SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20007
         (719 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P05141 Cluster: ADP/ATP translocase 2; n=61; Eukaryota|...   149   5e-35
UniRef50_P12236 Cluster: ADP/ATP translocase 3; n=11; Euteleosto...   147   2e-34
UniRef50_P12235 Cluster: ADP/ATP translocase 1; n=108; Eukaryota...   147   3e-34
UniRef50_Q9H0C2 Cluster: ADP/ATP translocase 4; n=17; Eukaryota|...   132   8e-30
UniRef50_Q16RN6 Cluster: Adp,atp carrier protein; n=1; Aedes aeg...   124   3e-27
UniRef50_UPI0000D67F67 Cluster: PREDICTED: similar to adenine nu...    99   1e-19
UniRef50_Q010A8 Cluster: ADT_CHLKE ADP,ATP carrier protein; n=1;...    93   5e-18
UniRef50_Q18683 Cluster: Putative uncharacterized protein; n=2; ...    93   5e-18
UniRef50_Q86CZ9 Cluster: Putative uncharacterized protein tag-61...    89   8e-17
UniRef50_UPI00005A551B Cluster: PREDICTED: similar to ADP/ATP tr...    88   2e-16
UniRef50_P91270 Cluster: Putative uncharacterized protein F25B4....    87   3e-16
UniRef50_Q76KG1 Cluster: ADP/ATP carrier protein; n=1; Penicilli...    86   7e-16
UniRef50_P04710 Cluster: ADP,ATP carrier protein 1; n=163; Eukar...    84   3e-15
UniRef50_Q21809 Cluster: Putative uncharacterized protein; n=2; ...    77   3e-13
UniRef50_Q5DAY1 Cluster: SJCHGC02793 protein; n=1; Schistosoma j...    77   6e-13
UniRef50_Q20AK0 Cluster: Adenine nucleotide translocator s6; n=1...    76   8e-13
UniRef50_A0E0L6 Cluster: Chromosome undetermined scaffold_71, wh...    74   3e-12
UniRef50_Q8LFZ1 Cluster: ADP/ATP translocase-like protein; n=10;...    74   4e-12
UniRef50_UPI0000DB7B77 Cluster: PREDICTED: similar to ADP/ATP tr...    71   4e-11
UniRef50_A5BXJ8 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-10
UniRef50_Q22HD2 Cluster: Mitochondrial carrier protein; n=1; Tet...    64   3e-09
UniRef50_A7SPF1 Cluster: Predicted protein; n=2; Nematostella ve...    56   1e-06
UniRef50_A5AUY8 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_A5C930 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_A5BXC7 Cluster: Putative uncharacterized protein; n=1; ...    54   4e-06
UniRef50_A7QCR1 Cluster: Chromosome undetermined scaffold_79, wh...    53   6e-06
UniRef50_Q5KJH5 Cluster: Putative uncharacterized protein; n=1; ...    53   6e-06
UniRef50_Q2TZ88 Cluster: Mitochondrial solute carrier protein; n...    53   6e-06
UniRef50_UPI00006CB3EF Cluster: Mitochondrial carrier protein; n...    53   8e-06
UniRef50_A0C2U9 Cluster: Chromosome undetermined scaffold_145, w...    52   2e-05
UniRef50_A4S8E6 Cluster: MC family transporter; n=2; Ostreococcu...    50   6e-05
UniRef50_A0BYX2 Cluster: Chromosome undetermined scaffold_138, w...    50   6e-05
UniRef50_Q24D15 Cluster: Mitochondrial carrier protein; n=1; Tet...    50   8e-05
UniRef50_Q750J8 Cluster: AGL047Cp; n=1; Eremothecium gossypii|Re...    48   2e-04
UniRef50_O04619 Cluster: A_IG002N01.16 protein; n=9; Magnoliophy...    48   3e-04
UniRef50_Q6Z3Q5 Cluster: Putative mitochondrial carrier protein;...    47   4e-04
UniRef50_A0EGA0 Cluster: Chromosome undetermined scaffold_95, wh...    46   7e-04
UniRef50_Q54MZ4 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q54EV4 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q12251 Cluster: Probable mitochondrial carrier YPR011C;...    46   0.001
UniRef50_Q16NW0 Cluster: Mitochondrial carrier protein; n=1; Aed...    46   0.001
UniRef50_Q6C3A2 Cluster: Yarrowia lipolytica chromosome F of str...    46   0.001
UniRef50_Q8S1A3 Cluster: Mitochondrial carrier protein-like; n=4...    45   0.002
UniRef50_Q6CCV8 Cluster: Similar to KLLA0B11319g Kluyveromyces l...    45   0.002
UniRef50_Q9MA27 Cluster: T5E21.6; n=9; Magnoliophyta|Rep: T5E21....    45   0.002
UniRef50_A7TIY4 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A4RUV7 Cluster: MC family transporter: aspartate/glutam...    44   0.003
UniRef50_Q9FI43 Cluster: Calcium-binding transporter-like protei...    44   0.004
UniRef50_A4S3P4 Cluster: MC family transporter; n=2; Ostreococcu...    44   0.004
UniRef50_Q60K80 Cluster: Putative uncharacterized protein CBG241...    44   0.005
UniRef50_Q4Q227 Cluster: Mitochondrial carrier protein, putative...    44   0.005
UniRef50_A0EEK4 Cluster: Chromosome undetermined scaffold_91, wh...    44   0.005
UniRef50_Q8TFH2 Cluster: Mitochondrial transporter; n=1; Schizos...    44   0.005
UniRef50_A7PP43 Cluster: Chromosome chr8 scaffold_23, whole geno...    43   0.007
UniRef50_Q7QHR1 Cluster: ENSANGP00000008222; n=5; Endopterygota|...    43   0.007
UniRef50_A5DUZ3 Cluster: Mitochondrial carrier protein LEU5; n=5...    43   0.007
UniRef50_Q6PJJ9 Cluster: Solute carrier family 25 (Mitochondrial...    43   0.009
UniRef50_UPI0000F211B5 Cluster: PREDICTED: similar to LOC495458 ...    42   0.012
UniRef50_UPI00006D001E Cluster: Mitochondrial carrier protein; n...    42   0.012
UniRef50_UPI00006CC149 Cluster: Mitochondrial carrier protein; n...    42   0.012
UniRef50_Q5BSI2 Cluster: SJCHGC04210 protein; n=3; Bilateria|Rep...    42   0.012
UniRef50_Q38BB0 Cluster: Mitochondrial carrier protein, putative...    42   0.012
UniRef50_Q86AV5 Cluster: Similar to Mus musculus (Mouse). Calciu...    42   0.015
UniRef50_Q54DU1 Cluster: Putative uncharacterized protein; n=1; ...    42   0.015
UniRef50_O75746 Cluster: Calcium-binding mitochondrial carrier p...    42   0.015
UniRef50_Q0E2M9 Cluster: Os02g0226300 protein; n=5; Magnoliophyt...    42   0.020
UniRef50_Q4PC12 Cluster: Putative uncharacterized protein; n=1; ...    42   0.020
UniRef50_Q01DN6 Cluster: Mitochondrial carnitine-acylcarnitine c...    41   0.027
UniRef50_Q01BW9 Cluster: Mitochondrial solute carrier protein; n...    41   0.027
UniRef50_Q5C0G7 Cluster: SJCHGC01451 protein; n=2; Schistosoma j...    41   0.027
UniRef50_A5C1E5 Cluster: Putative uncharacterized protein; n=1; ...    41   0.035
UniRef50_Q4MZZ5 Cluster: Mitochondrial carrier protein, putative...    41   0.035
UniRef50_Q176S5 Cluster: Mitochondrial carrier protein; n=3; Cul...    41   0.035
UniRef50_A6SPK8 Cluster: Carnitine / acyl carnitine carrier; n=2...    41   0.035
UniRef50_A1C808 Cluster: Mitochondrial carrier protein (Leu5), p...    41   0.035
UniRef50_O13805 Cluster: Putative mitochondrial carrier C17H9.08...    41   0.035
UniRef50_A7F8E5 Cluster: Putative uncharacterized protein; n=1; ...    40   0.047
UniRef50_Q86VD7 Cluster: Solute carrier family 25 member 42; n=3...    40   0.047
UniRef50_P16260 Cluster: Grave disease carrier protein; n=29; Co...    40   0.047
UniRef50_Q9VQG4 Cluster: Congested-like trachea protein; n=10; D...    40   0.047
UniRef50_Q9LV81 Cluster: Mitochondrial carrier protein-like; n=8...    40   0.062
UniRef50_Q54FE6 Cluster: Putative uncharacterized protein; n=1; ...    40   0.062
UniRef50_Q22V58 Cluster: Mitochondrial carrier protein; n=1; Tet...    40   0.062
UniRef50_Q4PF91 Cluster: Putative uncharacterized protein; n=1; ...    40   0.062
UniRef50_O95258-3 Cluster: Isoform 3 of O95258 ; n=4; Eutheria|R...    40   0.082
UniRef50_Q9VDL7 Cluster: CG4241-PA, isoform A; n=5; Endopterygot...    40   0.082
UniRef50_Q54QI8 Cluster: Putative uncharacterized protein; n=1; ...    40   0.082
UniRef50_Q0E8F2 Cluster: CG32103-PA, isoform A; n=7; Endopterygo...    40   0.082
UniRef50_Q6CQR3 Cluster: Similar to sp|P53257 Saccharomyces cere...    40   0.082
UniRef50_Q4RPP5 Cluster: Chromosome 12 SCAF15007, whole genome s...    39   0.11 
UniRef50_Q581R5 Cluster: Mitochondrial carrier protein, putative...    39   0.11 
UniRef50_Q6C107 Cluster: Yarrowia lipolytica chromosome F of str...    39   0.11 
UniRef50_Q2TWU9 Cluster: Mitochondrial solute carrier protein; n...    39   0.11 
UniRef50_UPI0000F2C10D Cluster: PREDICTED: similar to Solute car...    39   0.14 
UniRef50_Q96PZ1 Cluster: Solute carrier family 25 member 25; n=1...    39   0.14 
UniRef50_Q9UJS0 Cluster: Calcium-binding mitochondrial carrier p...    39   0.14 
UniRef50_UPI00015B42B4 Cluster: PREDICTED: similar to mitochondr...    38   0.19 
UniRef50_A7SGK5 Cluster: Predicted protein; n=2; Nematostella ve...    38   0.19 
UniRef50_Q4P4I1 Cluster: Putative uncharacterized protein; n=1; ...    38   0.19 
UniRef50_O95258 Cluster: Brain mitochondrial carrier protein 1; ...    38   0.19 
UniRef50_Q9M2Z8 Cluster: Mitochondrial phosphate transporter; n=...    38   0.25 
UniRef50_Q67Z63 Cluster: Mitochondrial carrier like protein; n=1...    38   0.25 
UniRef50_Q55BF4 Cluster: Putative uncharacterized protein; n=1; ...    38   0.25 
UniRef50_Q75EP3 Cluster: AAR036Wp; n=1; Eremothecium gossypii|Re...    38   0.25 
UniRef50_Q6CQV1 Cluster: Similarities with sp|P40556 Saccharomyc...    38   0.25 
UniRef50_UPI00005A1267 Cluster: PREDICTED: similar to solute car...    38   0.33 
UniRef50_Q91TH9 Cluster: T121.1; n=1; Tupaiid herpesvirus 1|Rep:...    38   0.33 
UniRef50_Q8NAU4 Cluster: CDNA FLJ34775 fis, clone NT2NE2003315; ...    38   0.33 
UniRef50_Q5KD66 Cluster: Coenzyme A transporter, putative; n=1; ...    38   0.33 
UniRef50_Q4P0R0 Cluster: Putative uncharacterized protein; n=1; ...    38   0.33 
UniRef50_A2R5Z0 Cluster: Contig An15c0200, complete genome; n=8;...    38   0.33 
UniRef50_A7SPL4 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...    37   0.44 
UniRef50_Q5KJD1 Cluster: Mitochondrial carrier protein, putative...    37   0.44 
UniRef50_Q1EAW9 Cluster: Putative uncharacterized protein; n=1; ...    37   0.44 
UniRef50_Q20799 Cluster: Probable calcium-binding mitochondrial ...    37   0.44 
UniRef50_Q9XI74 Cluster: F7A19.22 protein; n=10; Magnoliophyta|R...    37   0.58 
UniRef50_Q8I4M0 Cluster: Putative uncharacterized protein; n=3; ...    37   0.58 
UniRef50_O01883 Cluster: Uncoupling protein (Mitochondrial subst...    37   0.58 
UniRef50_A7SLQ3 Cluster: Predicted protein; n=2; Nematostella ve...    37   0.58 
UniRef50_Q6C6B6 Cluster: Similar to DEHA0A11253g Debaryomyces ha...    37   0.58 
UniRef50_Q4P222 Cluster: Putative uncharacterized protein; n=1; ...    37   0.58 
UniRef50_P32332 Cluster: Mitochondrial oxaloacetate transport pr...    37   0.58 
UniRef50_P38702 Cluster: Mitochondrial carrier protein LEU5; n=8...    37   0.58 
UniRef50_Q4A3J5 Cluster: Mitochondrial carrier like protein; n=6...    36   0.76 
UniRef50_Q9W0Y9 Cluster: CG2857-PA; n=2; Sophophora|Rep: CG2857-...    36   0.76 
UniRef50_Q54RB9 Cluster: Putative uncharacterized protein; n=1; ...    36   0.76 
UniRef50_Q9HE62 Cluster: Related to peroxisomal Ca-dependent sol...    36   0.76 
UniRef50_Q9FWW1 Cluster: Putative uncharacterized protein OSJNBa...    36   1.0  
UniRef50_A4RZP0 Cluster: MC family transporter: aspartate/glutam...    36   1.0  
UniRef50_Q5VM58 Cluster: Mitochondrial carrier family protein; n...    36   1.0  
UniRef50_Q552L9 Cluster: Putative uncharacterized protein; n=1; ...    36   1.0  
UniRef50_Q4UHC8 Cluster: Splicing factor, putative; n=3; Piropla...    36   1.0  
UniRef50_A0DPV1 Cluster: Chromosome undetermined scaffold_598, w...    36   1.0  
UniRef50_Q4P6T0 Cluster: Putative uncharacterized protein; n=1; ...    36   1.0  
UniRef50_Q4SBJ1 Cluster: Chromosome 15 SCAF14667, whole genome s...    36   1.3  
UniRef50_Q2QR79 Cluster: Retrotransposon protein, putative, uncl...    36   1.3  
UniRef50_A7QM39 Cluster: Chromosome undetermined scaffold_123, w...    36   1.3  
UniRef50_Q8IHJ0 Cluster: Putative mitochondrial carrier protein;...    36   1.3  
UniRef50_Q23PQ2 Cluster: Mitochondrial carrier protein; n=2; Tet...    36   1.3  
UniRef50_A7T3S4 Cluster: Predicted protein; n=1; Nematostella ve...    36   1.3  
UniRef50_P55916 Cluster: Mitochondrial uncoupling protein 3; n=1...    36   1.3  
UniRef50_Q0FKG0 Cluster: Putative uncharacterized protein; n=1; ...    35   1.8  
UniRef50_Q0II44 Cluster: Similar to solute carrier family 25 mem...    35   1.8  
UniRef50_Q5D8U9 Cluster: SJCHGC06784 protein; n=3; Schistosoma j...    35   1.8  
UniRef50_Q55E45 Cluster: Putative uncharacterized protein; n=1; ...    35   1.8  
UniRef50_Q54KZ6 Cluster: Putative uncharacterized protein; n=1; ...    35   1.8  
UniRef50_Q385C8 Cluster: Putative uncharacterized protein; n=1; ...    35   1.8  
UniRef50_Q59YC3 Cluster: Mitochondrial carrier family and EF han...    35   1.8  
UniRef50_Q0UZJ2 Cluster: Putative uncharacterized protein; n=1; ...    35   1.8  
UniRef50_A0CXN4 Cluster: Chromosome undetermined scaffold_30, wh...    35   2.3  
UniRef50_Q4X022 Cluster: Mitochondrial deoxynucleotide carrier p...    35   2.3  
UniRef50_Q8WUT9 Cluster: Solute carrier family 25 member 43; n=1...    35   2.3  
UniRef50_Q9H1K4 Cluster: Mitochondrial glutamate carrier 2 (GC-2...    35   2.3  
UniRef50_Q4RV71 Cluster: Chromosome 15 SCAF14992, whole genome s...    34   3.1  
UniRef50_Q0E592 Cluster: SNF2 DEAD-like helicase 110.8 kDa; n=2;...    34   3.1  
UniRef50_A3B6T2 Cluster: Putative uncharacterized protein; n=3; ...    34   3.1  
UniRef50_Q4QF00 Cluster: Mitochondrial ornithine carrier protein...    34   3.1  
UniRef50_A2DCW8 Cluster: Hydrogenosomal membrane protein 31; n=3...    34   3.1  
UniRef50_Q6FM23 Cluster: Similar to sp|P32332 Saccharomyces cere...    34   3.1  
UniRef50_A7TLE7 Cluster: Putative uncharacterized protein; n=1; ...    34   3.1  
UniRef50_A6RKD3 Cluster: Putative uncharacterized protein; n=2; ...    34   3.1  
UniRef50_P48233 Cluster: Calcium-binding mitochondrial carrier S...    34   3.1  
UniRef50_Q06497 Cluster: Peroxisomal adenine nucleotide transpor...    34   3.1  
UniRef50_A3AJ07 Cluster: Putative uncharacterized protein; n=3; ...    34   4.1  
UniRef50_Q9VC40 Cluster: CG5805-PA; n=6; Endopterygota|Rep: CG58...    34   4.1  
UniRef50_Q5CIH5 Cluster: Splicing factor; n=2; Cryptosporidium|R...    34   4.1  
UniRef50_Q4D533 Cluster: Mitochondrial carrier protein, putative...    34   4.1  
UniRef50_Q9UTN1 Cluster: Anion transporter; n=3; Ascomycota|Rep:...    34   4.1  
UniRef50_O94502 Cluster: Mitochondrial carrier, calcium binding ...    34   4.1  
UniRef50_A7TQ47 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_O43772 Cluster: Mitochondrial carnitine/acylcarnitine c...    34   4.1  
UniRef50_P42145 Cluster: Sperm protamine-P1; n=12; Euteleostomi|...    34   4.1  
UniRef50_Q4SEX5 Cluster: Chromosome undetermined SCAF14610, whol...    33   5.4  
UniRef50_Q013B8 Cluster: Mitochondrial carrier protein, putative...    33   5.4  
UniRef50_Q9XTH0 Cluster: Putative uncharacterized protein; n=2; ...    33   5.4  
UniRef50_A0CV34 Cluster: Chromosome undetermined scaffold_29, wh...    33   5.4  
UniRef50_Q6V9R7 Cluster: Solute carrier family 25 member 19; n=4...    33   5.4  
UniRef50_Q6BYB7 Cluster: Debaryomyces hansenii chromosome A of s...    33   5.4  
UniRef50_Q10248 Cluster: Putative mitochondrial carrier C4G9.20c...    33   5.4  
UniRef50_Q9HC21 Cluster: Mitochondrial deoxynucleotide carrier; ...    33   5.4  
UniRef50_UPI0000E4A38B Cluster: PREDICTED: similar to mitochondr...    33   7.1  
UniRef50_UPI0000E48E57 Cluster: PREDICTED: hypothetical protein;...    33   7.1  
UniRef50_UPI0000D9C841 Cluster: PREDICTED: similar to solute car...    33   7.1  
UniRef50_Q567M3 Cluster: Zgc:111878; n=4; Danio rerio|Rep: Zgc:1...    33   7.1  
UniRef50_Q9SVB2 Cluster: Mitochondrial carrier-like protein; n=1...    33   7.1  
UniRef50_Q014S0 Cluster: Mitochondrial fatty acid anion carrier ...    33   7.1  
UniRef50_A3QMB9 Cluster: Putative uncharacterized protein; n=3; ...    33   7.1  
UniRef50_A0DHJ2 Cluster: Chromosome undetermined scaffold_50, wh...    33   7.1  
UniRef50_Q75DP0 Cluster: ABL023Wp; n=1; Eremothecium gossypii|Re...    33   7.1  
UniRef50_A7F7Y2 Cluster: Putative uncharacterized protein; n=1; ...    33   7.1  
UniRef50_P33303 Cluster: Succinate/fumarate mitochondrial transp...    33   7.1  
UniRef50_UPI0000F2BC15 Cluster: PREDICTED: hypothetical protein;...    33   9.4  
UniRef50_UPI0000D55AE5 Cluster: PREDICTED: similar to solute car...    33   9.4  
UniRef50_UPI0000503A2F Cluster: solute carrier family 25 (mitoch...    33   9.4  
UniRef50_A5D6U9 Cluster: Zgc:162973 protein; n=1; Danio rerio|Re...    33   9.4  
UniRef50_Q2IMJ3 Cluster: LigA; n=4; cellular organisms|Rep: LigA...    33   9.4  
UniRef50_Q6H077 Cluster: Putative uncharacterized protein; n=2; ...    33   9.4  
UniRef50_A7BT37 Cluster: Type IV pilin biogenesis protein; n=1; ...    33   9.4  
UniRef50_A6CD68 Cluster: Putative uncharacterized protein; n=1; ...    33   9.4  
UniRef50_Q6YSJ6 Cluster: Putative uncharacterized protein B1100H...    33   9.4  
UniRef50_Q0JPF8 Cluster: Os01g0225000 protein; n=7; Magnoliophyt...    33   9.4  
UniRef50_Q01CQ2 Cluster: Mitochondrial fatty acid anion carrier ...    33   9.4  
UniRef50_A5AK25 Cluster: Putative uncharacterized protein; n=1; ...    33   9.4  
UniRef50_Q54S10 Cluster: Putative uncharacterized protein; n=1; ...    33   9.4  
UniRef50_Q21084 Cluster: Putative uncharacterized protein; n=3; ...    33   9.4  
UniRef50_O77304 Cluster: LA-MSC; n=3; Oxytrichidae|Rep: LA-MSC -...    33   9.4  
UniRef50_A0DZ51 Cluster: Chromosome undetermined scaffold_7, who...    33   9.4  
UniRef50_A0BLZ2 Cluster: Chromosome undetermined scaffold_115, w...    33   9.4  
UniRef50_A3LVX1 Cluster: Mitochondrial thiamine pyrophosphate tr...    33   9.4  
UniRef50_O43808 Cluster: Peroxisomal membrane protein PMP34; n=2...    33   9.4  

>UniRef50_P05141 Cluster: ADP/ATP translocase 2; n=61;
           Eukaryota|Rep: ADP/ATP translocase 2 - Homo sapiens
           (Human)
          Length = 298

 Score =  149 bits (362), Expect = 5e-35
 Identities = 68/91 (74%), Positives = 72/91 (79%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK+TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKAGAER 152



 Score =  108 bits (259), Expect = 2e-22
 Identities = 50/62 (80%), Positives = 58/62 (93%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           V+FAKDFLAGG++AA+SKTAVAPIERVKLLLQVQH SKQI AD++YKGI+D  VRIPKEQ
Sbjct: 6   VSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 29/40 (72%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IVISW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISW 214



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 16/24 (66%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI+KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKIYKSDGIKGLYQGF 177


>UniRef50_P12236 Cluster: ADP/ATP translocase 3; n=11;
           Euteleostomi|Rep: ADP/ATP translocase 3 - Homo sapiens
           (Human)
          Length = 298

 Score =  147 bits (357), Expect = 2e-34
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 3e-23
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 175 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 214



 Score = 39.5 bits (88), Expect = 0.082
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKITKSDGIRGLYQGF 177


>UniRef50_P12235 Cluster: ADP/ATP translocase 1; n=108;
           Eukaryota|Rep: ADP/ATP translocase 1 - Homo sapiens
           (Human)
          Length = 298

 Score =  147 bits (356), Expect = 3e-34
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVD+  QFWRYF        
Sbjct: 62  PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGKG  QR
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKGAAQR 152



 Score =  103 bits (247), Expect = 4e-21
 Identities = 48/60 (80%), Positives = 56/60 (93%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +F KDFLAGG++AAVSKTAVAPIERVKLLLQVQH SKQI+A+++YKGI+D  VRIPKEQG
Sbjct: 7   SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG 66



 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 26/40 (65%), Positives = 29/40 (72%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKN  I +SW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSW 214



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+CI KIFKSDGL GLY+GF
Sbjct: 154 FHGLGDCIIKIFKSDGLRGLYQGF 177


>UniRef50_Q9H0C2 Cluster: ADP/ATP translocase 4; n=17;
           Eukaryota|Rep: ADP/ATP translocase 4 - Homo sapiens
           (Human)
          Length = 315

 Score =  132 bits (319), Expect = 8e-30
 Identities = 59/91 (64%), Positives = 67/91 (73%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQ+F+ GV+K+ QFWR+F        
Sbjct: 74  PREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGG 133

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLC VYPLDFARTRL  D+GKG  +R
Sbjct: 134 AAGATSLCVVYPLDFARTRLGVDIGKGPEER 164



 Score = 98.3 bits (234), Expect = 2e-19
 Identities = 48/67 (71%), Positives = 55/67 (82%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           L D  +F KD LAGG++AAVSKTAVAPIERVKLLLQVQ  SKQI+ + RYKG+VD  VRI
Sbjct: 14  LFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRI 73

Query: 237 PKEQGLF 257
           P+EQG F
Sbjct: 74  PREQGFF 80



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 20/31 (64%), Positives = 26/31 (83%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           II+YRASYFG YDT +G+LP PK TP ++S+
Sbjct: 196 IIVYRASYFGAYDTVKGLLPKPKKTPFLVSF 226



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/25 (72%), Positives = 21/25 (84%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F GLG+CI KI KSDG+ GLY+GFG
Sbjct: 166 FKGLGDCIMKIAKSDGIAGLYQGFG 190


>UniRef50_Q16RN6 Cluster: Adp,atp carrier protein; n=1; Aedes
           aegypti|Rep: Adp,atp carrier protein - Aedes aegypti
           (Yellowfever mosquito)
          Length = 257

 Score =  124 bits (298), Expect = 3e-27
 Identities = 63/98 (64%), Positives = 69/98 (70%)
 Frame = +2

Query: 179 QADRRRPALQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 358
           +ADR +  +  + R   P  QG G+  +WRGN ANVIRYFPTQALNFAFKDKYKQVFLGG
Sbjct: 49  EADRYKGMVDCFIRI--PKEQGIGA--YWRGNMANVIRYFPTQALNFAFKDKYKQVFLGG 104

Query: 359 VDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTR 472
           VDK TQF RYF            TSLCFVYPLDFARTR
Sbjct: 105 VDKNTQFVRYFIGNLASGGMAGATSLCFVYPLDFARTR 142



 Score =  120 bits (288), Expect = 5e-26
 Identities = 57/69 (82%), Positives = 62/69 (89%)
 Frame = +3

Query: 48  MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 227
           MS LADPVAF KDF AGGISAA+SKTAVAPIERVKLLLQVQH+SKQIA   RYKG+VD F
Sbjct: 1   MSGLADPVAFLKDFAAGGISAAISKTAVAPIERVKLLLQVQHISKQIAEADRYKGMVDCF 60

Query: 228 VRIPKEQGL 254
           +RIPKEQG+
Sbjct: 61  IRIPKEQGI 69



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 20/25 (80%), Positives = 22/25 (88%)
 Frame = +3

Query: 621 YFGFYDTARGMLPDPKNTPIVISWA 695
           YFGFYDTARGMLP+PK TP  +SWA
Sbjct: 150 YFGFYDTARGMLPNPKTTPWYVSWA 174


>UniRef50_UPI0000D67F67 Cluster: PREDICTED: similar to adenine
           nucleotide translocator; n=1; Mus musculus|Rep:
           PREDICTED: similar to adenine nucleotide translocator -
           Mus musculus
          Length = 176

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 46/68 (67%), Positives = 49/68 (72%)
 Frame = +2

Query: 305 QALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLAAD 484
           QALNFAFKDKYKQ+FLGGVDK+TQFW YF            TSLCFVYPLDFA T LA D
Sbjct: 38  QALNFAFKDKYKQIFLGGVDKRTQFWCYFAGNLASGGATGATSLCFVYPLDFACTGLAVD 97

Query: 485 VGKGDGQR 508
           VGK   +R
Sbjct: 98  VGKAGAER 105



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 28/52 (53%), Positives = 37/52 (71%), Gaps = 1/52 (1%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAP-IERVKLLLQVQHVSKQIAADQRYKGIVD 221
           V+F KDFLA G+++A+SKTAVAP IERVKLL Q  + + +    Q + G VD
Sbjct: 6   VSFIKDFLACGVASAISKTAVAPIIERVKLLQQALNFAFKDKYKQIFLGGVD 57



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGL 570
           F GLG+C+ KI+KSDG+ GL
Sbjct: 107 FKGLGDCLVKIYKSDGIKGL 126


>UniRef50_Q010A8 Cluster: ADT_CHLKE ADP,ATP carrier protein; n=1;
           Ostreococcus tauri|Rep: ADT_CHLKE ADP,ATP carrier
           protein - Ostreococcus tauri
          Length = 306

 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 48/84 (57%), Positives = 52/84 (61%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXX 418
           QG GS  FWRGN AN++RYFPTQA NFAFKD  K +F      K  FW +F         
Sbjct: 66  QGFGS--FWRGNLANIVRYFPTQAFNFAFKDTIKGLF-PSYSPKEAFWPFFAVNMASGGL 122

Query: 419 XXXTSLCFVYPLDFARTRLAADVG 490
               SL  VYPLDFARTRLAADVG
Sbjct: 123 AGAGSLLIVYPLDFARTRLAADVG 146



 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 28/54 (51%), Positives = 39/54 (72%), Gaps = 2/54 (3%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ--RYKGIVDAFVRIPKEQG 251
           GG+S +++KTA APIERVKLL+Q Q  + +I + +  RY GIV+ F R+  EQG
Sbjct: 14  GGVSGSIAKTATAPIERVKLLIQTQDANPRIMSGEVPRYTGIVNCFTRVTAEQG 67



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGML 656
           II+YR SYFG YDT +G L
Sbjct: 183 IIVYRGSYFGLYDTGKGAL 201



 Score = 33.1 bits (72), Expect = 7.1
 Identities = 13/25 (52%), Positives = 19/25 (76%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GL +C++KI K  G + LY+GFG
Sbjct: 153 FTGLVDCLTKIAKRSGPMALYQGFG 177


>UniRef50_Q18683 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 306

 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 44/64 (68%), Positives = 52/64 (81%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           +D   FA D L GG+SA+VSKT VAPIERVK+LLQVQ+  K I AD+RY GI+DAFVR+P
Sbjct: 16  SDAQKFAIDLLIGGVSASVSKTVVAPIERVKILLQVQYSHKDIPADKRYNGIIDAFVRVP 75

Query: 240 KEQG 251
           KEQG
Sbjct: 76  KEQG 79



 Score = 92.7 bits (220), Expect = 8e-18
 Identities = 42/84 (50%), Positives = 51/84 (60%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G +SFWRGN  NVIRYFPTQA NFAF D YK + L  + ++     Y         
Sbjct: 75  PKEQGFVSFWRGNMTNVIRYFPTQAFNFAFNDLYKSILLKNMKRENNVLSYSVRTLVSGG 134

Query: 416 XXXXTSLCFVYPLDFARTRLAADV 487
               +SLC VYPLDF RTRL+AD+
Sbjct: 135 LAGCSSLCIVYPLDFIRTRLSADI 158


>UniRef50_Q86CZ9 Cluster: Putative uncharacterized protein tag-61;
           n=1; Caenorhabditis elegans|Rep: Putative
           uncharacterized protein tag-61 - Caenorhabditis elegans
          Length = 128

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 43/64 (67%), Positives = 50/64 (78%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D   F  D  +GG +AAVSKTAVAPIERVKLLLQVQ  SK IA D+RYKGI+D  +R+PK
Sbjct: 8   DTKKFLIDLASGGTAAAVSKTAVAPIERVKLLLQVQDASKAIAVDKRYKGIMDVLIRVPK 67

Query: 243 EQGL 254
           EQG+
Sbjct: 68  EQGV 71



 Score = 40.3 bits (90), Expect = 0.047
 Identities = 16/24 (66%), Positives = 18/24 (75%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQ 307
           P+  G  + WRGN ANVIRYFPTQ
Sbjct: 66  PKEQGVAALWRGNLANVIRYFPTQ 89


>UniRef50_UPI00005A551B Cluster: PREDICTED: similar to ADP/ATP
           translocase 2 (Adenine nucleotide translocator 2) (ANT
           2) (ADP,ATP carrier protein 2) (Solute carrier family
           25, member 5) (ADP,ATP carrier protein, fibroblast
           isoform); n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to ADP/ATP translocase 2 (Adenine nucleotide
           translocator 2) (ANT 2) (ADP,ATP carrier protein 2)
           (Solute carrier family 25, member 5) (ADP,ATP carrier
           protein, fibroblast isoform) - Canis familiaris
          Length = 161

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 40/62 (64%), Positives = 49/62 (79%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           V F KDFLAGG + A+SKT V P + VKLLLQVQH SKQI A+++Y GI+D  VRIPK+Q
Sbjct: 6   VCFTKDFLAGGEAMAISKTVVVPFQWVKLLLQVQHASKQITAEKQYMGIIDGMVRIPKDQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 27/39 (69%), Positives = 32/39 (82%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 352
           P+  G LSFW GN AN IR FPTQALNFAFKD+++Q+FL
Sbjct: 62  PKDQGVLSFWHGNLANGIRSFPTQALNFAFKDQHQQIFL 100


>UniRef50_P91270 Cluster: Putative uncharacterized protein F25B4.7;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein F25B4.7 - Caenorhabditis elegans
          Length = 306

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 36/63 (57%), Positives = 51/63 (80%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D + F+KDF+AG  +AA+SKT +AP+ERVKL+LQ+Q+    +A + RYKGIVD F+R+P+
Sbjct: 14  DVIKFSKDFMAGATAAAISKTVIAPVERVKLILQLQNSQTTLALENRYKGIVDCFIRVPR 73

Query: 243 EQG 251
           EQG
Sbjct: 74  EQG 76



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 37/91 (40%), Positives = 52/91 (57%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN+ N++R    ++L  +FK+ +++  L GVD KTQ  R+         
Sbjct: 72  PREQGFLSFWRGNWVNILRSCSQESLGLSFKEFFRKYSLEGVDPKTQHSRWLVGNLVAGG 131

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
                +L  +YPLDF RTRLA D+GK    R
Sbjct: 132 GSGCATLATIYPLDFIRTRLAIDLGKRKSDR 162



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 13/23 (56%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           F+G+ +C  KI KSDG+ GLY+G
Sbjct: 164 FTGMFDCAKKIIKSDGVPGLYKG 186


>UniRef50_Q76KG1 Cluster: ADP/ATP carrier protein; n=1; Penicillium
           chrysogenum|Rep: ADP/ATP carrier protein - Penicillium
           chrysogenum (Penicillium notatum)
          Length = 430

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 46/89 (51%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G +S WRGN ANVIRYFPTQALNFAF+D YK +F    D +  + ++             
Sbjct: 79  GVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKD-RDGYAKWMMSNLASGGAAGA 137

Query: 428 TSLCFVYPLDFARTRLAADV--GKGDGQR 508
           TSL FVY LD+ARTRLA D    KG G+R
Sbjct: 138 TSLLFVYSLDYARTRLANDAKSSKGTGER 166



 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 46/89 (51%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G +S WRGN ANVIRYFPTQALNFAF+D YK +F    D +  + ++             
Sbjct: 194 GVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKD-RDGYAKWMMSNLASGGAAGA 252

Query: 428 TSLCFVYPLDFARTRLAADV--GKGDGQR 508
           TSL FVY LD+ARTRLA D    KG G+R
Sbjct: 253 TSLLFVYSLDYARTRLANDAKSSKGTGER 281



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F  DFL GG+SAAVSKTA APIER+KLL+Q Q  + KQ   D++Y GIVD F R    +G
Sbjct: 20  FVVDFLMGGVSAAVSKTAAAPIERIKLLIQNQDEMHKQGRLDRKYNGIVDCFRRTAAAEG 79

Query: 252 L 254
           +
Sbjct: 80  V 80


>UniRef50_P04710 Cluster: ADP,ATP carrier protein 1; n=163;
           Eukaryota|Rep: ADP,ATP carrier protein 1 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 309

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 46/89 (51%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G +SFWRGN ANV+RYFPTQALNFAFKDK K + L    ++  + ++F            
Sbjct: 72  GIVSFWRGNTANVLRYFPTQALNFAFKDKIKSL-LSYDRERDGYAKWFAGNLFSGGAAGG 130

Query: 428 TSLCFVYPLDFARTRLAADV--GKGDGQR 508
            SL FVY LD+ARTRLAAD    K   QR
Sbjct: 131 LSLLFVYSLDYARTRLAADARGSKSTSQR 159



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 34/61 (55%), Positives = 43/61 (70%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F  DFL GG+SAA++KT  APIERVKLL+Q Q  + KQ + D RYKGI+D F R    +G
Sbjct: 13  FGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEG 72

Query: 252 L 254
           +
Sbjct: 73  I 73



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 14/24 (58%), Positives = 18/24 (75%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+GL +   K  K+DGL+GLYRGF
Sbjct: 161 FNGLLDVYKKTLKTDGLLGLYRGF 184


>UniRef50_Q21809 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 298

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 38/87 (43%), Positives = 48/87 (55%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+++ WRGN A V R  P   LNFAF+D Y+   L  VD+   F ++             
Sbjct: 69  GAMALWRGNGAGVARCLPNHTLNFAFRDIYRNTLLKNVDRNESFGKFLAGTFVSGGLGGA 128

Query: 428 TSLCFVYPLDFARTRLAADVGKGDGQR 508
           T+L  +YP DFARTRLA DV K DG R
Sbjct: 129 TTLFMLYPFDFARTRLALDV-KKDGSR 154



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 29/63 (46%), Positives = 39/63 (61%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D +  +K  LAG  +AA+SKT  AP +RVKL+LQ+Q  S+   A+  Y GI D   +I  
Sbjct: 9   DVLETSKKCLAGSAAAAISKTTTAPFDRVKLVLQLQRQSEFAMAE--YNGIRDCISKIRL 66

Query: 243 EQG 251
           EQG
Sbjct: 67  EQG 69


>UniRef50_Q5DAY1 Cluster: SJCHGC02793 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC02793 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 213

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 41/79 (51%), Positives = 45/79 (56%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G L FWRGN  N +RYFPTQALNFAFKDK K  F    +K   +   F            
Sbjct: 72  GILPFWRGNLPNCLRYFPTQALNFAFKDKVKSAF--KQNKDDPYLVSFYKNVVSGGTAGA 129

Query: 428 TSLCFVYPLDFARTRLAAD 484
            SL FVY LD+ARTRLA D
Sbjct: 130 LSLVFVYSLDYARTRLAND 148



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKE 245
           ++FA++FL  G +A ++KTA APIERVKLL+Q Q  + KQ   D+ Y G++D  +R  + 
Sbjct: 11  LSFAENFLLSGAAAVIAKTAAAPIERVKLLVQNQDEMIKQGRLDKPYTGVIDCTMRTFRH 70

Query: 246 QGL 254
           +G+
Sbjct: 71  EGI 73


>UniRef50_Q20AK0 Cluster: Adenine nucleotide translocator s6; n=1;
           Ictalurus punctatus|Rep: Adenine nucleotide translocator
           s6 - Ictalurus punctatus (Channel catfish)
          Length = 82

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 39/50 (78%), Positives = 45/50 (90%)
 Frame = +3

Query: 39  SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQI 188
           ++KM+  A  V+FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQI
Sbjct: 31  TSKMNETA--VSFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQI 78


>UniRef50_A0E0L6 Cluster: Chromosome undetermined scaffold_71, whole
           genome shotgun sequence; n=3; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_71, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 304

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 37/87 (42%), Positives = 50/87 (57%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+LS WRGN  NV+RYFPTQALNF+FKD + +      + +     ++            
Sbjct: 68  GTLSLWRGNGVNVLRYFPTQALNFSFKDFFAKFLKKNSNSEHSSQLFYNILSGGLAGTCS 127

Query: 428 TSLCFVYPLDFARTRLAADVGKGDGQR 508
           TS+  VYPLD ARTRL  D+G+   +R
Sbjct: 128 TSI--VYPLDLARTRLGVDLGRTKSER 152



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/59 (47%), Positives = 41/59 (69%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F  DFL+GG+S A++KT+ APIERVKLL+Q   ++ ++   + Y GI D F+R  +E G
Sbjct: 12  FLIDFLSGGLSGAIAKTSCAPIERVKLLMQTASMNTKLT--KPYAGITDCFLRCVREDG 68



 Score = 37.1 bits (82), Expect = 0.44
 Identities = 14/25 (56%), Positives = 20/25 (80%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F GL +C++KI+KSDG+ G Y+G G
Sbjct: 154 FQGLVDCLTKIYKSDGIKGWYQGIG 178


>UniRef50_Q8LFZ1 Cluster: ADP/ATP translocase-like protein; n=10;
           Eukaryota|Rep: ADP/ATP translocase-like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 330

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 34/87 (39%), Positives = 50/87 (57%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G LS WRGN ++V+RY+P+ ALNF+ KD Y+ +      ++   +               
Sbjct: 94  GVLSLWRGNGSSVLRYYPSVALNFSLKDLYRSILRNSSSQENHIFSGALANFMAGSAAGC 153

Query: 428 TSLCFVYPLDFARTRLAADVGKGDGQR 508
           T+L  VYPLD A TRLAAD+GK + ++
Sbjct: 154 TALIVVYPLDIAHTRLAADIGKPESRQ 180



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 29/66 (43%), Positives = 37/66 (56%), Gaps = 6/66 (9%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ------RYKGIVDAFVRI 236
           F KD LAG +   V  T VAPIER KLLLQ Q  +  I  D+      R+KG+ D   R 
Sbjct: 30  FQKDLLAGAVMGGVVHTIVAPIERAKLLLQTQESNIAIVGDEGHAGKRRFKGMFDFIFRT 89

Query: 237 PKEQGL 254
            +E+G+
Sbjct: 90  VREEGV 95


>UniRef50_UPI0000DB7B77 Cluster: PREDICTED: similar to ADP/ATP
           translocase 1 (Adenine nucleotide translocator 1) (ANT
           1) (ADP,ATP carrier protein 1) (Solute carrier family 25
           member 4) (ADP,ATP carrier protein, heart/skeletal
           muscle isoform T1) (mANC1); n=1; Apis mellifera|Rep:
           PREDICTED: similar to ADP/ATP translocase 1 (Adenine
           nucleotide translocator 1) (ANT 1) (ADP,ATP carrier
           protein 1) (Solute carrier family 25 member 4) (ADP,ATP
           carrier protein, heart/skeletal muscle isoform T1)
           (mANC1) - Apis mellifera
          Length = 344

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 37/109 (33%), Positives = 55/109 (50%)
 Frame = +2

Query: 164 STARQQADRRRPALQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 343
           +++RQ   ++R    G        P+  G LS WRGN  NV RYFP QA++F+F D Y +
Sbjct: 65  ASSRQIGIQKRAPYSGVLNAFIRIPKEQGFLSLWRGNLLNVCRYFPAQAIHFSFYDIYYE 124

Query: 344 VFLGGVDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLAADVG 490
           +F   +   T  + +             TS   +YPL+F  TR++ DVG
Sbjct: 125 IFRRVIPSGT--YNHIILPFLTGGSVGATSTMILYPLNFCNTRISVDVG 171



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR--YKGIVDAFVRIPK 242
           + F   F+  GI A + ++  AP+ER+KL+LQ Q  S+QI   +R  Y G+++AF+RIPK
Sbjct: 31  IDFGASFIISGILAIIFRSMTAPLERIKLILQTQASSRQIGIQKRAPYSGVLNAFIRIPK 90

Query: 243 EQG 251
           EQG
Sbjct: 91  EQG 93


>UniRef50_A5BXJ8 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 342

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 28/61 (45%), Positives = 42/61 (68%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F+ DF+ GG +A ++K+A APIERVKLLLQ Q  + K+    + Y G+ D F R+ +E+G
Sbjct: 11  FSVDFVMGGGAAVLAKSAAAPIERVKLLLQNQGEMLKRGHLKRPYMGVADCFSRVFREEG 70

Query: 252 L 254
           +
Sbjct: 71  V 71



 Score = 46.0 bits (104), Expect(2) = 2e-10
 Identities = 27/68 (39%), Positives = 37/68 (54%)
 Frame = +2

Query: 305 QALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLAAD 484
           +A NFAFK  +K +F G   +K  + ++F            T+  F+Y LD+ARTRLA D
Sbjct: 121 EAFNFAFKGYFKSLF-GCSKEKDGYLKWFAGNVASGSAAGATTSLFLYHLDYARTRLATD 179

Query: 485 VGKGDGQR 508
               DGQR
Sbjct: 180 A--RDGQR 185



 Score = 42.3 bits (95), Expect(2) = 2e-10
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALN 316
           G L+FWRGN ANVIRYFPTQ  N
Sbjct: 70  GVLAFWRGNQANVIRYFPTQWCN 92



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 14/25 (56%), Positives = 17/25 (68%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F GL +  SK   +DG+ GLYRGFG
Sbjct: 187 FKGLLDVYSKTLSTDGIAGLYRGFG 211


>UniRef50_Q22HD2 Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 263

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 33/60 (55%), Positives = 42/60 (70%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           F  DFL+GG++ A SKT  AP+ER+KLLLQ Q  S+  A  + YKGIVD F R  KE+G+
Sbjct: 7   FILDFLSGGVAGAFSKTIAAPLERIKLLLQTQ--SENQALLRPYKGIVDCFSRCVKEEGI 64



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = +2

Query: 428 TSLCFVYPLDFARTRLAADVGKGDGQR 508
           +S   +YPLDFARTRL  D+G    +R
Sbjct: 82  SSKALIYPLDFARTRLGVDIGNNKKKR 108



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 12/23 (52%), Positives = 19/23 (82%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           F+G+ +C++K++  DGL GLYRG
Sbjct: 110 FNGILDCLTKVYNQDGLRGLYRG 132


>UniRef50_A7SPF1 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 335

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 26/58 (44%), Positives = 42/58 (72%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           K  LAGGI+ AVS+T+V+P+ERVK+LLQ+Q        + ++KG++   ++I KE+G+
Sbjct: 36  KHLLAGGIAGAVSRTSVSPLERVKILLQIQ------VKNPKFKGVLPTLIQIGKEEGI 87



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 32/101 (31%), Positives = 46/101 (45%)
 Frame = +2

Query: 179 QADRRRPALQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 358
           Q   + P  +G    L    +  G L +++GN  NVIR FP  A+ FA  ++YK++    
Sbjct: 63  QIQVKNPKFKGVLPTLIQIGKEEGILGYFKGNGTNVIRIFPYSAVQFAAYEEYKKLLNIP 122

Query: 359 VDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLAA 481
            D + Q                 TS+   YPLD  RTRL+A
Sbjct: 123 DDPEHQ---TPIKRLVAGAMAGVTSITATYPLDLIRTRLSA 160



 Score = 39.9 bits (89), Expect = 0.062
 Identities = 23/62 (37%), Positives = 34/62 (54%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLFH 260
           K  +AG ++   S TA  P++ ++  L  Q       AD++Y+GIV AF  I  E+G F 
Sbjct: 132 KRLVAGAMAGVTSITATYPLDLIRTRLSAQ------GADRKYRGIVHAFRTILNEEGGFF 185

Query: 261 SG 266
           SG
Sbjct: 186 SG 187


>UniRef50_A5AUY8 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 307

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 1/59 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQ 248
           F  DFL G +S  VSK+A APIERVKLL+Q +  + K     + YKGI D F R  K +
Sbjct: 119 FMIDFLMGXVSIVVSKSAAAPIERVKLLIQNRDEIIKAAMLSELYKGITDCFARTIKNE 177


>UniRef50_A5C930 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 746

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 1/59 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQ 248
           F  DFL GG+S  VSK+A A IERVKLL+Q +  + K     + YKGI D F R  K +
Sbjct: 105 FMIDFLMGGVSIXVSKSAAASIERVKLLIQNRDEIIKATMLSELYKGITDCFARTNKNE 163


>UniRef50_A5BXC7 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 316

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAA--DQRYKGIVDAFVRIPKE 245
           +F KD  AG +   V  T VAPIER KLLLQ Q  +  I A   +R+KG+ D  +R  +E
Sbjct: 26  SFQKDLTAGAVMGGVVHTIVAPIERAKLLLQTQESNVAIIAGRHRRFKGMCDCILRTVRE 85

Query: 246 QGL 254
           +G+
Sbjct: 86  EGI 88



 Score = 41.1 bits (92), Expect = 0.027
 Identities = 16/27 (59%), Positives = 22/27 (81%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFK 328
           G LS WRGN ++V+RY+P+ ALNF+ K
Sbjct: 87  GILSLWRGNGSSVLRYYPSVALNFSLK 113



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 16/27 (59%), Positives = 21/27 (77%)
 Frame = +2

Query: 428 TSLCFVYPLDFARTRLAADVGKGDGQR 508
           T+L  +YPLD A TRLAADVGK + ++
Sbjct: 181 TTLIIIYPLDIAHTRLAADVGKTEARQ 207


>UniRef50_A7QCR1 Cluster: Chromosome undetermined scaffold_79, whole
           genome shotgun sequence; n=2; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_79, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 345

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 29/62 (46%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F  DFL G +S  VSK+  APIERVKLL+Q +  + K     + YKGI D F R  K + 
Sbjct: 115 FMIDFLIGRVSIVVSKSVAAPIERVKLLIQNRDEIIKAAMLSELYKGITDCFARPIKNED 174

Query: 252 LF 257
            F
Sbjct: 175 SF 176


>UniRef50_Q5KJH5 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 378

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           ++D       F+AGG++ A S+T V+P+ER+K++LQVQ    +    Q Y G+ ++  R+
Sbjct: 64  MSDNQMVINTFIAGGLAGAASRTVVSPLERLKIILQVQASGSKSGVGQAYAGVWESLGRM 123

Query: 237 PKEQG 251
            K++G
Sbjct: 124 WKDEG 128


>UniRef50_Q2TZ88 Cluster: Mitochondrial solute carrier protein;
           n=13; Pezizomycotina|Rep: Mitochondrial solute carrier
           protein - Aspergillus oryzae
          Length = 355

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 29/65 (44%), Positives = 45/65 (69%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           +A+PV  A  F+AGG++ AVS+T V+P+ER+K+LLQ+Q V +    ++    I  A V+I
Sbjct: 54  IAEPVVAA--FVAGGVAGAVSRTIVSPLERLKILLQIQSVGR----EEYRLSIWKALVKI 107

Query: 237 PKEQG 251
            KE+G
Sbjct: 108 GKEEG 112



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 30/96 (31%), Positives = 38/96 (39%), Gaps = 6/96 (6%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G   F RGN  N IR  P  A+ F   + YK+      D +    R              
Sbjct: 112 GWRGFMRGNGTNCIRIIPYSAVQFGSYNFYKRFAEPTPDAELSPVR----RLICGGAAGI 167

Query: 428 TSLCFVYPLDFARTRLA------ADVGKGDGQRNSP 517
           TS+   YPLD  RTRL+      A +G+ DG    P
Sbjct: 168 TSVTITYPLDIVRTRLSIQSASFAALGQRDGSGKLP 203


>UniRef50_UPI00006CB3EF Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 299

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 29/88 (32%), Positives = 41/88 (46%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S ++GN+ N +R FP QA+ F   DKYK+ +   +    Q  R              
Sbjct: 55  GVRSLFKGNYVNCLRIFPFQAIEFFMFDKYKKSYNQYMSSYIQLNRVALDLIAGALAGVT 114

Query: 428 TSLCFVYPLDFARTRLAADVGKGDGQRN 511
            S C +YPLD A+T LA ++ K     N
Sbjct: 115 ASAC-IYPLDLAKTHLAVNISKTPNASN 141



 Score = 39.9 bits (89), Expect = 0.062
 Identities = 19/27 (70%), Positives = 22/27 (81%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQ 164
           +FLAGGIS   S+TAVAPIERV +L Q
Sbjct: 6   NFLAGGISGVASRTAVAPIERVIILKQ 32


>UniRef50_A0C2U9 Cluster: Chromosome undetermined scaffold_145,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_145,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 299

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 30/80 (37%), Positives = 40/80 (50%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXX 418
           Q  G ++FWRGN ANV+R FP  A+NF+  D  ++ F    + KT   +           
Sbjct: 57  QHHGLINFWRGNQANVLRIFPQSAINFSTFDYLRRRFAPDREDKTIMRKIRLFLCGLTSG 116

Query: 419 XXXTSLCFVYPLDFARTRLA 478
               S+   YP DF RTRLA
Sbjct: 117 IVAQSI--AYPFDFLRTRLA 134


>UniRef50_A4S8E6 Cluster: MC family transporter; n=2;
           Ostreococcus|Rep: MC family transporter - Ostreococcus
           lucimarinus CCE9901
          Length = 322

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/58 (41%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAAD--QRYKGIVDAFVRIPKEQGL 254
           FLAGG++ A++KT  AP++R+K+++Q    S+  AA      KG++ AFV I K +G+
Sbjct: 28  FLAGGVAGALAKTCTAPLDRLKIIMQTSGASRASAASVAAADKGLLAAFVAIGKTEGV 85


>UniRef50_A0BYX2 Cluster: Chromosome undetermined scaffold_138,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_138,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 216

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 25/60 (41%), Positives = 33/60 (55%)
 Frame = +2

Query: 329 DKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
           D  K+ FL GVD + +  R+F              L  +YPLDF+RTRLAAD+ KG  +R
Sbjct: 3   DALKRQFLAGVDPQKRPGRFFAGSLLSGGFAGCIGLLILYPLDFSRTRLAADIRKGANER 62


>UniRef50_Q24D15 Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 339

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 25/86 (29%), Positives = 35/86 (40%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P   G  ++WRGNFAN++   P     FAF +     F    +K      Y         
Sbjct: 97  PTEQGIKAYWRGNFANIMYIIPRTIAQFAFFENINHFFFPAGEKNITELEYALRKFSAAL 156

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGK 493
                +L   YP D A+TRL+ +  K
Sbjct: 157 TAGFCTLSLAYPFDLAKTRLSLEFAK 182


>UniRef50_Q750J8 Cluster: AGL047Cp; n=1; Eremothecium gossypii|Rep:
           AGL047Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 316

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           F+AGG+  AVS+T V+P+ERVK+LLQVQ  S   A +    G+V A  ++ KE+G+
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQ--SSTTAYN---GGLVHAVKQVYKEEGV 70


>UniRef50_O04619 Cluster: A_IG002N01.16 protein; n=9;
           Magnoliophyta|Rep: A_IG002N01.16 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 352

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 25/61 (40%), Positives = 37/61 (60%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  K   AGG++  VS+TAVAP+ER+K+LLQVQ+       + +Y G V     I + +G
Sbjct: 37  SICKSLFAGGVAGGVSRTAVAPLERMKILLQVQN-----PHNIKYSGTVQGLKHIWRTEG 91

Query: 252 L 254
           L
Sbjct: 92  L 92


>UniRef50_Q6Z3Q5 Cluster: Putative mitochondrial carrier protein;
           n=3; Oryza sativa|Rep: Putative mitochondrial carrier
           protein - Oryza sativa subsp. japonica (Rice)
          Length = 333

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 32/94 (34%), Positives = 43/94 (45%)
 Frame = +2

Query: 197 PALQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQ 376
           P   G  + LR   +G G    +RGN AN +R F T+AL+F   ++YK+  LG       
Sbjct: 75  PRGAGAVQMLREIGRGEGVAGLFRGNGANALRVFHTKALHFMAYERYKRFLLGAA---PS 131

Query: 377 FWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLA 478
                            T++   YPLD ARTRLA
Sbjct: 132 LGDGPVVDLLAGSAAGGTAVLATYPLDLARTRLA 165



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/48 (45%), Positives = 32/48 (66%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGI 215
           AFA++ +AGG++  V+KTAVAP+ERV L+ QV    +   A Q  + I
Sbjct: 40  AFAREMVAGGVAGVVAKTAVAPLERVNLMRQVGAAPRGAGAVQMLREI 87


>UniRef50_A0EGA0 Cluster: Chromosome undetermined scaffold_95, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_95,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 305

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 25/80 (31%), Positives = 36/80 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  SFWRGN  NVI+  P  A+ F   DK+KQ ++    +K  + R              
Sbjct: 69  GLYSFWRGNGLNVIKTIPNAAIRFTVYDKFKQ-YVSEYRQKENYTRQVTNRLVAGFCTGL 127

Query: 428 TSLCFVYPLDFARTRLAADV 487
            +    YPL+  R +L  D+
Sbjct: 128 LNQLIHYPLEVLRVKLTVDM 147



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 28/64 (43%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK-QIAADQRYKGIVDAFVRIPKE 245
           + F K       S AVSKTA AP+ERVKL+LQV  + K +   D+ + GI     +I K 
Sbjct: 12  LTFWKCMAVTTFSYAVSKTATAPLERVKLILQVSPILKCEDKIDRTWSGI----KQIYKT 67

Query: 246 QGLF 257
           QGL+
Sbjct: 68  QGLY 71


>UniRef50_Q54MZ4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 434

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 29/80 (36%), Positives = 36/80 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G + F++GN  NVIR  P  A+ F   +KYK   L   D +T    Y             
Sbjct: 197 GFIGFFKGNGTNVIRIAPYSAIQFLSYEKYKNFLLNNND-QTHLTTY--ENLFVGGAAGV 253

Query: 428 TSLCFVYPLDFARTRLAADV 487
           TSL   YPLD  R+RL   V
Sbjct: 254 TSLLCTYPLDLIRSRLTVQV 273



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 21/58 (36%), Positives = 38/58 (65%), Gaps = 1/58 (1%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS-KQIAADQRYKGIVDAFVRIPKEQG 251
           K  L+GG++ AVS+T  +P+ER+K+L QV H++ +Q A   + +GI+ +   +   +G
Sbjct: 140 KLLLSGGVAGAVSRTCTSPLERLKILNQVGHMNLEQNAPKYKGRGIIQSLKTMYTTEG 197



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G IS A ++T   PI+ ++  LQVQ +      D  Y G  DAF +I +++G+
Sbjct: 342 GAISGATAQTLTYPIDLIRRRLQVQGIG---GKDILYNGTFDAFRKIIRDEGV 391


>UniRef50_Q54EV4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 327

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/59 (40%), Positives = 37/59 (62%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           + DF +G I+  VS+T  AP+ER+K+L QV+ + K      +Y  I+ AF  I KE+G+
Sbjct: 46  SNDFFSGLIAGIVSRTLTAPLERIKILNQVEVILKD---GTKYNRIIPAFKVIIKEEGI 101



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 19/66 (28%), Positives = 34/66 (51%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           L  P  +A   + G IS  ++ T + P++ VK  + +QH  +       YK  +DA ++I
Sbjct: 230 LKSPPLYAPS-IYGAISGGLTMTILYPLDVVKRRIMLQHFDRNQLPI--YKNFIDAIIKI 286

Query: 237 PKEQGL 254
            K +G+
Sbjct: 287 TKTEGI 292


>UniRef50_Q12251 Cluster: Probable mitochondrial carrier YPR011C;
           n=10; Saccharomycetales|Rep: Probable mitochondrial
           carrier YPR011C - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 326

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/28 (71%), Positives = 25/28 (89%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           FLAGG++ AVS+T V+P ERVK+LLQVQ
Sbjct: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQ 53


>UniRef50_Q16NW0 Cluster: Mitochondrial carrier protein; n=1; Aedes
           aegypti|Rep: Mitochondrial carrier protein - Aedes
           aegypti (Yellowfever mosquito)
          Length = 328

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/66 (33%), Positives = 41/66 (62%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS-KQIAADQRYKGIVDAFVRIPKEQGL- 254
           + F+ GG+++  ++    PI+  K  LQ+Q     Q  A+ +Y+G+ DAFV+I K++G+ 
Sbjct: 8   RPFIYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSHAELKYRGMTDAFVKISKQEGMK 67

Query: 255 -FHSGV 269
             +SG+
Sbjct: 68  ALYSGI 73


>UniRef50_Q6C3A2 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=3; Ascomycota|Rep:
           Yarrowia lipolytica chromosome F of strain CLIB122 of
           Yarrowia lipolytica - Yarrowia lipolytica (Candida
           lipolytica)
          Length = 338

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/55 (38%), Positives = 36/55 (65%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F AGG++ AVS+T V+P+ER+K++ QVQ      A    Y+G++    ++ +E+G
Sbjct: 25  FCAGGVAGAVSRTVVSPLERMKIIFQVQSAGPGGAP---YQGVIPTLSKMWREEG 76


>UniRef50_Q8S1A3 Cluster: Mitochondrial carrier protein-like; n=4;
           BEP clade|Rep: Mitochondrial carrier protein-like -
           Oryza sativa subsp. japonica (Rice)
          Length = 340

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/32 (59%), Positives = 27/32 (84%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           +AK+ +AGG + A +KTAVAP+ERVK+LLQ +
Sbjct: 29  YAKELIAGGAAGAFAKTAVAPLERVKILLQTR 60


>UniRef50_Q6CCV8 Cluster: Similar to KLLA0B11319g Kluyveromyces
           lactis IPF 7109.1; n=1; Yarrowia lipolytica|Rep: Similar
           to KLLA0B11319g Kluyveromyces lactis IPF 7109.1 -
           Yarrowia lipolytica (Candida lipolytica)
          Length = 337

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/56 (41%), Positives = 34/56 (60%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           L+G I  AV+  AV P++ V   LQVQ     +  D +YK ++DAF +I K +G+F
Sbjct: 8   LSGAIGGAVANLAVFPLDLVTTRLQVQ--KGYLDEDDQYKSLLDAFTKIVKNEGIF 61


>UniRef50_Q9MA27 Cluster: T5E21.6; n=9; Magnoliophyta|Rep: T5E21.6 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 319

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/46 (47%), Positives = 33/46 (71%), Gaps = 1/46 (2%)
 Frame = +3

Query: 33  T*SNKMSNLADPV-AFAKDFLAGGISAAVSKTAVAPIERVKLLLQV 167
           T S  + +L D +   AK  +AGG + A++KTAVAP+ER+K+LLQ+
Sbjct: 8   TLSADVMSLVDTLPVLAKTLIAGGAAGAIAKTAVAPLERIKILLQL 53



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 24/74 (32%), Positives = 33/74 (44%)
 Frame = +2

Query: 266 RGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXXTSLCFV 445
           RGN A+VIR  P  AL++   + Y+   L   +K                    T++   
Sbjct: 69  RGNGASVIRIIPYAALHYMTYEVYRDWIL---EKNLPLGSGPIVDLVAGSAAGGTAVLCT 125

Query: 446 YPLDFARTRLAADV 487
           YPLD ART+LA  V
Sbjct: 126 YPLDLARTKLAYQV 139


>UniRef50_A7TIY4 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 320

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/55 (43%), Positives = 37/55 (67%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F++GG++ AVS+T V+P ER+K+LLQ+Q  +  I A    KGI  + V I + +G
Sbjct: 15  FISGGLAGAVSRTVVSPFERIKILLQLQ-TANNINASYN-KGIWASIVYIYQNEG 67


>UniRef50_A4RUV7 Cluster: MC family transporter:
           aspartate/glutamate; n=2; Ostreococcus|Rep: MC family
           transporter: aspartate/glutamate - Ostreococcus
           lucimarinus CCE9901
          Length = 340

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/61 (34%), Positives = 37/61 (60%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           A A+  +AGG++  VS+TAVAP+ER+K+L       +Q+++   Y G+      + K +G
Sbjct: 31  AIARSLIAGGVAGGVSRTAVAPLERLKIL-------QQVSSSSAYNGVYSGLSHMWKTEG 83

Query: 252 L 254
           +
Sbjct: 84  V 84


>UniRef50_Q9FI43 Cluster: Calcium-binding transporter-like protein;
           n=15; Embryophyta|Rep: Calcium-binding transporter-like
           protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 487

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 18/34 (52%), Positives = 27/34 (79%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQI 188
           F+AGGI+ A S+TA AP++R+K+LLQ+Q    +I
Sbjct: 212 FIAGGIAGAASRTATAPLDRLKVLLQIQKTDARI 245


>UniRef50_A4S3P4 Cluster: MC family transporter; n=2;
           Ostreococcus|Rep: MC family transporter - Ostreococcus
           lucimarinus CCE9901
          Length = 335

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/59 (33%), Positives = 36/59 (61%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           ++   AGG +  +++TA AP++R+KLL QVQ ++    +   Y  +  AF +I  E+G+
Sbjct: 54  SRSVAAGGGAGIIARTASAPLDRIKLLFQVQAMASSGTSATAYTSVGQAFRKIYAEEGI 112



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 26/77 (33%), Positives = 32/77 (41%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G LSFW+GN  NVIR  P  A   A  D YK +     D++ +                 
Sbjct: 111 GILSFWKGNGVNVIRVAPYAAAQLASNDYYKSLL---ADEQGKLG--VPQRLLAGALAGM 165

Query: 428 TSLCFVYPLDFARTRLA 478
           T     +PLD  R RLA
Sbjct: 166 TGTAITHPLDTVRLRLA 182


>UniRef50_Q60K80 Cluster: Putative uncharacterized protein CBG24187;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG24187 - Caenorhabditis
           briggsae
          Length = 666

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/56 (39%), Positives = 30/56 (53%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FL G I+ A   TAV PI+ VK  +Q Q  S     +  YK  +D F ++ K +GL
Sbjct: 380 FLLGSIAGACGATAVYPIDLVKTRMQNQRTSGSFVGEVMYKNSLDCFKKVVKFEGL 435


>UniRef50_Q4Q227 Cluster: Mitochondrial carrier protein, putative;
           n=5; Trypanosomatidae|Rep: Mitochondrial carrier
           protein, putative - Leishmania major
          Length = 755

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGI 215
           + F + F AGGI+ AVSKT +AP +RVK++ QV+        +  Y G+
Sbjct: 145 IRFIESFAAGGIAGAVSKTVIAPGDRVKIIFQVEPTRHFSLREAVYLGV 193


>UniRef50_A0EEK4 Cluster: Chromosome undetermined scaffold_91, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_91,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 286

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 29/82 (35%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +2

Query: 254 LSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXXTS 433
           L  WRG     I Y P Q+L FAFKD Y +VF     KK   +++             T 
Sbjct: 49  LVIWRGVIPQAITYIPHQSLAFAFKDAYSKVF----QKKINDYKHLKNILIGSLAGASTM 104

Query: 434 LCFVYPLDFA--RTRLAADVGK 493
           L  +YP +F   RT+    VGK
Sbjct: 105 L-VMYPYEFVSQRTKYLQKVGK 125


>UniRef50_Q8TFH2 Cluster: Mitochondrial transporter; n=1;
           Schizosaccharomyces pombe|Rep: Mitochondrial transporter
           - Schizosaccharomyces pombe (Fission yeast)
          Length = 317

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/55 (38%), Positives = 36/55 (65%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           L+GG++A VS+TAV+P+ER+K++ QVQ+       ++ Y  +    V+I   +GL
Sbjct: 25  LSGGVAATVSRTAVSPLERMKIIFQVQN-------NKEYTSLTSTLVKIWNREGL 72


>UniRef50_A7PP43 Cluster: Chromosome chr8 scaffold_23, whole genome
           shotgun sequence; n=7; Magnoliophyta|Rep: Chromosome
           chr8 scaffold_23, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 381

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 19/56 (33%), Positives = 34/56 (60%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           F AG ++ A +K+  AP++R+KLL+Q   +     + ++  G ++A   I KE+GL
Sbjct: 88  FTAGAVAGAAAKSVTAPLDRIKLLMQTHGLRVGEESAKKAIGFIEAITLIGKEEGL 143



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 25/81 (30%), Positives = 34/81 (41%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G   +W+GN   VIR  P  A+     + YK++F G   + +   R              
Sbjct: 142 GLKGYWKGNLPQVIRIIPYSAVQLFAYETYKKLFRGKDGELSVIGR-----LAAGACAGM 196

Query: 428 TSLCFVYPLDFARTRLAADVG 490
           TS    YPLD  R RLA + G
Sbjct: 197 TSTFVTYPLDVLRLRLAVEPG 217


>UniRef50_Q7QHR1 Cluster: ENSANGP00000008222; n=5;
           Endopterygota|Rep: ENSANGP00000008222 - Anopheles
           gambiae str. PEST
          Length = 323

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 3/60 (5%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS-KQIAADQRYKGIV--DAFVRIPKEQG 251
           K+ LAGG++   SKTAVAP++R+K+LLQ   +  K +      K IV  ++F  + K  G
Sbjct: 34  KNLLAGGVAGMCSKTAVAPLDRIKILLQAHSIHYKHLGVFSGLKHIVKKESFFALYKGNG 93



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 28/93 (30%), Positives = 39/93 (41%)
 Frame = +2

Query: 257 SFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXXTSL 436
           + ++GN A ++R FP  A  F   + YK+V LG     T                  T++
Sbjct: 87  ALYKGNGAQMVRIFPYAATQFTAFEVYKKVTLG-----TNLPIKHADKFIAGAAAGVTAV 141

Query: 437 CFVYPLDFARTRLAADVGKGDGQRNSPVSETAS 535
              YPLD  R RLA  V  G+ + N  V    S
Sbjct: 142 TLTYPLDTIRARLAFQV-TGEHRYNGIVHTAVS 173


>UniRef50_A5DUZ3 Cluster: Mitochondrial carrier protein LEU5; n=5;
           Saccharomycetales|Rep: Mitochondrial carrier protein
           LEU5 - Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 495

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/56 (35%), Positives = 37/56 (66%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           +AGG++ + +KT VAP++R+K+L Q  +  + I     ++G++DA  RI K  G++
Sbjct: 152 IAGGVAGSCAKTLVAPLDRIKILFQTSN-PEFIKYRGTFRGLIDAGKRIWKSDGVW 206


>UniRef50_Q6PJJ9 Cluster: Solute carrier family 25 (Mitochondrial
           carrier; phosphate carrier), member 24 (Solute carrier
           family 25 (Mitochondrial carrier; phosphate carrier),
           member 24, isoform CRA_a); n=33; Eumetazoa|Rep: Solute
           carrier family 25 (Mitochondrial carrier; phosphate
           carrier), member 24 (Solute carrier family 25
           (Mitochondrial carrier; phosphate carrier), member 24,
           isoform CRA_a) - Homo sapiens (Human)
          Length = 477

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 28/82 (34%), Positives = 40/82 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NVI+  P  A+ F   ++YK++      K   F R+             
Sbjct: 246 GIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFI-----SGSMAGA 300

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
           T+  F+YP++  +TRLA  VGK
Sbjct: 301 TAQTFIYPMEVMKTRLA--VGK 320



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 18/34 (52%), Positives = 28/34 (82%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           +  LAGGI+ AVS+T+ AP++R+K+++QV H SK
Sbjct: 196 RQLLAGGIAGAVSRTSTAPLDRLKIMMQV-HGSK 228


>UniRef50_UPI0000F211B5 Cluster: PREDICTED: similar to LOC495458
           protein; n=1; Danio rerio|Rep: PREDICTED: similar to
           LOC495458 protein - Danio rerio
          Length = 253

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 22/63 (34%), Positives = 36/63 (57%)
 Frame = +3

Query: 66  PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKE 245
           P  + + +LAG ++   +   VAP ER+K LLQ+      +A   +Y G +D  VR+ K+
Sbjct: 44  PATYTQIYLAGMLAGVCTTVIVAPGERIKCLLQI----LPLAGRMKYTGPLDCAVRLYKQ 99

Query: 246 QGL 254
           QG+
Sbjct: 100 QGI 102


>UniRef50_UPI00006D001E Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 295

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 24/59 (40%), Positives = 37/59 (62%), Gaps = 1/59 (1%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQH-VSKQIAADQRYKGIVDAFVRIPKEQGL 254
           K  L G I  ++SKT  +P+E V++ LQ Q+ + KQ    QRY GI++   R+ +E+GL
Sbjct: 15  KTILNGIIYDSISKTFFSPLEVVRMRLQNQNEMIKQGYLQQRYNGIINCSKRVVQEEGL 73



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 21/82 (25%), Positives = 34/82 (41%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXX 418
           Q  G  + W+GNF +++    +  L+F      K++     +   + W            
Sbjct: 69  QEEGLKALWKGNFTHILINLTSNTLSFPINSLIKKIINPKREDGQKMW--IASNLAAGLL 126

Query: 419 XXXTSLCFVYPLDFARTRLAAD 484
               S  F YPLD+ART+L  D
Sbjct: 127 AGFLSSIFSYPLDYARTKLTND 148


>UniRef50_UPI00006CC149 Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 317

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 20/50 (40%), Positives = 32/50 (64%)
 Frame = +3

Query: 102 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++ A+++T +APIER+K+L Q Q + + +  D RY   + A  RI  EQG
Sbjct: 28  VAHAITRTVLAPIERLKILFQTQKIMRVLEQD-RYTSYLSAIRRIYSEQG 76



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 24/82 (29%), Positives = 30/82 (36%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G LSFWRGN  N+ R  PT  + FA    +K+      + +                   
Sbjct: 76  GFLSFWRGNGTNIYRVIPTNMIKFATFIHFKEEIFPKGEYRYSGLDLISRHFLCGMSSVF 135

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
               F YP D  RTR   D  K
Sbjct: 136 FIQMFCYPYDVIRTRQICDQTK 157


>UniRef50_Q5BSI2 Cluster: SJCHGC04210 protein; n=3; Bilateria|Rep:
           SJCHGC04210 protein - Schistosoma japonicum (Blood
           fluke)
          Length = 94

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 18/60 (30%), Positives = 36/60 (60%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           +++ +AGG+S    +    P++ +K+  Q+Q    + +    Y G++ AFVRI KE+G++
Sbjct: 5   SQNLIAGGLSGLTVRFLTQPLDVIKIRFQLQVEDIKPSGKSYYTGLLQAFVRIYKEEGIY 64


>UniRef50_Q38BB0 Cluster: Mitochondrial carrier protein, putative;
           n=1; Trypanosoma brucei|Rep: Mitochondrial carrier
           protein, putative - Trypanosoma brucei
          Length = 704

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 18/33 (54%), Positives = 25/33 (75%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQV 167
           V F + F AGGI+ AVSKT +AP ++VK++ QV
Sbjct: 109 VRFLEGFAAGGIAGAVSKTVIAPADKVKIIFQV 141


>UniRef50_Q86AV5 Cluster: Similar to Mus musculus (Mouse).
           Calcium-binding mitochondrial carrier protein Aralar2;
           n=2; Dictyostelium discoideum|Rep: Similar to Mus
           musculus (Mouse). Calcium-binding mitochondrial carrier
           protein Aralar2 - Dictyostelium discoideum (Slime mold)
          Length = 301

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           + +AG I+  +  + V P++ VK  LQ Q VS  I   ++Y GI+D F ++ K +G
Sbjct: 23  NLIAGAIAGVIGSSVVFPLDFVKTRLQQQRVS--IDGSKQYNGIIDCFKKVIKNEG 76


>UniRef50_Q54DU1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 297

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 25/85 (29%), Positives = 37/85 (43%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXX 418
           +  G    WRGN A ++R FP  A+ F   +  K   +   DK + F  +          
Sbjct: 63  ENEGIKGLWRGNSATILRVFPYAAVQFLSYETIKNHLV--ADKSSSFQIFL-----AGSA 115

Query: 419 XXXTSLCFVYPLDFARTRLAADVGK 493
               ++C  YPLD  R RLA ++ K
Sbjct: 116 AGGIAVCATYPLDLLRARLAIEIHK 140



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 15/28 (53%), Positives = 24/28 (85%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           FL+GG++   +K+AVAP+ERVK+L Q++
Sbjct: 18  FLSGGLAGVTAKSAVAPLERVKILYQIK 45


>UniRef50_O75746 Cluster: Calcium-binding mitochondrial carrier
           protein Aralar1; n=26; Euteleostomi|Rep: Calcium-binding
           mitochondrial carrier protein Aralar1 - Homo sapiens
           (Human)
          Length = 678

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  S  +  +  YK   D F ++ + +G F
Sbjct: 330 FTLGSVAGAVGATAVYPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFF 386


>UniRef50_Q0E2M9 Cluster: Os02g0226300 protein; n=5;
           Magnoliophyta|Rep: Os02g0226300 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 377

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 18/35 (51%), Positives = 28/35 (80%)
 Frame = +3

Query: 66  PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           P+A  ++ +AGG++  V+KTAVAP+ERVK+L Q +
Sbjct: 23  PLA-VRELVAGGVAGGVAKTAVAPLERVKILFQAR 56



 Score = 37.1 bits (82), Expect = 0.44
 Identities = 25/80 (31%), Positives = 37/80 (46%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G L F+RGN A+V R  P  AL++   ++Y++  + G     Q                 
Sbjct: 92  GLLGFYRGNGASVARIVPYAALHYMAYEEYRRWIILGFPNVEQGP---ILDLVAGSIAGG 148

Query: 428 TSLCFVYPLDFARTRLAADV 487
           T++   YPLD  RT+LA  V
Sbjct: 149 TAVICTYPLDLVRTKLAYQV 168


>UniRef50_Q4PC12 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 495

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQ 185
           F+AGG + A S+T V+P+ER+K+++QVQ  S Q
Sbjct: 143 FVAGGAAGATSRTVVSPLERLKIIMQVQPQSSQ 175


>UniRef50_Q01DN6 Cluster: Mitochondrial carnitine-acylcarnitine
           carrier protein; n=2; Ostreococcus|Rep: Mitochondrial
           carnitine-acylcarnitine carrier protein - Ostreococcus
           tauri
          Length = 558

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 28/83 (33%), Positives = 40/83 (48%)
 Frame = +3

Query: 24  VKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR 203
           V +  ++K S     +  AK  L G IS  VS+T VAP+ER K+   +   S +IA D  
Sbjct: 259 VSMAFASKRSARHGSMQVAKHLLVGAISGGVSRTIVAPLERAKIEYMLD--STKIARDGG 316

Query: 204 YKGIVDAFVRIPKEQGLFHSGVV 272
             G ++  VR     GLF    +
Sbjct: 317 LIGTLNRIVRDEGPGGLFRGNTL 339



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 19/43 (44%), Positives = 27/43 (62%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDK 367
           +G G L  +RGN  NV+R  PT+A+ F   DKYK+  + G D+
Sbjct: 328 EGPGGL--FRGNTLNVLRIAPTKAVEFFVYDKYKEHIINGSDQ 368


>UniRef50_Q01BW9 Cluster: Mitochondrial solute carrier protein; n=2;
           Ostreococcus|Rep: Mitochondrial solute carrier protein -
           Ostreococcus tauri
          Length = 426

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 24/82 (29%), Positives = 34/82 (41%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+L  W+GN  N+ R  P +A+NF   D Y++  +      +   R              
Sbjct: 168 GALGLWKGNVLNIARTAPFKAINFCAFDTYREFVIRSFPPGSDGRRIGLLCAGAGAGMTA 227

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
              CF  P+D  RTRL    GK
Sbjct: 228 VVTCF--PMDVIRTRLLTTGGK 247


>UniRef50_Q5C0G7 Cluster: SJCHGC01451 protein; n=2; Schistosoma
           japonicum|Rep: SJCHGC01451 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 172

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 18/54 (33%), Positives = 33/54 (61%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAG +S  V++  V P++ +K+  Q+Q    +I+   +Y+G++ A   I KE+G
Sbjct: 18  LAGSVSGFVARAVVQPLDVIKIRFQLQMEPIEISRTSKYQGLIQAVRCISKEEG 71


>UniRef50_A5C1E5 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 387

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 16/31 (51%), Positives = 24/31 (77%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQV 167
           + K+ +AGG++   +KT VAP+ERVK+L QV
Sbjct: 24  YVKELVAGGVAGGFAKTMVAPLERVKILFQV 54


>UniRef50_Q4MZZ5 Cluster: Mitochondrial carrier protein, putative;
           n=4; Piroplasmida|Rep: Mitochondrial carrier protein,
           putative - Theileria parva
          Length = 455

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 5/58 (8%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQ-----IAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++KT  AP +R++LL QVQ +  Q     +  +++Y+G++    RI +E+GL
Sbjct: 19  GLLSGVITKTICAPFDRIRLLYQVQPMFGQYSNEGLVGEKKYRGVIRTAQRIFREEGL 76



 Score = 36.3 bits (80), Expect = 0.76
 Identities = 12/24 (50%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           ++G+ +C S+IFK++GL+G Y+GF
Sbjct: 179 YTGIFDCFSQIFKTEGLMGFYKGF 202


>UniRef50_Q176S5 Cluster: Mitochondrial carrier protein; n=3;
           Culicidae|Rep: Mitochondrial carrier protein - Aedes
           aegypti (Yellowfever mosquito)
          Length = 309

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +A DFL GG+++  +     P+E VK  +Q+Q  ++ +    + YK I+DAFV I K  G
Sbjct: 2   YATDFLLGGVASMGATLFTNPLEVVKTRMQLQGELAAKGTYAKPYKSILDAFVTITKNDG 61


>UniRef50_A6SPK8 Cluster: Carnitine / acyl carnitine carrier; n=27;
           Dikarya|Rep: Carnitine / acyl carnitine carrier -
           Botryotinia fuckeliana B05.10
          Length = 341

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ--RYKGIVDAFVRI 236
           +P+  A+   AG  SA       AP ERVK+LLQ+Q   K++A  +  +Y G VD   ++
Sbjct: 144 EPLTIAQISTAGFFSAIPQTIITAPFERVKVLLQIQG-QKELAPGEKPKYNGGVDVVKQL 202

Query: 237 PKEQGL 254
            KE G+
Sbjct: 203 YKEGGI 208


>UniRef50_A1C808 Cluster: Mitochondrial carrier protein (Leu5),
           putative; n=13; Pezizomycotina|Rep: Mitochondrial
           carrier protein (Leu5), putative - Aspergillus clavatus
          Length = 436

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 24/82 (29%), Positives = 39/82 (47%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+   ++G+ A ++R FP  A+ F   ++ +   +   DK+T F R              
Sbjct: 149 GARGLFKGHSATLLRIFPYAAIKFLAYEQIRAAVIPSRDKETPFRRLI-----SGSLAGI 203

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
           TS+ F YPL+  R RLA +  K
Sbjct: 204 TSVFFTYPLELIRVRLAFETKK 225



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQ--HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAGG++   +KT VAP++RVK+L Q    H +K   +   + G+V A   I + +G
Sbjct: 97  LAGGLAGCAAKTVVAPLDRVKILFQASNPHFAKYTGS---WFGLVSAMRDIHRHEG 149


>UniRef50_O13805 Cluster: Putative mitochondrial carrier C17H9.08;
           n=1; Schizosaccharomyces pombe|Rep: Putative
           mitochondrial carrier C17H9.08 - Schizosaccharomyces
           pombe (Fission yeast)
          Length = 326

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 23/58 (39%), Positives = 33/58 (56%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           K  +AGG +  V+K+ VAP++RVK+L Q  H S +  A  R+ G+  A   I    GL
Sbjct: 19  KSGIAGGTAGCVAKSVVAPLDRVKILYQTNHASYRGYAYSRH-GLYKAIKHIYHVYGL 75


>UniRef50_A7F8E5 Cluster: Putative uncharacterized protein; n=1;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1500

 Score = 40.3 bits (90), Expect = 0.047
 Identities = 27/95 (28%), Positives = 42/95 (44%)
 Frame = +2

Query: 209  GYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRY 388
            GY   +R      G    +RG+ A ++R FP  A+ F   ++ + V +   + +T F R 
Sbjct: 1219 GYITAMRDIHTDEGLRGLFRGHSATILRIFPYAAIKFLAYEQIRAVIIPKHEYETPFRRL 1278

Query: 389  FXXXXXXXXXXXXTSLCFVYPLDFARTRLAADVGK 493
                         TS+ F YPL+  R RLA +  K
Sbjct: 1279 I-----SGSLAGVTSVFFTYPLEVMRVRLAFETKK 1308



 Score = 36.3 bits (80), Expect = 0.76
 Identities = 14/28 (50%), Positives = 22/28 (78%)
 Frame = +3

Query: 90   LAGGISAAVSKTAVAPIERVKLLLQVQH 173
            LAGG++ + +KT VAP++RVK+L Q  +
Sbjct: 1180 LAGGLAGSAAKTVVAPLDRVKILFQASN 1207


>UniRef50_Q86VD7 Cluster: Solute carrier family 25 member 42; n=34;
           Eumetazoa|Rep: Solute carrier family 25 member 42 - Homo
           sapiens (Human)
          Length = 318

 Score = 40.3 bits (90), Expect = 0.047
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 4/81 (4%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQV---FLGGVDKKTQFW-RYFXXXXXXXX 415
           G LS WRGN A ++R  P  A+ F+  ++YK++   + G   +    W R F        
Sbjct: 85  GFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLF-----AGA 139

Query: 416 XXXXTSLCFVYPLDFARTRLA 478
               T+    YPLD  R R+A
Sbjct: 140 LAGTTAASLTYPLDLVRARMA 160



 Score = 39.9 bits (89), Expect = 0.062
 Identities = 19/57 (33%), Positives = 36/57 (63%)
 Frame = +3

Query: 39  SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYK 209
           S+ +S+  D        L+G ++ A++KTAVAP++R K++ QV   SK+ +A + ++
Sbjct: 21  SSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVS--SKRFSAKEAFR 75


>UniRef50_P16260 Cluster: Grave disease carrier protein; n=29;
           Coelomata|Rep: Grave disease carrier protein - Homo
           sapiens (Human)
          Length = 332

 Score = 40.3 bits (90), Expect = 0.047
 Identities = 20/57 (35%), Positives = 34/57 (59%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           + FLAG I+   +KT VAP++RVK+LLQ  +         ++ G+  A   +P+++G
Sbjct: 38  RSFLAGSIAGCCAKTTVAPLDRVKVLLQAHN------HHYKHLGVFSALRAVPQKEG 88



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 28/92 (30%), Positives = 39/92 (42%)
 Frame = +2

Query: 224 LRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXX 403
           LR  PQ  G L  ++GN A +IR FP  A+ F   + YK +    +       R      
Sbjct: 80  LRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLM---- 135

Query: 404 XXXXXXXXTSLCFVYPLDFARTRLAADVGKGD 499
                   T++    P+D  R RLA  V KG+
Sbjct: 136 -AGSMAGMTAVICTDPVDMVRVRLAFQV-KGE 165


>UniRef50_Q9VQG4 Cluster: Congested-like trachea protein; n=10;
           Drosophila|Rep: Congested-like trachea protein -
           Drosophila melanogaster (Fruit fly)
          Length = 306

 Score = 40.3 bits (90), Expect = 0.047
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F+AG  S   S   +AP ER+K+LLQ Q        +++Y G++D   ++ KE 
Sbjct: 113 LTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQ---GGERKYNGMIDCAGKLYKEG 169

Query: 249 GL 254
           GL
Sbjct: 170 GL 171


>UniRef50_Q9LV81 Cluster: Mitochondrial carrier protein-like; n=8;
           Magnoliophyta|Rep: Mitochondrial carrier protein-like -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 428

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 2/87 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYK-QVF-LGGVDKKTQFWRYFXXXXXXXXXX 421
           G   FW+GN  N++R  P +++NF   D Y+ Q+  L G ++ T F R+           
Sbjct: 180 GIRGFWKGNLVNILRTAPFKSINFYAYDTYRGQLLKLSGNEETTNFERF-----VAGAAA 234

Query: 422 XXTSLCFVYPLDFARTRLAADVGKGDG 502
             T+     PLD  RT + A  G+  G
Sbjct: 235 GVTASLLCLPLDTIRTVMVAPGGEALG 261


>UniRef50_Q54FE6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 285

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 22/63 (34%), Positives = 33/63 (52%)
 Frame = +3

Query: 66  PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKE 245
           P+   +  +AGG +   +   + P+E VK  LQV     Q    Q+YKG +D  V+I KE
Sbjct: 95  PLTVGQCAIAGGFAGVGASVVLTPVELVKCRLQV-----QTTGPQKYKGSLDCLVQILKE 149

Query: 246 QGL 254
            G+
Sbjct: 150 GGI 152


>UniRef50_Q22V58 Cluster: Mitochondrial carrier protein; n=1;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 346

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV 167
           K FL+GGI+ A  KT +AP ERVKLL  V
Sbjct: 26  KSFLSGGIAGACGKTVIAPFERVKLLFVV 54



 Score = 39.5 bits (88), Expect = 0.082
 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFA-FKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           Q  G  + WRGN AN++R FP  ++NF+ F    K V+     +     +          
Sbjct: 94  QKHGFRNLWRGNSANLLRIFPFASINFSTFDYLRKNVYYPYPSENKIKKQLLLFCIGAVS 153

Query: 416 XXXXTSLCFVYPLDFARTRLA 478
                S+C  YP +F RTRLA
Sbjct: 154 GIVSQSIC--YPFEFIRTRLA 172


>UniRef50_Q4PF91 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 967

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 37/130 (28%), Positives = 54/130 (41%), Gaps = 2/130 (1%)
 Frame = +2

Query: 149  QAAAPSTARQQADRRRPALQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFK 328
            QAAA   A Q     R AL    R       G G  +FW GN  N ++ FP  A+ F   
Sbjct: 701  QAAAAKAAGQGLGMLREALWNLYR------DGGGLRAFWVGNGLNCLKIFPESAIKFLSY 754

Query: 329  DKYKQVFLGGVDKKTQFWRYF-XXXXXXXXXXXXTSLCFVYPLDFARTRL-AADVGKGDG 502
            +  K+ F   VD  +                   TS   +YP++  +TRL ++   K   
Sbjct: 755  ETAKRAFAKYVDNVSDSRDISGSSRFMSGGFGGITSQLAIYPVETLKTRLMSSQNAKTSL 814

Query: 503  QRNSPVSETA 532
            Q N+ +++TA
Sbjct: 815  QGNALLAKTA 824



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIA 191
           K  +AGGI+ AVS+TA AP +R+K+ L     S ++A
Sbjct: 650 KFLVAGGIAGAVSRTATAPFDRLKIYLITTARSPEVA 686


>UniRef50_O95258-3 Cluster: Isoform 3 of O95258 ; n=4; Eutheria|Rep:
           Isoform 3 of O95258 - Homo sapiens (Human)
          Length = 353

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 29/88 (32%), Positives = 47/88 (53%), Gaps = 3/88 (3%)
 Frame = +3

Query: 15  IHLVKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAA 194
           IH    T S++MS L       K F+ GG+++ V++    P++  K  LQVQ  S     
Sbjct: 22  IHQKSTTVSHEMSGLN-----WKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARF 76

Query: 195 DQ-RYKGIVDAFVRIPKEQGL--FHSGV 269
            + +Y+G+  A  RI KE+G+   +SG+
Sbjct: 77  KEIKYRGMFHALFRICKEEGVLALYSGI 104


>UniRef50_Q9VDL7 Cluster: CG4241-PA, isoform A; n=5;
           Endopterygota|Rep: CG4241-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 365

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 24/77 (31%), Positives = 34/77 (44%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G L+ WRGN A + R  P  A+ F   ++++++     D      R F            
Sbjct: 125 GVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRF----LAGSLAGI 180

Query: 428 TSLCFVYPLDFARTRLA 478
           TS    YPLD AR R+A
Sbjct: 181 TSQSLTYPLDLARARMA 197


>UniRef50_Q54QI8 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 326

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 28/104 (26%), Positives = 43/104 (41%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G    W+GN A ++R FP  A+ +   D  K  F+   DKK+    +             
Sbjct: 63  GLAGLWKGNTATILRIFPYSAIQWTSYDYLKNNFV--TDKKSSVQIFI-----AGSLGFS 115

Query: 428 TSLCFVYPLDFARTRLAADVGKGDGQRNSPVSETASARSSSPTV 559
            ++   YPLD  R RLA      +   NS  S+  ++ +  P V
Sbjct: 116 CAILLTYPLDVIRARLALSY-SNNNNNNSINSKNLNSSTQPPKV 158



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 15/27 (55%), Positives = 23/27 (85%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQ 170
           LAGG+S  ++K+ +AP+ERVK+L QV+
Sbjct: 16  LAGGVSGVIAKSTIAPLERVKILYQVK 42


>UniRef50_Q0E8F2 Cluster: CG32103-PA, isoform A; n=7;
           Endopterygota|Rep: CG32103-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 583

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 16/30 (53%), Positives = 24/30 (80%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           +  +AGGI+ AVS+T  AP++R+K+ LQVQ
Sbjct: 287 RHLVAGGIAGAVSRTCTAPLDRIKVYLQVQ 316



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           GS S WRGN  NV++  P  A  FA  ++ K++ + G D   Q                 
Sbjct: 334 GSRSMWRGNGINVLKIAPETAFKFAAYEQMKRL-IRGDDGSRQM--SIVERFYAGAAAGG 390

Query: 428 TSLCFVYPLDFARTRLA 478
            S   +YP++  +TRLA
Sbjct: 391 ISQTIIYPMEVLKTRLA 407


>UniRef50_Q6CQR3 Cluster: Similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w; n=1; Kluyveromyces lactis|Rep:
           Similar to sp|P53257 Saccharomyces cerevisiae YGR096w -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 317

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 21/64 (32%), Positives = 35/64 (54%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           + V++    +AG +S   ++ A AP++ VK+  Q+Q V      + +YKGI      I K
Sbjct: 14  ETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQ-----EDKYKGIASTVRTIMK 68

Query: 243 EQGL 254
           E+GL
Sbjct: 69  EEGL 72


>UniRef50_Q4RPP5 Cluster: Chromosome 12 SCAF15007, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 12 SCAF15007, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 499

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 17/44 (38%), Positives = 30/44 (68%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKG 212
           +  +AGG + AVS+T  AP++R+K+++QV+ V  Q A+ +   G
Sbjct: 167 RHLVAGGGAGAVSRTCTAPLDRLKVMMQVRQVQVQTASRRTVYG 210



 Score = 36.7 bits (81), Expect = 0.58
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKT-QFWRYFXXXXXXXXXXX 424
           G  S WRGN  NVI+  P  AL F   ++ K+V   G D++T      F           
Sbjct: 230 GVRSLWRGNGVNVIKIAPESALKFMAYEQIKRVM--GSDRETLSVLERFVAGSLAGVIAQ 287

Query: 425 XTSLCFVYPLDFARTRLA 478
            T    +YP++  +TRLA
Sbjct: 288 ST----IYPMEVLKTRLA 301


>UniRef50_Q581R5 Cluster: Mitochondrial carrier protein, putative;
           n=2; Trypanosoma|Rep: Mitochondrial carrier protein,
           putative - Trypanosoma brucei
          Length = 385

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 15/38 (39%), Positives = 26/38 (68%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHV 176
           D    A  F+AGG++ A S+T  AP++R+K+++Q  H+
Sbjct: 40  DSYTTAATFVAGGVAGACSRTLTAPLDRIKIIVQEGHL 77


>UniRef50_Q6C107 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 336

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 22/72 (30%), Positives = 42/72 (58%)
 Frame = +3

Query: 39  SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIV 218
           SN +S+ +D ++  +  L GGI+  VS+  +AP++ VK+ LQ+Q         + Y+GI 
Sbjct: 2   SNHLSSDSD-ISSTESMLCGGIAGMVSRFCIAPLDVVKIRLQLQK-----DGSRYYRGIF 55

Query: 219 DAFVRIPKEQGL 254
               +I +++G+
Sbjct: 56  QTMQQIVRDEGV 67


>UniRef50_Q2TWU9 Cluster: Mitochondrial solute carrier protein; n=1;
           Aspergillus oryzae|Rep: Mitochondrial solute carrier
           protein - Aspergillus oryzae
          Length = 337

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           +AGG++   +KT VAP+ER+K+L Q  +    +    R+ G ++A   I    G+
Sbjct: 45  VAGGVAGCAAKTIVAPMERIKILFQTSN-PHFLPYSTRWNGFIEAISHIRTSHGV 98



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 23/77 (29%), Positives = 38/77 (49%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  + ++G+ A++IR FP   +NF   ++ ++V +    + T F R+F            
Sbjct: 97  GVPALFKGHAASLIRVFPYAGINFLAYEQLQRVIIISPKRDTPFHRFF-----CGSTAGA 151

Query: 428 TSLCFVYPLDFARTRLA 478
            S  F YPL+  R RLA
Sbjct: 152 ISTAFTYPLELIRIRLA 168


>UniRef50_UPI0000F2C10D Cluster: PREDICTED: similar to Solute
           carrier family 25 (mitochondrial carrier; phosphate
           carrier), member 24; n=1; Monodelphis domestica|Rep:
           PREDICTED: similar to Solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 24 -
           Monodelphis domestica
          Length = 602

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 17/34 (50%), Positives = 28/34 (82%), Gaps = 1/34 (2%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQV-QHVSKQI 188
           L+GGI+ AVS+T  AP+ER+K+++QV  H+ ++I
Sbjct: 308 LSGGIAGAVSRTCTAPLERLKIIMQVGGHMPQKI 341


>UniRef50_Q96PZ1 Cluster: Solute carrier family 25 member 25; n=123;
           Coelomata|Rep: Solute carrier family 25 member 25 - Homo
           sapiens (Human)
          Length = 568

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 287 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 337



 Score = 33.1 bits (72), Expect = 7.1
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 337 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 394

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 395 SS---IYPMEVLKTRMA 408


>UniRef50_Q9UJS0 Cluster: Calcium-binding mitochondrial carrier
           protein Aralar2; n=64; Eumetazoa|Rep: Calcium-binding
           mitochondrial carrier protein Aralar2 - Homo sapiens
           (Human)
          Length = 675

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  +     +  YK   D F ++ + +G F
Sbjct: 332 FGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFF 388


>UniRef50_UPI00015B42B4 Cluster: PREDICTED: similar to mitochondrial
           solute carrier protein, putative; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to mitochondrial
           solute carrier protein, putative - Nasonia vitripennis
          Length = 338

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 22/77 (28%), Positives = 36/77 (46%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G +S WRGN A ++R  P  A+ F   +++K++     +   +  R+             
Sbjct: 108 GLVSLWRGNSATMVRIIPYAAIQFTAFEQWKRILKVEEEHDHKTRRFL-----AGALAGT 162

Query: 428 TSLCFVYPLDFARTRLA 478
           TS    YPLD AR ++A
Sbjct: 163 TSQSMTYPLDLARAQMA 179


>UniRef50_A7SGK5 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 301

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 15/29 (51%), Positives = 22/29 (75%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQH 173
           F+AGG+S   +KT  AP+ER+K+L Q Q+
Sbjct: 10  FVAGGLSTCCAKTTTAPLERLKILFQAQN 38



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 21/80 (26%), Positives = 34/80 (42%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G   +++GN A ++R FP  ++ F   ++YK +F   +                      
Sbjct: 58  GLQGYYKGNGAMMVRVFPYGSIQFVSYEQYKLLFENALQNS------HLSKIVAGGLAGL 111

Query: 428 TSLCFVYPLDFARTRLAADV 487
           T+    YPLD  R+RLA  V
Sbjct: 112 TACSCTYPLDIVRSRLAFQV 131


>UniRef50_Q4P4I1 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 462

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 15/27 (55%), Positives = 23/27 (85%)
 Frame = +3

Query: 93  AGGISAAVSKTAVAPIERVKLLLQVQH 173
           AGGI+  V+K+A+AP++RVK+L Q Q+
Sbjct: 84  AGGIAGCVAKSAIAPLDRVKILFQAQN 110


>UniRef50_O95258 Cluster: Brain mitochondrial carrier protein 1;
           n=65; Eumetazoa|Rep: Brain mitochondrial carrier protein
           1 - Homo sapiens (Human)
          Length = 325

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ-RYKGIVDAFVRIPKEQGL- 254
           K F+ GG+++ V++    P++  K  LQVQ  S      + +Y+G+  A  RI KE+G+ 
Sbjct: 42  KPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVL 101

Query: 255 -FHSGV 269
             +SG+
Sbjct: 102 ALYSGI 107


>UniRef50_Q9M2Z8 Cluster: Mitochondrial phosphate transporter; n=10;
           Magnoliophyta|Rep: Mitochondrial phosphate transporter -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 363

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 42  NKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVD 221
           N+   +  P  FA   +AG +S  ++ TA+ P++ +K  +Q+  +        +YK I  
Sbjct: 56  NEKVEMYSPAYFAACTVAGMLSCGITHTAITPLDVIKCNMQIDPL--------KYKNITS 107

Query: 222 AFVRIPKEQGL 254
           AF    KEQGL
Sbjct: 108 AFKTTIKEQGL 118


>UniRef50_Q67Z63 Cluster: Mitochondrial carrier like protein; n=16;
           Magnoliophyta|Rep: Mitochondrial carrier like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 337

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 17/41 (41%), Positives = 27/41 (65%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR 203
           ++ LAGGI+ A+SKT  AP+ R+ +L Q+Q +  + A   R
Sbjct: 43  QNLLAGGIAGAISKTCTAPLARLTILFQLQGMQSEGAVLSR 83



 Score = 36.3 bits (80), Expect = 0.76
 Identities = 24/81 (29%), Positives = 32/81 (39%), Gaps = 3/81 (3%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYF---XXXXXXXXX 418
           G  +FW+GN   V+   P  A+NF   +KY   F      ++                  
Sbjct: 98  GYRAFWKGNLVTVVHRIPYTAVNFYAYEKYNLFFNSNPVVQSFIGNTSGNPMVHFVSGGL 157

Query: 419 XXXTSLCFVYPLDFARTRLAA 481
              T+    YPLD  RTRLAA
Sbjct: 158 AGITAATATYPLDLVRTRLAA 178


>UniRef50_Q55BF4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 306

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 3/80 (3%)
 Frame = +3

Query: 42  NKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR-YKGIV 218
           N   N  + VA    F++G +++  + T   PIE VK  LQ+Q    ++   QR Y G+ 
Sbjct: 6   NNNKNNKNKVAIG--FISGSLASICATTVTNPIELVKTRLQLQG---ELQLSQRIYNGVW 60

Query: 219 DAFVRIPKEQGL--FHSGVV 272
           DAF +I K +G+    SG++
Sbjct: 61  DAFKQIYKTEGIRGLQSGLI 80


>UniRef50_Q75EP3 Cluster: AAR036Wp; n=1; Eremothecium gossypii|Rep:
           AAR036Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 317

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 17/55 (30%), Positives = 35/55 (63%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           +AG +S  V+++  AP++ VK+  Q+Q     +A++ +Y GI+  F  + +E+G+
Sbjct: 29  VAGSVSGLVARSVTAPMDTVKIRRQLQ-----LASEHKYHGILHTFRTVAREEGV 78


>UniRef50_Q6CQV1 Cluster: Similarities with sp|P40556 Saccharomyces
           cerevisiae YIL006w; n=1; Kluyveromyces lactis|Rep:
           Similarities with sp|P40556 Saccharomyces cerevisiae
           YIL006w - Kluyveromyces lactis (Yeast) (Candida
           sphaerica)
          Length = 431

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 6/69 (8%)
 Frame = +3

Query: 84  DFLAGGISA----AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +FL+  +SA    A+S T   PI  VK  L +Q   K I     YK  +DAF++I K +G
Sbjct: 214 EFLSHSMSALTAGAISTTLTNPIWVVKTRLMLQS-GKNIKGMTHYKNTLDAFIKIYKVEG 272

Query: 252 L--FHSGVV 272
           +  F+SG++
Sbjct: 273 IKSFYSGLI 281


>UniRef50_UPI00005A1267 Cluster: PREDICTED: similar to solute
           carrier family 25 member 24 isoform 1; n=2; Canis lupus
           familiaris|Rep: PREDICTED: similar to solute carrier
           family 25 member 24 isoform 1 - Canis familiaris
          Length = 488

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 24/85 (28%), Positives = 39/85 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G +S WRGN  +V++  P  A+     ++YK+ FL     K + +  F            
Sbjct: 319 GVISLWRGNGMHVLKIAPETAVKVWSYEQYKK-FLSSEGTKLETFEQF----ASASLAGA 373

Query: 428 TSLCFVYPLDFARTRLAADVGKGDG 502
           T+  F+YPL+  +T L     +G G
Sbjct: 374 TAQSFIYPLELLKTHLLNTDTEGPG 398



 Score = 36.7 bits (81), Expect = 0.58
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           LAGGI+   ++T  AP+ER+K L+Q Q      + + +   I++ F+ + KE G+
Sbjct: 272 LAGGIAGTCARTCTAPLERLKTLMQAQ------SLEAKNVKIINHFIEMVKEGGV 320


>UniRef50_Q91TH9 Cluster: T121.1; n=1; Tupaiid herpesvirus 1|Rep:
           T121.1 - Tupaiid herpesvirus 1 (strain 1) (TuHV-1)
           (Herpesvirus tupaia (strain1))
          Length = 389

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 21/52 (40%), Positives = 25/52 (48%)
 Frame = -1

Query: 503 GHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRG 348
           GH     R R G  R+ GGT  T R  R   RR   +RS  R A++  RR G
Sbjct: 252 GHSGRSERLRSGSTRTNGGTACTPRRCRADSRRTTGRRSENRVAAAATRRWG 303


>UniRef50_Q8NAU4 Cluster: CDNA FLJ34775 fis, clone NT2NE2003315;
           n=1; Homo sapiens|Rep: CDNA FLJ34775 fis, clone
           NT2NE2003315 - Homo sapiens (Human)
          Length = 138

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 18/27 (66%), Positives = 21/27 (77%)
 Frame = -2

Query: 139 IGATAVLETAAEIPPARKSLANATGSA 59
           +GATAVLE AA  PPARKSLA  T ++
Sbjct: 1   MGATAVLEMAAATPPARKSLAKDTAAS 27


>UniRef50_Q5KD66 Cluster: Coenzyme A transporter, putative; n=1;
           Filobasidiella neoformans|Rep: Coenzyme A transporter,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 381

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 14/28 (50%), Positives = 23/28 (82%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQH 173
           +AGGI+  V+KT++AP++RVK+L Q  +
Sbjct: 82  IAGGIAGCVAKTSIAPLDRVKILFQTSN 109


>UniRef50_Q4P0R0 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 693

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 18/74 (24%), Positives = 36/74 (48%)
 Frame = +3

Query: 39  SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIV 218
           SN  S   + + + + +LAGG++   +     P+E +++ LQ Q       +   Y+G +
Sbjct: 491 SNVSSGRKEDLTYTQFYLAGGVAGLANSFVAGPVEHIRIRLQTQ------PSPPLYRGPM 544

Query: 219 DAFVRIPKEQGLFH 260
           D   ++    G+FH
Sbjct: 545 DCLKQMLSSSGIFH 558


>UniRef50_A2R5Z0 Cluster: Contig An15c0200, complete genome; n=8;
           Eurotiomycetidae|Rep: Contig An15c0200, complete genome
           - Aspergillus niger
          Length = 585

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 16/28 (57%), Positives = 23/28 (82%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           F+AGGI+ AVS+TA AP++R+K+ L  Q
Sbjct: 274 FVAGGIAGAVSRTATAPLDRLKVYLIAQ 301


>UniRef50_A7SPL4 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 308

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 7/63 (11%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQV------QHVSKQIAADQRYKGIV-DAFVRIPKE 245
           F+ GG+S   + T   PIE VK+ +Q+      +H SK I  ++ YKG++     R+ +E
Sbjct: 12  FVLGGLSCMTATTVTNPIEVVKIRMQLDNELGSKHNSKDIFRERYYKGLIRTGLSRVYRE 71

Query: 246 QGL 254
           +G+
Sbjct: 72  EGV 74


>UniRef50_Q5KJD1 Cluster: Mitochondrial carrier protein, putative;
           n=1; Filobasidiella neoformans|Rep: Mitochondrial
           carrier protein, putative - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 660

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 1/93 (1%)
 Frame = +2

Query: 227 RPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRY-FXXXX 403
           R + +G G  +FW GN  NV +  P  A+ F   ++ K+      DK +           
Sbjct: 418 RIYMEGGGLRAFWVGNGLNVTKILPESAIKFVSYEQSKKFLAKYWDKVSDPSELSSSSRF 477

Query: 404 XXXXXXXXTSLCFVYPLDFARTRLAADVGKGDG 502
                   TS   +Y L+  +TR+ +D+G   G
Sbjct: 478 ISGGVGGITSQLAIYGLETLKTRIQSDIGPNQG 510


>UniRef50_Q1EAW9 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 469

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 17/56 (30%), Positives = 34/56 (60%)
 Frame = +3

Query: 54  NLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVD 221
           ++ +P+     FLAGG++  VS+T+ AP++R+++ L  Q   + +AA  +    V+
Sbjct: 170 HINEPLQGLGYFLAGGMAGVVSRTSTAPLDRLRVYLIAQTKPQSVAASVKSGAAVE 225


>UniRef50_Q20799 Cluster: Probable calcium-binding mitochondrial
           carrier F55A11.4; n=4; Caenorhabditis|Rep: Probable
           calcium-binding mitochondrial carrier F55A11.4 -
           Caenorhabditis elegans
          Length = 588

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 2/84 (2%)
 Frame = +2

Query: 233 HPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF--LGGVDKKTQFWRYFXXXXX 406
           H +G G  SFWRGN  NVI+  P  A+ F   D+ K++     G ++ + F R       
Sbjct: 296 HAEG-GIKSFWRGNGINVIKIAPESAIKFMCYDQLKRLIQKKKGNEEISTFER-----LC 349

Query: 407 XXXXXXXTSLCFVYPLDFARTRLA 478
                   S   +YP++  +TRLA
Sbjct: 350 AGSAAGAISQSTIYPMEVMKTRLA 373



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV 167
           +  +AGG + AVS+T  AP +R+K+ LQV
Sbjct: 250 RHLVAGGAAGAVSRTCTAPFDRIKVYLQV 278


>UniRef50_Q9XI74 Cluster: F7A19.22 protein; n=10; Magnoliophyta|Rep:
           F7A19.22 protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 305

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 17/68 (25%), Positives = 34/68 (50%)
 Frame = +3

Query: 51  SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 230
           +N ++ +  A   L GG S  +++   +P + VK+ +Q            RY G ++AF 
Sbjct: 106 TNNSESLPLATKALVGGFSGVIAQVVASPADLVKVRMQADGRLVSQGLKPRYSGPIEAFT 165

Query: 231 RIPKEQGL 254
           +I + +G+
Sbjct: 166 KILQSEGV 173


>UniRef50_Q8I4M0 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 360

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           + DP +    F+ G  +        AP ER+KLLLQ+Q       A  ++ G +DA  ++
Sbjct: 89  MEDPDSITSHFVGGCAAGMAQSVIAAPTERIKLLLQIQ----DDKAHTKFNGPIDATKQL 144

Query: 237 PKEQGL 254
            +  GL
Sbjct: 145 LRTHGL 150


>UniRef50_O01883 Cluster: Uncoupling protein (Mitochondrial
           substrate carrier) protein 4; n=2; Caenorhabditis|Rep:
           Uncoupling protein (Mitochondrial substrate carrier)
           protein 4 - Caenorhabditis elegans
          Length = 324

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           K  L G  S  +++ A +P + VK+ +Q++ + +      RY G  D F  + + QG F
Sbjct: 121 KSMLCGAFSGLIAQFAASPTDLVKVQMQMEGLRRLQKQPLRYTGATDCFRSLYRTQGFF 179


>UniRef50_A7SLQ3 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 335

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 21/55 (38%), Positives = 31/55 (56%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           LAG  S  ++   V P E +K  L VQHV+K   ++  YKG+  A   I +E+G+
Sbjct: 111 LAGTSSTLIAMVTVYPCEVIKTRLTVQHVNK---SNAHYKGMRHALKTILREEGI 162



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 17/62 (27%), Positives = 33/62 (53%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + FL GG SA ++++  +P+E VK+L QV          +   G++  F  + K +
Sbjct: 10  ITWFQSFLCGGTSAVLARSLTSPLEVVKVLAQV-------GTQEAKPGLIRTFASVYKRE 62

Query: 249 GL 254
           G+
Sbjct: 63  GI 64


>UniRef50_Q6C6B6 Cluster: Similar to DEHA0A11253g Debaryomyces
           hansenii; n=1; Yarrowia lipolytica|Rep: Similar to
           DEHA0A11253g Debaryomyces hansenii - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 551

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 14/25 (56%), Positives = 22/25 (88%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLL 161
           FLAGG++ A+S+TA AP++R+K+ L
Sbjct: 226 FLAGGLAGAISRTATAPLDRLKVYL 250


>UniRef50_Q4P222 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 504

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +3

Query: 51  SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 230
           S LA+    A  F  GGI+ +   T V PI+ VK  +Q Q  S  +     YK  +D   
Sbjct: 154 SALAEIGKSAYSFGLGGIAGSTGATLVYPIDLVKTRMQNQR-SSVVGEPLMYKNSIDCVK 212

Query: 231 RIPKEQGL--FHSGV 269
           ++ + +GL  F+SG+
Sbjct: 213 KVFRNEGLRGFYSGL 227


>UniRef50_P32332 Cluster: Mitochondrial oxaloacetate transport
           protein; n=7; Saccharomycetales|Rep: Mitochondrial
           oxaloacetate transport protein - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 324

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           F+AGG++A ++ T   PIE +K+ +Q+Q      AA + YK  +     I K +G+
Sbjct: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAA-KVYKNPIQGMAVIFKNEGI 80


>UniRef50_P38702 Cluster: Mitochondrial carrier protein LEU5; n=8;
           Ascomycota|Rep: Mitochondrial carrier protein LEU5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 357

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 14/28 (50%), Positives = 22/28 (78%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQH 173
           LAGGIS + +KT +AP++R+K+L Q  +
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSN 65



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 18/63 (28%), Positives = 35/63 (55%)
 Frame = +3

Query: 66  PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKE 245
           P+    + ++GG++   S+TA  P E ++  LQV  +S +   D +++ I +    I KE
Sbjct: 261 PLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKE 320

Query: 246 QGL 254
           +G+
Sbjct: 321 RGV 323


>UniRef50_Q4A3J5 Cluster: Mitochondrial carrier like protein; n=6;
           Magnoliophyta|Rep: Mitochondrial carrier like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 363

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 13/23 (56%), Positives = 21/23 (91%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           +SG+ +CI+K+F+S+G+ GLYRG
Sbjct: 258 YSGVIDCITKVFRSEGIPGLYRG 280



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 18/53 (33%), Positives = 30/53 (56%)
 Frame = +3

Query: 93  AGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           AG  + A++ T V P++ +K  LQV  + +  A+ QR   I+ +   I KE+G
Sbjct: 23  AGATAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEG 75


>UniRef50_Q9W0Y9 Cluster: CG2857-PA; n=2; Sophophora|Rep: CG2857-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 323

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 15/55 (27%), Positives = 31/55 (56%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           + GGI+ A ++T   P++ +K+  Q+Q          +Y+G++ AF  +  E+G+
Sbjct: 14  VGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGM 68


>UniRef50_Q54RB9 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 772

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 21/54 (38%), Positives = 30/54 (55%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAG ++   + + V P + +K  LQV    K  A +Q Y GI D F +I KE+G
Sbjct: 631 LAGAVAGIPAASLVTPADVIKTRLQV----KANAGEQTYTGIRDCFQKILKEEG 680


>UniRef50_Q9HE62 Cluster: Related to peroxisomal Ca-dependent solute
           carrier protein; n=5; Pezizomycotina|Rep: Related to
           peroxisomal Ca-dependent solute carrier protein -
           Neurospora crassa
          Length = 631

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 17/41 (41%), Positives = 24/41 (58%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYK 209
           FLAG +S  VS+TA AP++R+K+ L V    K     +  K
Sbjct: 319 FLAGAVSGGVSRTATAPLDRLKVFLLVNTKPKSTTTVEAVK 359


>UniRef50_Q9FWW1 Cluster: Putative uncharacterized protein
           OSJNBa0051D19.1; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OSJNBa0051D19.1 - Oryza sativa subsp. japonica (Rice)
          Length = 104

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 28/76 (36%), Positives = 38/76 (50%), Gaps = 4/76 (5%)
 Frame = -1

Query: 554 SDLKILL--MQFPRPE--NYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRS 387
           +DL++L   + +PRP+    AG +  R RRR G+ R RG      R L R  R P +   
Sbjct: 2   TDLRLLSPDLAWPRPDPAEAAGVVAQRERRRYGWQR-RGAPLWRRRRLARPARAPTHASG 60

Query: 386 NARTASSCQRRRGTPA 339
               A   +RRRGT A
Sbjct: 61  ARGVARWSRRRRGTSA 76


>UniRef50_A4RZP0 Cluster: MC family transporter:
           aspartate/glutamate; n=2; Ostreococcus|Rep: MC family
           transporter: aspartate/glutamate - Ostreococcus
           lucimarinus CCE9901
          Length = 292

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 19/59 (32%), Positives = 32/59 (54%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           FA+  LAGG +  ++ T   P++ ++  L  Q   K       Y GI DAF++I +++G
Sbjct: 114 FAQRLLAGGSAGCIACTLTYPLDLIRTRLAAQTTVKH------YNGIADAFMKILRDEG 166


>UniRef50_Q5VM58 Cluster: Mitochondrial carrier family protein; n=2;
           Entamoeba histolytica|Rep: Mitochondrial carrier family
           protein - Entamoeba histolytica
          Length = 276

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 22/92 (23%), Positives = 37/92 (40%)
 Frame = +2

Query: 218 RRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXX 397
           + LR      G +  WRGNF N ++  PT A+ F   +  K++      +++     F  
Sbjct: 47  KMLRDLLANEGVIGLWRGNFVNCMKVAPTTAVKFFVTESLKRIAKDYYARRS-LQLPFSV 105

Query: 398 XXXXXXXXXXTSLCFVYPLDFARTRLAADVGK 493
                      S    +P+D  RTR+  +  K
Sbjct: 106 NFAIGALGAIASTMVSHPIDVIRTRMTIETTK 137


>UniRef50_Q552L9 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 366

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 23/71 (32%), Positives = 34/71 (47%)
 Frame = +3

Query: 39  SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIV 218
           +N  SN+   V   K  +A      +S   V P++ VK  LQ Q+    I     +KG +
Sbjct: 21  NNNDSNIHKNVK--KLMVASIFGGIMSSLIVTPLDVVKTRLQTQNTGSHINQKHVFKGTL 78

Query: 219 DAFVRIPKEQG 251
           DAF +I K +G
Sbjct: 79  DAFKKIYKNEG 89


>UniRef50_Q4UHC8 Cluster: Splicing factor, putative; n=3;
           Piroplasmida|Rep: Splicing factor, putative - Theileria
           annulata
          Length = 425

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = -1

Query: 527 FPRPENYAGHLP-YRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNART 375
           +PR   Y G    YRH+R     R R  +RS +R+  R  R  DY R   +T
Sbjct: 55  YPRSHGYRGDYERYRHKRSRSRSRDRYRSRSRDRYRDRDDRYDDYNRDGDKT 106


>UniRef50_A0DPV1 Cluster: Chromosome undetermined scaffold_598,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_598,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 169

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 5/58 (8%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQV--QHVSKQIAADQRYK---GIVDAFVRIPKEQGL 254
           GG+S  ++KT  APIE+VKL L +    ++    ++Q ++   GI+D F R+   +G+
Sbjct: 23  GGVSEVLAKTIAAPIEKVKLKLFIDPNRITTSYTSNQIFRLQLGILDCFKRVFVYEGV 80


>UniRef50_Q4P6T0 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 237

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = -1

Query: 494 PYRHRR-RDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRG 348
           PY+    R GY   RGGT S++ + RR    P Y  S++    S +R RG
Sbjct: 14  PYKDETSRRGYRNDRGGTSSSQEFRRRRSPSPGYSWSSSSRHDSDRRERG 63


>UniRef50_Q4SBJ1 Cluster: Chromosome 15 SCAF14667, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 15
           SCAF14667, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 763

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 18/57 (31%), Positives = 27/57 (47%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G I+ A   TAV PI+ VK  +Q Q  +     +  YK   D   ++ + +G F
Sbjct: 379 FTLGSIAGATGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCAKKVLRYEGFF 435


>UniRef50_Q2QR79 Cluster: Retrotransposon protein, putative,
           unclassified; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 143

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = -1

Query: 503 GHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNAR---TASSCQRRRGTPACT 333
           G  P R  RR    ++ GG R T    RR  RRP+++++ AR   T ++  RR GT    
Sbjct: 11  GAAPERAERRG---KANGGLRLTPGQRRRRERRPEWRKAAARLGMTMATALRRDGTSLSR 67

Query: 332 CP*RRS*APG 303
            P + +  PG
Sbjct: 68  IPPKSTIRPG 77


>UniRef50_A7QM39 Cluster: Chromosome undetermined scaffold_123,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_123, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 57

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 17/28 (60%), Positives = 18/28 (64%)
 Frame = -2

Query: 163 WSSSLTRSIGATAVLETAAEIPPARKSL 80
           W   LTRSIGA A LET  E  P RKS+
Sbjct: 12  WFGFLTRSIGAAADLETTIETSPIRKSI 39


>UniRef50_Q8IHJ0 Cluster: Putative mitochondrial carrier protein;
           n=1; Brugia malayi|Rep: Putative mitochondrial carrier
           protein - Brugia malayi (Filarial nematode worm)
          Length = 305

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 3/80 (3%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDK---KTQFWRYFXXXXXXXXX 418
           G +S WRGN A ++R  P   + F   ++ K +    VDK   +T   RY          
Sbjct: 72  GLMSLWRGNSAMMVRIVPYAVIQFGAHEEIKHIL--RVDKDGIRTPVKRYIAGSLAGVVA 129

Query: 419 XXXTSLCFVYPLDFARTRLA 478
              T     YPLD A+ RLA
Sbjct: 130 TTCT-----YPLDTAKARLA 144


>UniRef50_Q23PQ2 Cluster: Mitochondrial carrier protein; n=2;
           Tetrahymena thermophila SB210|Rep: Mitochondrial carrier
           protein - Tetrahymena thermophila SB210
          Length = 300

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  +FW+GNF++++R   +   +F   +++ Q F    +K    ++ F            
Sbjct: 67  GLYAFWKGNFSHILRQSLSTLSSFMLANQF-QRFFNFQEKSQSHFQQFLQNVLFGGISGC 125

Query: 428 TSLCFVYPLDFARTRLAAD 484
             +   YPL+ AR +L  D
Sbjct: 126 IVMSLWYPLEVARIKLTND 144



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)
 Frame = +3

Query: 96  GGISAAVSKTAV-APIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGLF 257
           GG    ++ T V +P+E ++L LQ      +I   Q+ Y GIVD+  +I KE+GL+
Sbjct: 14  GGFLKTIAYTTVGSPLEVIRLRLQNSSEMVKIGYLQKNYSGIVDSVKQIAKEEGLY 69


>UniRef50_A7T3S4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 339

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQ---HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           G +S  +SK  + P + +K  +QVQ      +     Q+Y G+ D F  I KE+G
Sbjct: 231 GALSGMISKAVILPFDIIKKRIQVQGFEEARQSFGRVQQYDGVKDCFRTILKEEG 285


>UniRef50_P55916 Cluster: Mitochondrial uncoupling protein 3; n=143;
           Eumetazoa|Rep: Mitochondrial uncoupling protein 3 - Homo
           sapiens (Human)
          Length = 312

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           AD  +     LAG  + A++ T   P + VK+  Q         +D++Y G +DA+  I 
Sbjct: 111 ADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIA 170

Query: 240 KEQGL 254
           +E+G+
Sbjct: 171 REEGV 175


>UniRef50_Q0FKG0 Cluster: Putative uncharacterized protein; n=1;
           Roseovarius sp. HTCC2601|Rep: Putative uncharacterized
           protein - Roseovarius sp. HTCC2601
          Length = 597

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 26/60 (43%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +3

Query: 531 HQQDLQVRRSDWSVQRFRCVRASIIIYRASY-FGFYDTARGMLPDP--KNTPIVISWASL 701
           H+  L+V RSD SVQ F CV A   IYR +Y    Y  AR  L +   K+   V +WA L
Sbjct: 328 HRDGLKVARSDPSVQGFACV-ARAQIYRRTYRTEEYQAARDCLEETVRKDPDYVRAWAML 386


>UniRef50_Q0II44 Cluster: Similar to solute carrier family 25 member
           25; n=2; Theria|Rep: Similar to solute carrier family 25
           member 25 - Bos taurus (Bovine)
          Length = 349

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 24/84 (28%), Positives = 35/84 (41%)
 Frame = +2

Query: 224 LRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXX 403
           LR   Q  G  S WRGN  NV++  P  A+ F+  ++ K  F G  +        F    
Sbjct: 134 LRSLIQEGGIRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGVHESPP-----FQERL 188

Query: 404 XXXXXXXXTSLCFVYPLDFARTRL 475
                   TS   + P++  +TRL
Sbjct: 189 LAGSLAVATSQTLINPMEVLKTRL 212



 Score = 33.1 bits (72), Expect = 7.1
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           A  K  L+G ++ AVS+T  AP++R K+ +QV    K
Sbjct: 89  ALWKFLLSGAMAGAVSRTGTAPLDRAKVYMQVYSSKK 125


>UniRef50_Q5D8U9 Cluster: SJCHGC06784 protein; n=3; Schistosoma
           japonicum|Rep: SJCHGC06784 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 313

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 22/77 (28%), Positives = 30/77 (38%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G LS WRGN  N+++  P  A+ F      K V    V                      
Sbjct: 71  GILSLWRGNGVNILKNCPESAIRFGLHGWLKSVIFPNVKGPLS----PKDRLLVASLAGA 126

Query: 428 TSLCFVYPLDFARTRLA 478
           TSL   YP++  +TR+A
Sbjct: 127 TSLTITYPVEILKTRMA 143



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 14/27 (51%), Positives = 21/27 (77%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQV 167
           F+ GGIS  VS+T  AP++R+K+L Q+
Sbjct: 23  FVCGGISGTVSRTVTAPMDRLKVLRQM 49


>UniRef50_Q55E45 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 303

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 22/62 (35%), Positives = 34/62 (54%)
 Frame = +3

Query: 66  PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKE 245
           P      F AG  +AAV+     P++ +K  +QVQ  +++    Q YKG+ D+F  I KE
Sbjct: 213 PYQLGSGFFAGAFAAAVT----CPLDVIKTRIQVQRSTEK----QIYKGMWDSFKTILKE 264

Query: 246 QG 251
           +G
Sbjct: 265 EG 266


>UniRef50_Q54KZ6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 283

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 22/80 (27%), Positives = 37/80 (46%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G   F+RGN AN+I+  P  A+ F   +  K++F     + T   R+             
Sbjct: 47  GIKGFFRGNLANIIKVSPESAVKFGTYEYVKKLFAENDCELTSAQRFI-----SGSVAGV 101

Query: 428 TSLCFVYPLDFARTRLAADV 487
            S   ++PL+  R RL+A++
Sbjct: 102 VSHTTLFPLEVVRLRLSAEI 121


>UniRef50_Q385C8 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 1454

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +3

Query: 129 VAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLFHSGVV 272
           VA +ER  L L V+H+   + + Q+YK + +  V++P E     +G+V
Sbjct: 815 VAQVERSPLELYVRHLLNDVLSRQKYKFVCEKLVKVPWEDPAKRNGLV 862


>UniRef50_Q59YC3 Cluster: Mitochondrial carrier family and EF hand
           protein; n=4; Saccharomycetales|Rep: Mitochondrial
           carrier family and EF hand protein - Candida albicans
           (Yeast)
          Length = 572

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLL 161
           K FLAGG++  VS+T  AP +R+K+ L
Sbjct: 217 KFFLAGGLAGVVSRTCTAPFDRIKVFL 243


>UniRef50_Q0UZJ2 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 519

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 3/62 (4%)
 Frame = +3

Query: 93  AGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG---LFHS 263
           +G    A++K    P++ V   LQVQ   K+      Y GI+DA   I + +G    F+S
Sbjct: 46  SGAAGTAIAKLVTYPLDLVITRLQVQRQLKRDGKHAHYTGILDAIETIYEREGGLKAFYS 105

Query: 264 GV 269
           GV
Sbjct: 106 GV 107


>UniRef50_A0CXN4 Cluster: Chromosome undetermined scaffold_30, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_30,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 306

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           F+AG +   +S T   P+E  +  L +Q+ +K +    +Y G +D    I KE+GL
Sbjct: 14  FIAGLVGGFISVTVCHPLEVARSRLNLQNATKSM---NKYHGFIDTLCVIYKEEGL 66


>UniRef50_Q4X022 Cluster: Mitochondrial deoxynucleotide carrier
           protein, putative; n=15; Pezizomycotina|Rep:
           Mitochondrial deoxynucleotide carrier protein, putative
           - Aspergillus fumigatus (Sartorya fumigata)
          Length = 341

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 6/61 (9%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR------YKGIVDAFVRIPKEQG 251
           L+GGI+  VS+  VAP++ VK+ LQ+Q  S    A         YKG +     I K++G
Sbjct: 43  LSGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPASHHDVVGPIYKGTLSTMRTIIKQEG 102

Query: 252 L 254
           +
Sbjct: 103 I 103


>UniRef50_Q8WUT9 Cluster: Solute carrier family 25 member 43; n=16;
           Euteleostomi|Rep: Solute carrier family 25 member 43 -
           Homo sapiens (Human)
          Length = 341

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ--HVSKQIAADQRYKGIVDAFVRI 236
           D  +  ++F    ++AAV++T   P E VK  +Q Q  ++      D  + G VD F +I
Sbjct: 197 DQFSLPQNFANVCLAAAVTQTLSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQI 256

Query: 237 PKEQGL 254
            K QG+
Sbjct: 257 VKAQGV 262


>UniRef50_Q9H1K4 Cluster: Mitochondrial glutamate carrier 2 (GC-2)
           (Glutamate/H(+) symporter 2); n=31; Eumetazoa|Rep:
           Mitochondrial glutamate carrier 2 (GC-2) (Glutamate/H(+)
           symporter 2) - Homo sapiens (Human)
          Length = 315

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           GG++  V  T V PI+  K  LQ QH          YKG++D  ++  + +G F
Sbjct: 15  GGVAGLVGVTCVFPIDLAKTRLQNQH------GKAMYKGMIDCLMKTARAEGFF 62


>UniRef50_Q4RV71 Cluster: Chromosome 15 SCAF14992, whole genome
           shotgun sequence; n=4; Tetraodontidae|Rep: Chromosome 15
           SCAF14992, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 514

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +3

Query: 48  MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 227
           +S+  + +   + FLAG ++ A ++TA+ P+E +K  L ++          +Y G+ D  
Sbjct: 317 LSSKGEKIKTHQRFLAGSLAGATAQTAIYPMEVLKTRLTLRKTG-------QYSGMFDCA 369

Query: 228 VRIPKEQGL--FHSGVV 272
            +I +E+G+  F+ G V
Sbjct: 370 KKILREEGVKAFYKGYV 386



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 13/30 (43%), Positives = 22/30 (73%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           K  +AG  + AVS+T  AP++R+K+ +QV+
Sbjct: 195 KHLVAGAAAGAVSRTGTAPLDRMKVFMQVR 224


>UniRef50_Q0E592 Cluster: SNF2 DEAD-like helicase 110.8 kDa; n=2;
            Ascovirus|Rep: SNF2 DEAD-like helicase 110.8 kDa -
            Spodoptera frugiperda ascovirus 1a
          Length = 978

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 3/54 (5%)
 Frame = -2

Query: 184  CLLT---CCTWSSSLTRSIGATAVLETAAEIPPARKSLANATGSARFDILFDYV 32
            C+LT   C TW+SS  R IG+   +  AA  P      A      R D LF YV
Sbjct: 916  CVLTGRKCVTWTSSKLREIGSGVGVRVAANSPRKATCSAIEQEFGRLDALFAYV 969


>UniRef50_A3B6T2 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 181

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 27/73 (36%), Positives = 32/73 (43%)
 Frame = -1

Query: 515 ENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPAC 336
           E  A H   R  RR G  R+ GG+RS  R   R  RRPD +   A  A   +   G   C
Sbjct: 58  EAAAAHGGPRRSRRPGEARTSGGSRSRRRRRSRTRRRPDAEA--AAVADEAEAAHG-GRC 114

Query: 335 TCP*RRS*APGSG 297
               RR+ A G G
Sbjct: 115 EERRRRAAAVGRG 127


>UniRef50_Q4QF00 Cluster: Mitochondrial ornithine carrier
           protein-like protein; n=5; Trypanosomatidae|Rep:
           Mitochondrial ornithine carrier protein-like protein -
           Leishmania major
          Length = 300

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 11/23 (47%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           ++G  +C +K+F+ DG+IG YRG
Sbjct: 39  YAGYADCTTKLFRQDGVIGFYRG 61


>UniRef50_A2DCW8 Cluster: Hydrogenosomal membrane protein 31; n=3;
           Trichomonas|Rep: Hydrogenosomal membrane protein 31 -
           Trichomonas vaginalis G3
          Length = 316

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 33/116 (28%), Positives = 45/116 (38%), Gaps = 1/116 (0%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNF-AFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXX 424
           G   FWRGN+A  IR  P  A+ F A+++  K++  G      Q                
Sbjct: 69  GIAGFWRGNWAACIRLGPQSAIKFYAYEELEKRIGKGKPLVGIQ-------RTVFGSLSG 121

Query: 425 XTSLCFVYPLDFARTRLAADVGKGDGQRNSPVSETASARSSSPTV*LVCTEVSVCP 592
             S    YPLD  RTR+    GK  G  N   +       +S    +V T + V P
Sbjct: 122 VISQVLTYPLDVIRTRITVYSGKYTGIFNCAFTMLKEEGFTSLFAGIVPTVMGVIP 177


>UniRef50_Q6FM23 Cluster: Similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w; n=3; Ascomycota|Rep: Similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 320

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR 203
           A  V+    F AGG++A ++ T   PIE VK+ +Q+Q   + +AA+QR
Sbjct: 13  AQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQ--GELMAANQR 58


>UniRef50_A7TLE7 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 555

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 13/25 (52%), Positives = 19/25 (76%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLL 161
           F+AGGIS  +S+T  AP +R+K+ L
Sbjct: 241 FIAGGISGVISRTCTAPFDRLKVFL 265


>UniRef50_A6RKD3 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 298

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 13/19 (68%), Positives = 14/19 (73%)
 Frame = +1

Query: 526 NCISKIFKSDGLIGLYRGF 582
           NCI  I K DG +GLYRGF
Sbjct: 151 NCIRTILKEDGFVGLYRGF 169


>UniRef50_P48233 Cluster: Calcium-binding mitochondrial carrier
           SAL1; n=5; Saccharomycetales|Rep: Calcium-binding
           mitochondrial carrier SAL1 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 545

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 13/25 (52%), Positives = 19/25 (76%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLL 161
           F+AGGIS  +S+T  AP +R+K+ L
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFL 255


>UniRef50_Q06497 Cluster: Peroxisomal adenine nucleotide transporter
           1; n=4; Saccharomycetales|Rep: Peroxisomal adenine
           nucleotide transporter 1 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 328

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 9/64 (14%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAAD---------QRYKGIVDAFVRIPK 242
           L G +++A++  AV P++  K ++Q Q VS   + D         +RYK +VD  + I K
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQ-VSPSSSEDSNEGKVLPNRRYKNVVDCMINIFK 66

Query: 243 EQGL 254
           E+G+
Sbjct: 67  EKGI 70


>UniRef50_A3AJ07 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 132

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 20/40 (50%), Positives = 22/40 (55%)
 Frame = -1

Query: 485 HRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASS 366
           H  RDG  RSRGG R   R +RR  RRP  QR+  R   S
Sbjct: 70  HGLRDGCGRSRGGRRQRARRMRRMVRRP--QRTRRRQMQS 107


>UniRef50_Q9VC40 Cluster: CG5805-PA; n=6; Endopterygota|Rep:
           CG5805-PA - Drosophila melanogaster (Fruit fly)
          Length = 339

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + G+ +C  KI++S+G+ GLYRGF
Sbjct: 76  YKGMVDCAMKIYRSEGVPGLYRGF 99


>UniRef50_Q5CIH5 Cluster: Splicing factor; n=2; Cryptosporidium|Rep:
           Splicing factor - Cryptosporidium hominis
          Length = 563

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 6/62 (9%)
 Frame = -1

Query: 509 YAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHH--RRPDYQRSNA----RTASSCQRRRG 348
           Y    PY+ RR+D Y R +  +RS ER+  R+   +  +Y RSN+    R +S+  RR  
Sbjct: 49  YRNEYPYKFRRKDQYFR-KDSSRSPERYRNRNQISKGIEYSRSNSISPDRISSNGSRRYP 107

Query: 347 TP 342
            P
Sbjct: 108 NP 109


>UniRef50_Q4D533 Cluster: Mitochondrial carrier protein, putative;
           n=2; Trypanosoma cruzi|Rep: Mitochondrial carrier
           protein, putative - Trypanosoma cruzi
          Length = 327

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 24/80 (30%), Positives = 28/80 (35%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  SFWRGN   V+   P       F     Q F+           Y             
Sbjct: 96  GWRSFWRGNLIQVVSLLPITIAQI-FIALPTQTFVFNAFAHHSALTYTFSFYAAHICGAL 154

Query: 428 TSLCFVYPLDFARTRLAADV 487
            +    YPLDFAR RLA D+
Sbjct: 155 AASMVSYPLDFARFRLAVDI 174


>UniRef50_Q9UTN1 Cluster: Anion transporter; n=3; Ascomycota|Rep:
           Anion transporter - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 320

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FL+GG++A  + T   P E +K   Q+Q  ++K   + + YK +  AF  I + +G+
Sbjct: 27  FLSGGLAACGAVTLTNPFEVIKTRFQLQGQLTKLDPSKRIYKSVGQAFSLIARHEGI 83


>UniRef50_O94502 Cluster: Mitochondrial carrier, calcium binding
           subfamily; n=1; Schizosaccharomyces pombe|Rep:
           Mitochondrial carrier, calcium binding subfamily -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 426

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLL 161
           DP      F++GGI+  VS+T  AP++R+K++L
Sbjct: 123 DPKNNVGYFISGGIAGIVSRTCTAPLDRLKVML 155


>UniRef50_A7TQ47 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 927

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL--F 257
           +F  G I+  +  T V PI+ +K  +Q Q    Q      YK  +D F +I   +GL   
Sbjct: 537 NFALGSIAGCIGATIVYPIDLIKTRMQAQRSVTQ------YKNYIDCFAKILSREGLKGL 590

Query: 258 HSGV 269
           +SG+
Sbjct: 591 YSGI 594


>UniRef50_O43772 Cluster: Mitochondrial carnitine/acylcarnitine
           carrier protein; n=59; Eumetazoa|Rep: Mitochondrial
           carnitine/acylcarnitine carrier protein - Homo sapiens
           (Human)
          Length = 301

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D +++ + F AG +S   +   + P ER+K LLQ+Q  S     + +Y G +D   ++ +
Sbjct: 106 DVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASS----GESKYTGTLDCAKKLYQ 161

Query: 243 EQGL 254
           E G+
Sbjct: 162 EFGI 165


>UniRef50_P42145 Cluster: Sperm protamine-P1; n=12;
           Euteleostomi|Rep: Sperm protamine-P1 - Pseudochirops
           cupreus (Coppery ringtail)
          Length = 69

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 3/51 (5%)
 Frame = -1

Query: 491 YRHRR---RDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRG 348
           YRH R   R  Y R R   RS  R  RR +RR   +R   R   +C  RRG
Sbjct: 4   YRHSRSRSRSRYRRRRRRRRSRYRGRRRRYRRSRRRRRRGRRRGNCLGRRG 54


>UniRef50_Q4SEX5 Cluster: Chromosome undetermined SCAF14610, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF14610,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 328

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 22/84 (26%), Positives = 35/84 (41%)
 Frame = +2

Query: 224 LRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXX 403
           LR   Q  G  S WRGN  NV++  P  A+ F   ++ K +  G  +  +          
Sbjct: 195 LRGMVQEGGLSSLWRGNAINVLKIAPESAIKFMAYEQIKWLIRGSREGGS---LRVQERF 251

Query: 404 XXXXXXXXTSLCFVYPLDFARTRL 475
                   T+   +YP++  +TRL
Sbjct: 252 IAGSLAGATAQTIIYPMEVLKTRL 275


>UniRef50_Q013B8 Cluster: Mitochondrial carrier protein, putative;
           n=2; Ostreococcus|Rep: Mitochondrial carrier protein,
           putative - Ostreococcus tauri
          Length = 676

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 14/25 (56%), Positives = 20/25 (80%)
 Frame = +3

Query: 93  AGGISAAVSKTAVAPIERVKLLLQV 167
           +G I+ AV+KT VAP +RVK++ QV
Sbjct: 375 SGAIAGAVAKTVVAPADRVKIIYQV 399



 Score = 33.1 bits (72), Expect = 7.1
 Identities = 14/26 (53%), Positives = 19/26 (73%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQV 167
           LAG ++  +S+   API+RVKLL QV
Sbjct: 27  LAGALAGGISRVFTAPIDRVKLLFQV 52


>UniRef50_Q9XTH0 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 341

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 1/24 (4%)
 Frame = +1

Query: 514 SGLGNCISK-IFKSDGLIGLYRGF 582
           SGLG  + K I+K+DG++G YRGF
Sbjct: 190 SGLGTSVIKAIYKTDGILGFYRGF 213


>UniRef50_A0CV34 Cluster: Chromosome undetermined scaffold_29, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_29,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 302

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 15/23 (65%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           +SGL + ISKIFK +GL GLY G
Sbjct: 150 YSGLIDAISKIFKQEGLKGLYAG 172


>UniRef50_Q6V9R7 Cluster: Solute carrier family 25 member 19; n=4;
           Catarrhini|Rep: Solute carrier family 25 member 19 -
           Homo sapiens (Human)
          Length = 263

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++ L G  +  +SKT   P++  K  LQV   +H        +RYKG++D   ++ +++G
Sbjct: 161 QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEG 220


>UniRef50_Q6BYB7 Cluster: Debaryomyces hansenii chromosome A of
           strain CBS767 of Debaryomyces hansenii; n=2;
           Saccharomycetaceae|Rep: Debaryomyces hansenii chromosome
           A of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 540

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLL 161
           FLAGG++  +S+T  AP +R+K  L
Sbjct: 197 FLAGGVAGVISRTCTAPFDRIKTFL 221


>UniRef50_Q10248 Cluster: Putative mitochondrial carrier C4G9.20c;
           n=1; Schizosaccharomyces pombe|Rep: Putative
           mitochondrial carrier C4G9.20c - Schizosaccharomyces
           pombe (Fission yeast)
          Length = 302

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVA-PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           +F KDFLA G+S  V++  V  P + VK+ LQ Q     I     Y   +D   +I K +
Sbjct: 16  SFTKDFLA-GVSGGVAQVLVGQPFDCVKVRLQSQSNVSPI-----YNNALDCVKKISKNE 69

Query: 249 GL--FHSGVV 272
           GL  F+ G V
Sbjct: 70  GLAAFYKGTV 79



 Score = 33.1 bits (72), Expect = 7.1
 Identities = 21/69 (30%), Positives = 35/69 (50%)
 Frame = +3

Query: 66  PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKE 245
           PV   + +++G IS   +   V P+E V++ LQ+Q   K +     Y G  D   +I  +
Sbjct: 109 PVTMPQYYVSGAISGLANSFLVGPVEHVRIRLQIQ-TGKNVL----YHGPWDCIKKISSQ 163

Query: 246 QGLFHSGVV 272
            GL  SG++
Sbjct: 164 YGL--SGIM 170


>UniRef50_Q9HC21 Cluster: Mitochondrial deoxynucleotide carrier;
           n=20; Tetrapoda|Rep: Mitochondrial deoxynucleotide
           carrier - Homo sapiens (Human)
          Length = 320

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++ L G  +  +SKT   P++  K  LQV   +H        +RYKG++D   ++ +++G
Sbjct: 218 QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEG 277


>UniRef50_UPI0000E4A38B Cluster: PREDICTED: similar to mitochondrial
           solute carrier family 25 member 19; n=5;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           mitochondrial solute carrier family 25 member 19 -
           Strongylocentrotus purpuratus
          Length = 417

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 3/62 (4%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQ---HVSKQIAADQRYKGIVDAFVRIPKEQ 248
           A+  L GG++   +K+ V P++ +K  LQVQ      +       Y G +     I K++
Sbjct: 319 AQSLLCGGLAGVCAKSGVYPLDVIKKRLQVQGFEEARRPFGHVTHYTGFLHCIATIAKQE 378

Query: 249 GL 254
           G+
Sbjct: 379 GM 380


>UniRef50_UPI0000E48E57 Cluster: PREDICTED: hypothetical protein;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 341

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 11/25 (44%), Positives = 19/25 (76%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F GL +C++ I + +G+ GL++GFG
Sbjct: 282 FDGLSDCLAHILEEEGVEGLFKGFG 306


>UniRef50_UPI0000D9C841 Cluster: PREDICTED: similar to solute
           carrier family 25 (mitochondrial carrier, glutamate),
           member 22; n=3; Eutheria|Rep: PREDICTED: similar to
           solute carrier family 25 (mitochondrial carrier,
           glutamate), member 22 - Macaca mulatta
          Length = 219

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           GG++  V  + V PI+  K  LQ QH          YKG++D  ++  + +G F
Sbjct: 15  GGVAGLVGVSCVFPIDLAKTRLQNQH------GKAMYKGMIDCLMKTARAEGFF 62


>UniRef50_Q567M3 Cluster: Zgc:111878; n=4; Danio rerio|Rep:
           Zgc:111878 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 313

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 3/57 (5%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++G  +  +SKT   P + +K  LQV   +    +    + Y G VD  +RI +E+G
Sbjct: 218 ISGSCAGVISKTLTYPFDLIKKRLQVGGFEEARLKFGEVRTYHGFVDCVLRIGREEG 274


>UniRef50_Q9SVB2 Cluster: Mitochondrial carrier-like protein; n=12;
           Magnoliophyta|Rep: Mitochondrial carrier-like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 330

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 17/57 (29%), Positives = 26/57 (45%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F+AGG +  V +TA+ PI+ +K  LQ      +I     Y G+      +     LF
Sbjct: 58  FIAGGTAGVVVETALYPIDTIKTRLQAARGGGKIVLKGLYSGLAGNIAGVLPASALF 114


>UniRef50_Q014S0 Cluster: Mitochondrial fatty acid anion carrier
           protein/Uncoupling protein; n=1; Ostreococcus tauri|Rep:
           Mitochondrial fatty acid anion carrier
           protein/Uncoupling protein - Ostreococcus tauri
          Length = 359

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           +  ++GG++A     A  P +  K  L  Q  SK  A   +YK  + A   IPKE+G+
Sbjct: 264 QSMISGGLAATFGPVATGPFDVAKTRLMAQ--SK--AGGVKYKSFMHALYLIPKEEGI 317


>UniRef50_A3QMB9 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 313

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 16/63 (25%), Positives = 34/63 (53%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           +P+  A+   AG  S  V++  + P++ +K+  Q+Q    +     +YKG++ +   I +
Sbjct: 11  EPLTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQEEPIRGKKSGKYKGVMQSIFLITR 70

Query: 243 EQG 251
           E+G
Sbjct: 71  EEG 73


>UniRef50_A0DHJ2 Cluster: Chromosome undetermined scaffold_50, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_50,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 289

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 19/52 (36%), Positives = 27/52 (51%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           G  S A++   V P + VK +L VQ        +Q YKGI D  V+I + +G
Sbjct: 113 GAFSGALATMTVYPFDLVKTILAVQ-------TNQEYKGITDCLVKIVQRKG 157


>UniRef50_Q75DP0 Cluster: ABL023Wp; n=1; Eremothecium gossypii|Rep:
           ABL023Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 309

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +3

Query: 66  PVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPK 242
           PV+    F A G +A V+ T   PIE VK  LQ+Q   + +A   R Y G   A   I +
Sbjct: 8   PVSKLGSFAAAGAAACVAVTFTNPIETVKTRLQLQ--GELVAGVSRLYSGPAQAVSLIYR 65

Query: 243 EQGL 254
            +GL
Sbjct: 66  TEGL 69


>UniRef50_A7F7Y2 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 563

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 8/69 (11%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHV-----SKQIAADQRYKGIVDAFVRIPKEQG- 251
           ++G    A+S   + P++ +   LQVQ       S   +  Q+Y  + D F +I  E+G 
Sbjct: 36  ISGATGTAISNLCIYPLDLIITRLQVQRTLANSSSSTTSKTQKYTSVADTFDKIYHEEGG 95

Query: 252 --LFHSGVV 272
              F+SGV+
Sbjct: 96  IAAFYSGVL 104


>UniRef50_P33303 Cluster: Succinate/fumarate mitochondrial
           transporter; n=23; Dikarya|Rep: Succinate/fumarate
           mitochondrial transporter - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 322

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +3

Query: 69  VAFAKDFLAG---GISAAVSKTAVAPIERVKLLLQVQHVS-KQIAADQRYKGIVDAFVRI 236
           V+    F+AG   GI+ AV    V P+E VK+ LQ QH++  +  A  +Y   + A   I
Sbjct: 108 VSTGNTFVAGVGAGITEAV--LVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTI 165

Query: 237 PKEQGL 254
            KE+G+
Sbjct: 166 VKEEGV 171


>UniRef50_UPI0000F2BC15 Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 346

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           L+GG+S  +S T V P++ +K  LQV        A  +Y G+V  F  +  ++G+
Sbjct: 48  LSGGMSTGLSHTMVLPLDLIKCRLQV--------APTKYPGLVSGFSLVSLQEGM 94


>UniRef50_UPI0000D55AE5 Cluster: PREDICTED: similar to solute
           carrier family 25, member 35; n=3; Tribolium
           castaneum|Rep: PREDICTED: similar to solute carrier
           family 25, member 35 - Tribolium castaneum
          Length = 309

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           + G+ +C  KI+K +G+ GLY+G G
Sbjct: 247 YKGITDCFIKIYKCEGIPGLYKGIG 271


>UniRef50_UPI0000503A2F Cluster: solute carrier family 25
           (mitochondrial oxodicarboxylate carrier), member 21;
           n=1; Rattus norvegicus|Rep: solute carrier family 25
           (mitochondrial oxodicarboxylate carrier), member 21 -
           Rattus norvegicus
          Length = 298

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
 Frame = +3

Query: 93  AGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL--FHSG 266
           AGG +  V    + P++ VK   QVQ   + +   Q YK + D+F  I + +GL  F+ G
Sbjct: 18  AGGCAGLVEICLMHPLDVVKTRFQVQ---RSVTDPQSYKSLRDSFQVIFRTEGLFGFYKG 74

Query: 267 VV 272
           ++
Sbjct: 75  II 76


>UniRef50_A5D6U9 Cluster: Zgc:162973 protein; n=1; Danio rerio|Rep:
           Zgc:162973 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 488

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = -1

Query: 584 PKPLYRPIRPSDLKILLMQFPRPENYA-GHLPYRHRRRDGYVRSRGGTRSTERWLRRHHR 408
           P   + P  P + + LL ++  P + A GH PYR ++R  Y+R   G+  +  +  R  +
Sbjct: 313 PPAAHAPYPPEEDQPLLRRYQVPLHEARGHEPYRQQQRGSYLRDSTGSLPSSPY--RLAQ 370

Query: 407 RPDYQRSNARTASSCQRRRGT 345
             +Y+ +    +S  Q +R +
Sbjct: 371 EDEYESTQEYLSSMEQPKRSS 391


>UniRef50_Q2IMJ3 Cluster: LigA; n=4; cellular organisms|Rep: LigA -
           Anaeromyxobacter dehalogenans (strain 2CP-C)
          Length = 808

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 20/48 (41%), Positives = 24/48 (50%)
 Frame = -1

Query: 482 RRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPA 339
           RRR    R+RGG R+  R  R   R P   R  A  A+  +RR G PA
Sbjct: 534 RRRARPARARGGDRAPGRRGRAGARPPARGRGEAARAARARRRGGRPA 581


>UniRef50_Q6H077 Cluster: Putative uncharacterized protein; n=2;
           Nostocales|Rep: Putative uncharacterized protein -
           Fremyella diplosiphon (Calothrix PCC 7601)
          Length = 292

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +2

Query: 194 RPALQGYRRRLRPHPQGAGSLSFWRGNFANVI 289
           +P    Y +   PHP   GSLS WRGN+ N +
Sbjct: 15  KPMYNNYNQSSFPHP---GSLSIWRGNYFNYV 43


>UniRef50_A7BT37 Cluster: Type IV pilin biogenesis protein; n=1;
           Beggiatoa sp. PS|Rep: Type IV pilin biogenesis protein -
           Beggiatoa sp. PS
          Length = 1489

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = -3

Query: 582 ETSVQTNQTVGLEDLADAVSETGELRWPS 496
           E  V+TN+T G+ DLADA+ ETGE   PS
Sbjct: 620 EIKVRTNETCGI-DLADALFETGETIRPS 647


>UniRef50_A6CD68 Cluster: Putative uncharacterized protein; n=1;
           Planctomyces maris DSM 8797|Rep: Putative
           uncharacterized protein - Planctomyces maris DSM 8797
          Length = 876

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 11/20 (55%), Positives = 16/20 (80%)
 Frame = +3

Query: 618 SYFGFYDTARGMLPDPKNTP 677
           S+  FY++ RG++PDPK TP
Sbjct: 179 SFHNFYESNRGLVPDPKRTP 198


>UniRef50_Q6YSJ6 Cluster: Putative uncharacterized protein
           B1100H02.13; n=3; Oryza sativa|Rep: Putative
           uncharacterized protein B1100H02.13 - Oryza sativa
           subsp. japonica (Rice)
          Length = 159

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 30/80 (37%), Positives = 34/80 (42%), Gaps = 6/80 (7%)
 Frame = -1

Query: 461 RSRGGTRSTERWLRRHHRRPDYQRSNARTA-SSCQRRRGTPACTC--P*RRS*APG---S 300
           R RG  R     LRR H  P   R+  R      QRRRGTP   C  P RR  AP     
Sbjct: 68  RWRGDPRQRRVALRRQHDGPRRWRAALRRQRGGHQRRRGTPRRRCGGPQRRRGAPRRRCG 127

Query: 299 GST**RWRSYHARMKETLLL 240
           G+    WRS  A +   + L
Sbjct: 128 GAPTAMWRSQVAALSVCIAL 147


>UniRef50_Q0JPF8 Cluster: Os01g0225000 protein; n=7;
           Magnoliophyta|Rep: Os01g0225000 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 322

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 20/61 (32%), Positives = 30/61 (49%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           + A   ++GG++   S     P++ VK  LQ Q          RY+GI D F R  +E+G
Sbjct: 222 SLATMLVSGGLAGVASWVCCYPLDVVKSRLQAQ------GYPPRYRGIADCFRRSVREEG 275

Query: 252 L 254
           L
Sbjct: 276 L 276


>UniRef50_Q01CQ2 Cluster: Mitochondrial fatty acid anion carrier
           protein/Uncoupling protein; n=3; Ostreococcus|Rep:
           Mitochondrial fatty acid anion carrier
           protein/Uncoupling protein - Ostreococcus tauri
          Length = 787

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 20/59 (33%), Positives = 27/59 (45%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           FAKD  AG            P + VK+LLQ Q     +     Y G VDA  ++ K++G
Sbjct: 501 FAKDVFAGTCGGITVTLLGHPFDTVKVLLQTQSSKNPV-----YSGAVDAASKVIKQEG 554


>UniRef50_A5AK25 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 711

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 14/43 (32%), Positives = 20/43 (46%)
 Frame = -3

Query: 567 TNQTVGLEDLADAVSETGELRWPSPLPTSAARRVRAKSRGYTK 439
           T  TV  E     + +  + RWP P+ T  A+R  +K   Y K
Sbjct: 165 TPLTVSYEKFLPMIQDLSDFRWPGPIRTDPAKRDHSKKCAYHK 207


>UniRef50_Q54S10 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 390

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           +AG  S  V    + P++ +K  LQ Q    + +   RY GIV+AF    + +G+
Sbjct: 63  IAGSGSKLVESLVMFPLDTIKTRLQFQGDFSRGSIKNRYSGIVNAFKTTIRSEGI 117


>UniRef50_Q21084 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 296

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           ++G+ +C+ K  K +G  GLYRGF
Sbjct: 146 YAGMMDCLKKTVKQEGFFGLYRGF 169


>UniRef50_O77304 Cluster: LA-MSC; n=3; Oxytrichidae|Rep: LA-MSC -
           Oxytricha fallax
          Length = 307

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F +  ++G  +  V+   ++PIE VK  LQVQ   K   A   Y+G +    RI +E+G
Sbjct: 107 FKQSLISGMFAGFVNSFVLSPIELVKCRLQVQREDK---AHAYYRGPLHCVKRIIQEEG 162


>UniRef50_A0DZ51 Cluster: Chromosome undetermined scaffold_7, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_7,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 290

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 18/75 (24%), Positives = 33/75 (44%)
 Frame = +2

Query: 284 VIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFA 463
           ++R+   Q  NF+  +   +  L  +D   Q  +YF             +L   Y L+F+
Sbjct: 78  MVRFSLIQGFNFSIYNALNRQCLSKIDVNKQLIKYFGYSLLNGGIAGTVTLPIFYTLNFS 137

Query: 464 RTRLAADVGKGDGQR 508
           R RLA ++ K   ++
Sbjct: 138 RVRLANNLIKAQKEK 152


>UniRef50_A0BLZ2 Cluster: Chromosome undetermined scaffold_115,
           whole genome shotgun sequence; n=3;
           Oligohymenophorea|Rep: Chromosome undetermined
           scaffold_115, whole genome shotgun sequence - Paramecium
           tetraurelia
          Length = 301

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 18/64 (28%), Positives = 32/64 (50%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           DP   +K   AG  +  +  +  +P + +K+  QV          +RYK + DA+++I K
Sbjct: 110 DP-PLSKKIYAGLATGGIGISIASPFDVIKVRFQVD--GNLPVEQRRYKNLTDAYIKIYK 166

Query: 243 EQGL 254
           + GL
Sbjct: 167 QDGL 170


>UniRef50_A3LVX1 Cluster: Mitochondrial thiamine pyrophosphate
           transporter; n=5; Saccharomycetales|Rep: Mitochondrial
           thiamine pyrophosphate transporter - Pichia stipitis
           (Yeast)
          Length = 305

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 13/30 (43%), Positives = 21/30 (70%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           +  LAG IS AV++   AP++ +K+ LQ+Q
Sbjct: 20  ESLLAGSISGAVARAVTAPLDTIKIRLQLQ 49


>UniRef50_O43808 Cluster: Peroxisomal membrane protein PMP34; n=27;
           Coelomata|Rep: Peroxisomal membrane protein PMP34 - Homo
           sapiens (Human)
          Length = 307

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAP--IERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           KD + G ++  V+     P  +   +L LQ      +      YKGI+DAF +I +++G+
Sbjct: 103 KDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGI 162


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 636,868,932
Number of Sequences: 1657284
Number of extensions: 11764128
Number of successful extensions: 44964
Number of sequences better than 10.0: 210
Number of HSP's better than 10.0 without gapping: 41883
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44832
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58264468239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -