: 229  LHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKH--TGPGV--LSMANAGAD 396
            L F    P FM+QGG   + +GTGG S +G  FEDE        + P V  L MAN G +
Sbjct: 788  LTFHRVVPGFMIQGG-CPHGDGTGGLSSFGEPFEDEGVDAMDFFSYPRVQWLCMANRGPN 846

Query: 397  TNGSQFFITTVK-TSWLDGRHVVFGNVVEGMEVVKQI 504
            TN SQFFIT  + T WL+G+H VFG V  G  VV  +
Sbjct: 847  TNESQFFITLGEATPWLNGKHTVFGFVTAGKSVVLSV 883


>UniRef50_Q4QDV4 Cluster: Putative uncharacterized protein; n=3;
            Leishmania|Rep: Putative uncharacterized protein -
            Leishmania major
          Length = 1020

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 47/108 (43%), Positives = 58/108 (53%), Gaps = 12/108 (11%)
 Frame = +1

Query: 229  LHFPSCHPHFMLQGGDFTNHNGTGGKSIY--GNKFEDENFTL----KHTGPGV---LSMA 381
            L F    P  ++QGG     +GTGG+S +  G  F DE  TL     HT   +   L MA
Sbjct: 893  LTFHRVIPAAIVQGG-CPRGDGTGGESAFADGAPFSDEGLTLFPFFSHTANPLCCWLCMA 951

Query: 382  NAGADTNGSQFFITTV---KTSWLDGRHVVFGNVVEGMEVVKQIETLA 516
            NAG +TNGSQFF T        WLDG H VFG  VEG++VV+ +   A
Sbjct: 952  NAGPNTNGSQFFFTVPGGEAMPWLDGHHTVFGYAVEGLDVVRAMSIAA 999


>UniRef50_A1A249 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Bifidobacterium adolescentis|Rep: Peptidyl-prolyl
           cis-trans isomerase - Bifidobacterium adolescentis
           (strain ATCC 15703 / DSM 20083)
          Length = 179

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 49/108 (45%), Positives = 58/108 (53%), Gaps = 12/108 (11%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGA--- 393
           GL F      FM+QGG     NGTGG    G  F+DE    LK   P +L+MANAG    
Sbjct: 55  GLTFHRIIKDFMIQGGCPLG-NGTGGP---GYDFDDEIVPDLKFDHPYLLAMANAGLRRG 110

Query: 394 ------DTNGSQFFITTVKTSWLDGRHVVFGNVV--EGMEVVKQIETL 513
                  TNGSQFFITTV T WLDG H +FG V   +   VV ++E +
Sbjct: 111 MDGKIHGTNGSQFFITTVPTPWLDGHHTIFGEVADDDSKAVVDKLEAV 158


>UniRef50_Q9CDE9 Cluster: Probable peptidyl-prolyl cis-trans
           isomerase A; n=23; Bacteria|Rep: Probable
           peptidyl-prolyl cis-trans isomerase A - Mycobacterium
           leprae
          Length = 182

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 44/90 (48%), Positives = 54/90 (60%), Gaps = 3/90 (3%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD T   G GG    G KF DE +  L+   P +L+MANAG  TNGSQFFIT  +
Sbjct: 78  FMIQGGDPTG-TGRGGP---GYKFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGE 133

Query: 433 TSWLDGRHVVFGNVV--EGMEVVKQIETLA 516
           T  L+ RH +FG V   +  +VV  I T A
Sbjct: 134 TPHLNRRHTIFGEVTDPDSQKVVDAISTTA 163


>UniRef50_A7QD90 Cluster: Chromosome undetermined scaffold_80, whole
           genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_80, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 627

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 47/115 (40%), Positives = 62/115 (53%), Gaps = 10/115 (8%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIY----GNK---FEDE-NFTLKHTGPGVLSMA 381
           G  F      F  Q GD T   GTGG SIY    G++   F DE +  LKH+  G ++MA
Sbjct: 39  GCLFHMVQKDFTAQTGDPTA-TGTGGDSIYKFLYGDQARFFNDEVHLDLKHSKTGTVAMA 97

Query: 382 NAGADTNGSQFFIT-TVKTSWLDGRHVVFGNVVEGMEVVKQI-ETLAATLGRPLR 540
           +AG + N SQF+ T      +LDG+H VFG V EG+E + +I E      GRP +
Sbjct: 98  SAGENLNASQFYFTLRDDLDYLDGKHTVFGEVAEGLETLTRINEAYVDDKGRPYK 152



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 23/58 (39%), Positives = 29/58 (50%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           LG IV++L +D  P T +NF  LC   K   Y G +FH V      + G  PT T  G
Sbjct: 9   LGDIVVDLYTDRCPLTSKNFLKLC---KIKYYNGCLFHMVQKDFTAQTG-DPTATGTG 62


>UniRef50_A5BCZ5 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Vitis vinifera|Rep: Peptidyl-prolyl cis-trans isomerase
           - Vitis vinifera (Grape)
          Length = 522

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 47/115 (40%), Positives = 62/115 (53%), Gaps = 10/115 (8%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIY----GNK---FEDE-NFTLKHTGPGVLSMA 381
           G  F      F  Q GD T   GTGG SIY    G++   F DE +  LKH+  G ++MA
Sbjct: 39  GCLFHMVQKDFTAQTGDPTA-TGTGGDSIYKFLYGDQARFFNDEVHLDLKHSKTGTVAMA 97

Query: 382 NAGADTNGSQFFIT-TVKTSWLDGRHVVFGNVVEGMEVVKQI-ETLAATLGRPLR 540
           +AG + N SQF+ T      +LDG+H VFG V EG+E + +I E      GRP +
Sbjct: 98  SAGENLNASQFYFTLRDDLDYLDGKHTVFGEVAEGLETLTRINEAYVDDKGRPYK 152



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 23/58 (39%), Positives = 29/58 (50%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           LG IV++L +D  P T +NF  LC   K   Y G +FH V      + G  PT T  G
Sbjct: 9   LGDIVVDLYTDRCPLTSKNFLKLC---KIKYYNGCLFHMVQKDFTAQTG-DPTATGTG 62


>UniRef50_A2XN96 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Oryza sativa|Rep: Peptidyl-prolyl cis-trans isomerase -
           Oryza sativa subsp. indica (Rice)
          Length = 255

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 30/55 (54%), Positives = 37/55 (67%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANA 387
           +G  F      FM+QGGD+   +GTG  SIYG KF+DENF  KHTGPG+LSM  +
Sbjct: 87  KGCQFHRVIKDFMIQGGDYMKGDGTGCTSIYGTKFDDENFIAKHTGPGLLSMVRS 141



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 34/59 (57%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE---KGF--GYKGSIFHRVI 250
           P VFFDVT+   P G+I +EL +D+ PKT ENFR  CTGE    G   GYKG  FHRVI
Sbjct: 37  PVVFFDVTIGSIPAGRIKMELFADIVPKTAENFRQFCTGEHRKSGLPQGYKGCQFHRVI 95



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/37 (56%), Positives = 27/37 (72%), Gaps = 1/37 (2%)
 Frame = +1

Query: 409 QFFITTVKTSWLDGRHVVFGNVV-EGMEVVKQIETLA 516
           QFFIT  K  WLD +HVVFG V+ +GM  V++IE +A
Sbjct: 200 QFFITCAKCEWLDNKHVVFGRVLGDGMLAVRKIENVA 236


>UniRef50_A7AUH3 Cluster: Peptidyl-prolyl cis-trans isomerase,
           cyclophilin-type family protein; n=1; Babesia bovis|Rep:
           Peptidyl-prolyl cis-trans isomerase, cyclophilin-type
           family protein - Babesia bovis
          Length = 354

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 8/114 (7%)
 Frame = +1

Query: 190 CPVHWRE--RLRLQGLH----FPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFT-L 348
           CP+  R   +L L+G +    F    P FM+Q GD T   G GG+SIYG  FE+E  + L
Sbjct: 33  CPLAVRNFVQLCLEGYYNNCIFHRIIPQFMVQTGDPTG-TGHGGESIYGECFENEIVSRL 91

Query: 349 KHTGPGVLSMANAGAD-TNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           K    G++ MAN G   TNGSQFFIT  +   L+G++ +FG  +EG  V   I+
Sbjct: 92  KFRYRGLVGMANTGGKRTNGSQFFITLERADCLNGKYTLFGK-IEGNTVYNLIK 144


>UniRef50_Q6FPI7 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Candida glabrata|Rep: Peptidyl-prolyl cis-trans
           isomerase - Candida glabrata (Yeast) (Torulopsis
           glabrata)
          Length = 322

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 39/96 (40%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGA 393
           LR  G  F +  P+  + GG+     G    SIYG+K+ +ENF LK   PG ++M N G 
Sbjct: 98  LRYPGTKFTNVLPNKYILGGEILP--GISPYSIYGDKWPEENFDLKFDRPGRIAMWNHGQ 155

Query: 394 DTNGSQFFITT--VKTSWLDGRHVVFGNVVEGMEVV 495
               SQFFI+T     + LDGR+ +FG VV G++V+
Sbjct: 156 GKQESQFFISTNPKPDTELDGRYSIFGQVVSGLDVI 191


>UniRef50_A7EA49 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 158

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 4/93 (4%)
 Frame = +1

Query: 277 FTNHNGTGGKSIYGNKFEDENF-TLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGR 453
           F++     G SI+   F DE   TL+H   G++SMAN G  TNGSQFFI       LDG+
Sbjct: 14  FSSPPPKSGTSIWETPFADEILPTLRHNARGIVSMANKGPCTNGSQFFILFAPAPHLDGQ 73

Query: 454 HVVFGNVV--EGMEVVKQIETLAA-TLGRPLRE 543
           + VFG+V+  EGM V+ ++E L      RPL +
Sbjct: 74  NTVFGHVIGEEGMRVLGELERLEVDRKNRPLEK 106


>UniRef50_Q7PYL0 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Anopheles gambiae str. PEST|Rep: Peptidyl-prolyl
           cis-trans isomerase - Anopheles gambiae str. PEST
          Length = 662

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 1/51 (1%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKG-SIF 238
           P  FF V ++  P G+I+IE+R+DV PK  +NF ALCTGE GFGYKG SIF
Sbjct: 499 PIYFFSVEINGQPFGRILIEVRNDVAPKMAKNFGALCTGELGFGYKGCSIF 549



 Score = 36.7 bits (81), Expect = 0.56
 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 5/109 (4%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKF--EDENFTLKHTGPGVLSMANAGAD 396
           +G     C  +  +  GDF  +NG GG+S++   F   D+   L   G   +  +    D
Sbjct: 544 KGCSIFQCWENESIITGDFELNNGRGGRSVFEEGFFMPDDTKILAIRGSVGMRRSQKRHD 603

Query: 397 TN---GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
                GSQF I   +     G   +F  VVEG+++V++I     + G+P
Sbjct: 604 NMGLVGSQFRIILREMRGFTG---IFAFVVEGLDLVEKISQAGDSAGKP 649


>UniRef50_Q4Q1A6 Cluster: Peptidyl-prolyl cis-trans isomerase; n=6;
           Trypanosomatidae|Rep: Peptidyl-prolyl cis-trans
           isomerase - Leishmania major
          Length = 266

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 41/97 (42%), Positives = 53/97 (54%), Gaps = 4/97 (4%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFE--DENFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           +++QGGD  +  GTG  SIYG  F+  +E    K    G+L  A +    NGSQFFI T 
Sbjct: 158 YLVQGGDIVSGQGTGQLSIYGESFDAPEEVKASKFDRMGLLGTAVSAPHLNGSQFFILTA 217

Query: 430 -KTSWLDGRHVVFGNVVEGMEVVKQIETLAAT-LGRP 534
            K   L+G  + FG VV+G  VVK IE +  T  G P
Sbjct: 218 DKAPHLNGTCICFGRVVDGWTVVKAIEAIPLTAAGEP 254



 Score = 32.7 bits (71), Expect = 9.2
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +2

Query: 98  FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE 208
           F D+ +   P  ++  EL +   P   ENF  LCTGE
Sbjct: 83  FMDIAIGSQPPHRVTFELFTKRCPIASENFLKLCTGE 119


>UniRef50_Q54CU3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Dictyostelium discoideum AX4|Rep: Peptidyl-prolyl
           cis-trans isomerase - Dictyostelium discoideum AX4
          Length = 489

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 43/112 (38%), Positives = 66/112 (58%), Gaps = 10/112 (8%)
 Frame = +1

Query: 235 FPSCHPHFMLQGGDFTNHNGTGGKSIYG-------NKFEDE-NFTLKHTGPGVLSMANAG 390
           F +    F+++ GD +N  G GG+SIYG         F+DE   +L+H   G ++MAN  
Sbjct: 42  FYNVQKDFLVECGDPSN-TGKGGESIYGLLYGNEAKYFQDEIKKSLRHNEIGTVAMANTS 100

Query: 391 ADTNGSQFFITTVKT-SWLDGRHVVFGNVVEGMEVVKQI-ETLAATLGRPLR 540
            D N S+F+IT     + L+ +H +FG VVEG+EV+K+I  T + +  RPL+
Sbjct: 101 KDKNDSKFYITLKSDLNELNDKHTIFGRVVEGIEVLKKINSTFSDSNNRPLQ 152


>UniRef50_Q6ZQM2 Cluster: CDNA fis, clone TRACH3016614, moderately
           similar to Peptidyl-prolyl cis-trans isomerase B; n=2;
           Murinae|Rep: CDNA fis, clone TRACH3016614, moderately
           similar to Peptidyl-prolyl cis-trans isomerase B - Mus
           musculus (Mouse)
          Length = 142

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 29/53 (54%), Positives = 37/53 (69%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +V+FD+ + D  +G++V  L     PKT +NF AL TGEKGFGYK S FHRVI
Sbjct: 45  KVYFDLQIGDESVGRVVFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVI 97


>UniRef50_A0BRF8 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Paramecium tetraurelia|Rep: Peptidyl-prolyl cis-trans
           isomerase - Paramecium tetraurelia
          Length = 544

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 37/90 (41%), Positives = 50/90 (55%), Gaps = 1/90 (1%)
 Frame = +1

Query: 259 MLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVKT 435
           +L+GGD T   G GG+SI+G  F  E N  L H+  G++SM N GA    S FFIT  + 
Sbjct: 359 LLEGGDPTA-TGYGGESIFGKPFRIEINNLLSHSKAGMVSMGNLGATHQTSHFFITLAEC 417

Query: 436 SWLDGRHVVFGNVVEGMEVVKQIETLAATL 525
              D ++ VFG VV G + + QI  L   +
Sbjct: 418 KKYDSKYAVFGEVVGGFQTLYQINKLPTNM 447



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 26/57 (45%), Positives = 31/57 (54%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I  EL  D+ P TCENF  LC  EKG+ Y  + FH++I      EG  PT T  G
Sbjct: 319 GNINFELHCDLVPMTCENFLELC--EKGY-YNQTKFHKLIENELL-EGGDPTATGYG 371


>UniRef50_Q4L4W9 Cluster: Putative peptidyl-prolyl cis-trans
           isomerase; n=86; Bacilli|Rep: Putative peptidyl-prolyl
           cis-trans isomerase - Staphylococcus haemolyticus
           (strain JCSC1435)
          Length = 198

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 38/70 (54%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGP-GVLSMANAGADTN 402
           G+ F      FM+QGGD T   G GG+SIYG  FEDE F+L+     G LSMANAG +TN
Sbjct: 54  GITFHRVINDFMIQGGDPTA-TGMGGESIYGGSFEDE-FSLEAFNLYGALSMANAGPNTN 111

Query: 403 GSQFFITTVK 432
           GSQFF+  +K
Sbjct: 112 GSQFFVVQMK 121



 Score = 36.7 bits (81), Expect = 0.56
 Identities = 23/57 (40%), Positives = 28/57 (49%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G +  +L  D+ PKT ENF    T  K   Y G  FHRVI      +G  PT T +G
Sbjct: 25  GDMTFKLFPDIAPKTVENF---VTHAKNGYYDGITFHRVIN-DFMIQGGDPTATGMG 77


>UniRef50_Q4S257 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Tetraodon nigroviridis|Rep: Peptidyl-prolyl cis-trans
           isomerase - Tetraodon nigroviridis (Green puffer)
          Length = 587

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 35/57 (61%), Positives = 42/57 (73%), Gaps = 1/57 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFIT 423
           FM+Q GD T   G GG+SI+G +FEDE + TL+H  P  LSMANAG  +NGSQFFIT
Sbjct: 459 FMIQTGDPTG-TGMGGESIWGGEFEDEFHPTLRHDRPYTLSMANAGPASNGSQFFIT 514



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 25/71 (35%), Positives = 32/71 (45%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P+   D  +    +G I I+L     PKT ENF   C   +   Y   IFHRVI     +
Sbjct: 406 PKRVSDSAIIHTTMGDIHIKLFPVECPKTVENF---CVHSRNGYYNNHIFHRVIKGFMIQ 462

Query: 269 EGTSPTITALG 301
            G  PT T +G
Sbjct: 463 TG-DPTGTGMG 472


>UniRef50_P25334 Cluster: Peptidyl-prolyl cis-trans isomerase CPR4
           precursor; n=2; Saccharomyces cerevisiae|Rep:
           Peptidyl-prolyl cis-trans isomerase CPR4 precursor -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 318

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +1

Query: 247 HPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITT 426
           +P+  +QGG        G  ++YG KF+DENF LKH  P  L+MA  G D+N S+F ITT
Sbjct: 117 YPNKYIQGGVVAPD--VGPFTVYGPKFDDENFYLKHDRPERLAMAYFGPDSNTSEFIITT 174

Query: 427 VK--TSWLDGRHVVFGNVVEGME 489
                  LDG+ VVFG +  G++
Sbjct: 175 KADGNEELDGKSVVFGQITSGLD 197


>UniRef50_Q01DA3 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Eukaryota|Rep: Peptidyl-prolyl cis-trans isomerase -
           Ostreococcus tauri
          Length = 756

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 37/81 (45%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = +1

Query: 301 GKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVE 480
           G S    K +   FT  H   GVLSMAN+G +TNGSQFFIT   +  L+G+H VFG VV 
Sbjct: 572 GASASMTKSKGNPFT--HDDRGVLSMANSGKNTNGSQFFITYKPSPHLNGKHTVFGRVVG 629

Query: 481 GMEVVKQIETLAATLG-RPLR 540
           G+E + + E +      RPL+
Sbjct: 630 GLETLSKCEAVETDASDRPLK 650



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 20/39 (51%), Positives = 23/39 (58%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHR 244
           LG + IEL  D   +TCENF  L   EKG+ Y G  FHR
Sbjct: 526 LGDLNIELHCDRAHRTCENFITL--AEKGY-YDGCKFHR 561


>UniRef50_Q4N4P2 Cluster: Peptidyl-prolyl cis-trans isomerase; n=2;
           Theileria|Rep: Peptidyl-prolyl cis-trans isomerase -
           Theileria parva
          Length = 445

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = +1

Query: 250 PHFMLQGGDFTNHNGTGGKSIYGNKFEDENFT-LKHTGPGVLSMANAGAD-TNGSQFFIT 423
           P+FM+Q GD  +  G GG+S+YG  FE+E  + LK    G+++MAN G   +N SQFFIT
Sbjct: 59  PNFMVQTGD-PSGTGNGGESVYGEPFENEIVSRLKFRNRGMVAMANTGGKCSNMSQFFIT 117

Query: 424 TVKTSWLDGRHVVFGNVVEGMEV 492
             ++ +L+G++ +FG  VEG  +
Sbjct: 118 LDRSDFLNGKYTLFGK-VEGNSI 139



 Score = 37.9 bits (84), Expect = 0.24
 Identities = 21/42 (50%), Positives = 24/42 (57%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           LG + I L S   PK C NF  LC   +G+ Y   IFHRVIP
Sbjct: 21  LGDLDIHLWSSHCPKACRNFIQLCL--EGY-YNNCIFHRVIP 59


>UniRef50_Q75EN4 Cluster: Peptidyl-prolyl cis-trans isomerase; n=1;
           Eremothecium gossypii|Rep: Peptidyl-prolyl cis-trans
           isomerase - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 309

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 2/63 (3%)
 Frame = +1

Query: 307 SIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITT--VKTSWLDGRHVVFGNVVE 480
           SI+G  F+DENF +KH  PG L+M N G D+N SQF+I T        DG++VVFG V +
Sbjct: 128 SIHGQTFKDENFDIKHDRPGRLAMVNDGPDSNHSQFYIVTSLEPLEENDGKNVVFGQVYD 187

Query: 481 GME 489
           G+E
Sbjct: 188 GLE 190



 Score = 33.1 bits (72), Expect = 6.9
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 10/50 (20%)
 Frame = +2

Query: 134 KIVIELRSDVTPKTCENFRALCTGEKG----------FGYKGSIFHRVIP 253
           +I IEL   V P T +NFR +  G K             YK ++FHRV+P
Sbjct: 64  EIGIELYGSVVPDTVKNFREIAKGVKAKIKGTDQVLDITYKNTVFHRVVP 113


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 777,836,223
Number of Sequences: 1657284
Number of extensions: 17491485
Number of successful extensions: 51561
Number of sequences better than 10.0: 483
Number of HSP's better than 10.0 without gapping: 48138
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51197
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57024798702
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -