SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20004
         (768 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9VUN3 Cluster: GTP-binding nuclear protein Ran-like; n...   144   2e-33
UniRef50_Q554Y4 Cluster: GTP-binding nuclear protein Ran; n=5; E...   127   3e-28
UniRef50_P38543 Cluster: GTP-binding nuclear protein Ran; n=2; G...   120   3e-26
UniRef50_Q6E6E6 Cluster: GTP-binding nuclear protein-like protei...   116   6e-25
UniRef50_UPI00005A251C Cluster: PREDICTED: similar to RAN, membe...   107   4e-22
UniRef50_A1C5M7 Cluster: RAN small monomeric GTPase (Ran), putat...   100   3e-20
UniRef50_Q8SS11 Cluster: GTP-BINDING NUCLEAR PROTEIN; n=1; Encep...    94   3e-18
UniRef50_Q4WDZ1 Cluster: RAN small monomeric GTPase (Ran), putat...    93   9e-18
UniRef50_UPI0000EBD6B3 Cluster: PREDICTED: similar to Chain A, C...    83   6e-15
UniRef50_UPI0000DC0923 Cluster: UPI0000DC0923 related cluster; n...    82   2e-14
UniRef50_UPI0000D63BDB Cluster: UPI0000D63BDB related cluster; n...    79   9e-14
UniRef50_Q5EHZ5 Cluster: GekBS156P; n=1; Gekko japonicus|Rep: Ge...    75   1e-12
UniRef50_Q676W1 Cluster: GTP-binding nuclear protein RAN; n=1; H...    75   3e-12
UniRef50_Q5NT00 Cluster: Small GTPase EhRabX16; n=1; Entamoeba h...    73   6e-12
UniRef50_UPI0000584AC6 Cluster: PREDICTED: similar to small GTP-...    73   1e-11
UniRef50_Q3SDJ2 Cluster: Rab_A31 protein; n=3; Oligohymenophorea...    68   3e-10
UniRef50_A6R1W3 Cluster: GTP-binding nuclear protein GSP1/Ran; n...    67   5e-10
UniRef50_Q6AW62 Cluster: EhRab7G protein; n=1; Entamoeba histoly...    65   2e-09
UniRef50_A2EKA1 Cluster: Small GTP-binding protein, putative; n=...    65   2e-09
UniRef50_P51151 Cluster: Ras-related protein Rab-9; n=43; Eukary...    65   2e-09
UniRef50_A2DC35 Cluster: Ras family protein; n=1; Trichomonas va...    65   2e-09
UniRef50_Q4G298 Cluster: Small Rab GTPase RabX10; n=2; Trichomon...    64   3e-09
UniRef50_A2DTS3 Cluster: Ras family protein; n=1; Trichomonas va...    64   4e-09
UniRef50_A7RR98 Cluster: Predicted protein; n=1; Nematostella ve...    64   5e-09
UniRef50_Q4PAV9 Cluster: Putative uncharacterized protein; n=1; ...    64   5e-09
UniRef50_P51159 Cluster: Ras-related protein Rab-27A; n=74; Eume...    63   6e-09
UniRef50_O18339 Cluster: CG7062-PA; n=5; Endopterygota|Rep: CG70...    63   8e-09
UniRef50_Q9VP48 Cluster: Ras-related protein Rab-26; n=3; Coelom...    63   8e-09
UniRef50_A0E5M1 Cluster: Chromosome undetermined scaffold_8, who...    62   1e-08
UniRef50_UPI0000E464CF Cluster: PREDICTED: similar to LOC494641 ...    62   1e-08
UniRef50_A2EXZ8 Cluster: Small GTP-binding protein, putative; n=...    62   1e-08
UniRef50_A2EWL6 Cluster: Small GTP-binding protein, putative; n=...    62   1e-08
UniRef50_Q550H6 Cluster: Rab GTPase; n=2; Dictyostelium discoide...    62   2e-08
UniRef50_Q9VNG6 Cluster: CG2108-PA; n=10; Coelomata|Rep: CG2108-...    61   3e-08
UniRef50_Q6AW65 Cluster: EhRab7D protein; n=1; Entamoeba histoly...    61   3e-08
UniRef50_A2G211 Cluster: Ras family protein; n=1; Trichomonas va...    61   3e-08
UniRef50_A2E2M2 Cluster: Small GTP-binding protein, putative; n=...    61   3e-08
UniRef50_Q15286 Cluster: Ras-related protein Rab-35; n=30; Bilat...    61   3e-08
UniRef50_Q8WR06 Cluster: Small GTP binding protein rab6; n=4; Pi...    60   6e-08
UniRef50_Q5NT41 Cluster: Small GTPase EhRabC3; n=2; Entamoeba hi...    60   6e-08
UniRef50_Q5NT40 Cluster: Small GTPase EhRabC4; n=1; Entamoeba hi...    60   6e-08
UniRef50_Q55BW0 Cluster: Ras GTPase; n=1; Dictyostelium discoide...    60   6e-08
UniRef50_Q54ZJ8 Cluster: Rab GTPase; n=2; Dictyostelium discoide...    60   6e-08
UniRef50_A2EX25 Cluster: Small GTP-binding protein, putative; n=...    60   8e-08
UniRef50_A2E735 Cluster: Ras family protein; n=4; Trichomonas va...    60   8e-08
UniRef50_Q5BJK1 Cluster: Si:dkey-13a21.4; n=4; Euteleostomi|Rep:...    59   1e-07
UniRef50_Q231N6 Cluster: Ras family protein; n=2; Intramacronucl...    59   1e-07
UniRef50_Q8IZ41 Cluster: RAS and EF-hand domain-containing prote...    59   1e-07
UniRef50_Q7YT71 Cluster: Rif protein; n=1; Ciona intestinalis|Re...    59   1e-07
UniRef50_Q7RRJ8 Cluster: Rab6; n=1; Plasmodium yoelii yoelii|Rep...    59   1e-07
UniRef50_A2FR00 Cluster: Small GTP-binding protein, putative; n=...    59   1e-07
UniRef50_Q7YZQ9 Cluster: Rab1a; n=5; Apicomplexa|Rep: Rab1a - Ba...    58   2e-07
UniRef50_A2FJT8 Cluster: Small GTP-binding protein, putative; n=...    58   2e-07
UniRef50_UPI0000D560ED Cluster: PREDICTED: similar to CG8024-PB,...    58   2e-07
UniRef50_Q3SCZ1 Cluster: Rab_A18 protein; n=7; Paramecium tetrau...    58   2e-07
UniRef50_O76225 Cluster: Small G-protein; n=3; Trypanosoma bruce...    58   2e-07
UniRef50_Q40520 Cluster: Ras-related protein Rab11C; n=7; Magnol...    58   2e-07
UniRef50_Q15771 Cluster: Ras-related protein Rab-30; n=11; Tetra...    58   2e-07
UniRef50_Q6IME7 Cluster: Rbj-like protein; n=1; Phytophthora soj...    58   3e-07
UniRef50_Q9XXA4 Cluster: Putative uncharacterized protein; n=2; ...    58   3e-07
UniRef50_Q4QHC3 Cluster: Small GTP-binding protein Rab11, putati...    58   3e-07
UniRef50_P19073 Cluster: Cell division control protein 42 precur...    58   3e-07
UniRef50_Q9W5X0 Cluster: CG9575-PA; n=6; Coelomata|Rep: CG9575-P...    57   4e-07
UniRef50_A6NDS3 Cluster: Uncharacterized protein ENSP00000331047...    57   4e-07
UniRef50_Q86E82 Cluster: Clone ZZD836 mRNA sequence; n=1; Schist...    57   6e-07
UniRef50_Q3SDV8 Cluster: Rab_A34 protein; n=3; Paramecium tetrau...    57   6e-07
UniRef50_A2EBA3 Cluster: Small GTP-binding protein, putative; n=...    57   6e-07
UniRef50_Q9ULC3 Cluster: Ras-related protein Rab-23; n=23; Coelo...    57   6e-07
UniRef50_Q3SD82 Cluster: Rab_C72 protein; n=4; Paramecium|Rep: R...    56   7e-07
UniRef50_Q3SD45 Cluster: Rab_B58 protein; n=3; Paramecium tetrau...    56   7e-07
UniRef50_Q8SVZ2 Cluster: Similarity to RAS-RELATED CELL DIVISION...    56   7e-07
UniRef50_Q54U62 Cluster: Small GTPase; n=1; Dictyostelium discoi...    56   1e-06
UniRef50_A2ESY6 Cluster: Small GTP-binding protein, putative; n=...    56   1e-06
UniRef50_A2EI68 Cluster: Ras family protein; n=1; Trichomonas va...    56   1e-06
UniRef50_A2E160 Cluster: Small GTP-binding protein, putative; n=...    56   1e-06
UniRef50_A2DRV6 Cluster: Small GTP-binding protein, putative; n=...    56   1e-06
UniRef50_O14966 Cluster: Ras-related protein Rab-7L1; n=22; Eume...    56   1e-06
UniRef50_Q08D03 Cluster: RAB9B, member RAS oncogene family; n=1;...    56   1e-06
UniRef50_A2F1C1 Cluster: Small GTP-binding protein, putative; n=...    56   1e-06
UniRef50_A0DCB6 Cluster: Chromosome undetermined scaffold_45, wh...    56   1e-06
UniRef50_UPI00015B46B9 Cluster: PREDICTED: similar to GA21542-PA...    55   2e-06
UniRef50_UPI0000F3228D Cluster: UPI0000F3228D related cluster; n...    55   2e-06
UniRef50_Q3SDM6 Cluster: Rab_C73 protein; n=7; Oligohymenophorea...    55   2e-06
UniRef50_A2FF55 Cluster: Small GTP-binding protein, putative; n=...    55   2e-06
UniRef50_A2D8H5 Cluster: Small GTP-binding protein, putative; n=...    55   2e-06
UniRef50_Q22908 Cluster: RAS and EF-hand domain-containing prote...    55   2e-06
UniRef50_P62820 Cluster: Ras-related protein Rab-1A; n=163; Euka...    55   2e-06
UniRef50_Q5NSZ4 Cluster: Small GTPase EhRabX22; n=2; Entamoeba h...    55   2e-06
UniRef50_Q54HZ7 Cluster: Rho GTPase; n=1; Dictyostelium discoide...    55   2e-06
UniRef50_A2GIP9 Cluster: Ras family protein; n=1; Trichomonas va...    55   2e-06
UniRef50_A2GBJ0 Cluster: Ras family protein; n=1; Trichomonas va...    55   2e-06
UniRef50_A2E5K7 Cluster: Ras family protein; n=5; Trichomonas va...    55   2e-06
UniRef50_A2E5E2 Cluster: Ras family protein; n=1; Trichomonas va...    55   2e-06
UniRef50_UPI00006CAB29 Cluster: Ras family protein; n=1; Tetrahy...    54   3e-06
UniRef50_UPI00003C0A3C Cluster: PREDICTED: similar to ras homolo...    54   3e-06
UniRef50_Q963D1 Cluster: Small GTP-binding protein Rab8; n=2; En...    54   3e-06
UniRef50_Q3SDN8 Cluster: Rab_C09 protein; n=3; Paramecium tetrau...    54   3e-06
UniRef50_A2EXX5 Cluster: Small GTP-binding protein, putative; n=...    54   3e-06
UniRef50_A0N0H4 Cluster: Rbj-like protein; n=1; Blastocladiella ...    54   3e-06
UniRef50_A5WW21 Cluster: RAS and EF-hand domain-containing prote...    54   3e-06
UniRef50_Q9ULW5 Cluster: Ras-related protein Rab-26; n=13; Eutel...    54   3e-06
UniRef50_Q9NP72 Cluster: Ras-related protein Rab-18; n=53; Eukar...    54   3e-06
UniRef50_P51153 Cluster: Ras-related protein Rab-13; n=89; Eukar...    54   3e-06
UniRef50_P60953 Cluster: Cell division control protein 42 homolo...    54   3e-06
UniRef50_UPI0000660B08 Cluster: Homolog of Homo sapiens "Ras-rel...    54   4e-06
UniRef50_Q9BLF1 Cluster: Small GTPase RabD1; n=3; Entamoeba hist...    54   4e-06
UniRef50_Q5BVW6 Cluster: SJCHGC06044 protein; n=1; Schistosoma j...    54   4e-06
UniRef50_A2G1N8 Cluster: Small GTP-binding protein, putative; n=...    54   4e-06
UniRef50_A2F446 Cluster: Small GTP-binding protein, putative; n=...    54   4e-06
UniRef50_A2E7L0 Cluster: GTP-binding protein YPTM1, putative; n=...    54   4e-06
UniRef50_A2DYG4 Cluster: Ras family protein; n=3; Trichomonas va...    54   4e-06
UniRef50_A2DFV6 Cluster: Ras family protein; n=3; Trichomonas va...    54   4e-06
UniRef50_P15153 Cluster: Ras-related C3 botulinum toxin substrat...    54   4e-06
UniRef50_P34143 Cluster: Ras-related protein RabC; n=3; Dictyost...    54   4e-06
UniRef50_UPI00015ADE7B Cluster: hypothetical protein NEMVEDRAFT_...    54   5e-06
UniRef50_UPI000069EE97 Cluster: UPI000069EE97 related cluster; n...    54   5e-06
UniRef50_Q8IR98 Cluster: CG32670-PA; n=22; melanogaster subgroup...    54   5e-06
UniRef50_Q552K3 Cluster: Rab GTPase; n=1; Dictyostelium discoide...    54   5e-06
UniRef50_Q4FZ19 Cluster: Small GTP binding protein rab6-like pro...    54   5e-06
UniRef50_Q22YA7 Cluster: Small GTP-binding protein domain contai...    54   5e-06
UniRef50_A7AMF5 Cluster: Rab7; n=2; Babesia bovis|Rep: Rab7 - Ba...    54   5e-06
UniRef50_Q4RWQ6 Cluster: Chromosome 15 SCAF14981, whole genome s...    53   7e-06
UniRef50_Q9XWR6 Cluster: Putative uncharacterized protein rab-28...    53   7e-06
UniRef50_Q9VM50 Cluster: CG9100-PA, isoform A; n=56; Eukaryota|R...    53   7e-06
UniRef50_Q5NT04 Cluster: Small GTPase EhRabX12; n=1; Entamoeba h...    53   7e-06
UniRef50_Q5NSY4 Cluster: Small GTPase EhRabX32; n=1; Entamoeba h...    53   7e-06
UniRef50_Q3SDR8 Cluster: Rab_C88 protein; n=5; Paramecium tetrau...    53   7e-06
UniRef50_A2FJF4 Cluster: Guanine nucleotide regulatory protein, ...    53   7e-06
UniRef50_A2EEB3 Cluster: Small GTP-binding protein, putative; n=...    53   7e-06
UniRef50_A2DT20 Cluster: Small GTP-binding protein, putative; n=...    53   7e-06
UniRef50_P40392 Cluster: Ras-related protein RIC1; n=36; Eukaryo...    53   7e-06
UniRef50_Q6Z808 Cluster: Rac-like GTP-binding protein 3; n=7; Eu...    53   7e-06
UniRef50_UPI0000E4688C Cluster: PREDICTED: similar to RAB13, mem...    53   9e-06
UniRef50_UPI0000D57496 Cluster: PREDICTED: similar to Ras-like G...    53   9e-06
UniRef50_A2U1B9 Cluster: Small GTP-binding protein domain protei...    53   9e-06
UniRef50_Q9N2P5 Cluster: LmRab7 GTP-binding protein; n=6; Trypan...    53   9e-06
UniRef50_Q4DJA9 Cluster: Small GTP-binding protein RAB6, putativ...    53   9e-06
UniRef50_Q247S3 Cluster: Ras family protein; n=1; Tetrahymena th...    53   9e-06
UniRef50_O15971 Cluster: CG17060-PA; n=3; Coelomata|Rep: CG17060...    53   9e-06
UniRef50_A7S7Y6 Cluster: Predicted protein; n=1; Nematostella ve...    53   9e-06
UniRef50_P34150 Cluster: RAS-related protein racD; n=2; Dictyost...    53   9e-06
UniRef50_P34141 Cluster: Ras-related protein RabA; n=6; Dictyost...    53   9e-06
UniRef50_A3U5M9 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q4Q0D5 Cluster: Small G-protein, putative; n=6; Trypano...    52   1e-05
UniRef50_Q24CD0 Cluster: Ras family protein; n=2; Tetrahymena th...    52   1e-05
UniRef50_Q22BR3 Cluster: Ras family protein; n=1; Tetrahymena th...    52   1e-05
UniRef50_A2EL65 Cluster: Small GTP-binding protein, putative; n=...    52   1e-05
UniRef50_A2DXX7 Cluster: Small GTP-binding protein, putative; n=...    52   1e-05
UniRef50_Q96WY0 Cluster: GTP-binding protein rhoC precursor; n=1...    52   1e-05
UniRef50_P59190 Cluster: Ras-related protein Rab-15; n=40; Coelo...    52   1e-05
UniRef50_UPI0000498A2D Cluster: Rab family GTPase; n=1; Entamoeb...    52   2e-05
UniRef50_Q5NSZ3 Cluster: Small GTPase EhRabX23; n=1; Entamoeba h...    52   2e-05
UniRef50_Q551X0 Cluster: Rab GTPase; n=2; Dictyostelium discoide...    52   2e-05
UniRef50_Q54E92 Cluster: Rab GTPase; n=1; Dictyostelium discoide...    52   2e-05
UniRef50_Q4Q5N4 Cluster: Ras-related rab-4, putative; n=10; Tryp...    52   2e-05
UniRef50_Q3SDN1 Cluster: Rab_B60 protein; n=2; Paramecium tetrau...    52   2e-05
UniRef50_Q22BI9 Cluster: Ras family protein; n=1; Tetrahymena th...    52   2e-05
UniRef50_A2EDV7 Cluster: Small GTP-binding protein, putative; n=...    52   2e-05
UniRef50_Q96E17 Cluster: Ras-related protein Rab-3C; n=133; Meta...    52   2e-05
UniRef50_P28186 Cluster: Ras-related protein ARA-3; n=42; Eukary...    52   2e-05
UniRef50_UPI0000D55E4E Cluster: PREDICTED: similar to Ras-relate...    52   2e-05
UniRef50_Q4QDS9 Cluster: Ras-related protein rab-5, putative; n=...    52   2e-05
UniRef50_Q22045 Cluster: Putative uncharacterized protein rab-21...    52   2e-05
UniRef50_A7RGU7 Cluster: Predicted protein; n=1; Nematostella ve...    52   2e-05
UniRef50_A2G3Z0 Cluster: Small GTP-binding protein, putative; n=...    52   2e-05
UniRef50_A2E8M0 Cluster: Small GTP-binding protein, putative; n=...    52   2e-05
UniRef50_A2E6D1 Cluster: Small GTP-binding protein, putative; n=...    52   2e-05
UniRef50_A0EHT3 Cluster: Chromosome undetermined scaffold_98, wh...    52   2e-05
UniRef50_A0BIK0 Cluster: Chromosome undetermined scaffold_11, wh...    52   2e-05
UniRef50_Q9H4E5 Cluster: Rho-related GTP-binding protein RhoJ pr...    52   2e-05
UniRef50_Q9HBH0 Cluster: Rho-related GTP-binding protein RhoF pr...    52   2e-05
UniRef50_Q15907 Cluster: Ras-related protein Rab-11B; n=180; Euk...    52   2e-05
UniRef50_P60763 Cluster: Ras-related C3 botulinum toxin substrat...    52   2e-05
UniRef50_Q5U518 Cluster: LOC495396 protein; n=4; Tetrapoda|Rep: ...    51   3e-05
UniRef50_Q6BGB2 Cluster: Ras-related RAB, putative; n=1; Paramec...    51   3e-05
UniRef50_Q5NT02 Cluster: Small GTPase EhRabX14; n=1; Entamoeba h...    51   3e-05
UniRef50_Q5NSZ7 Cluster: Small GTPase EhRabX19; n=3; Entamoeba h...    51   3e-05
UniRef50_Q3SD64 Cluster: Rab_C34 protein; n=6; Paramecium tetrau...    51   3e-05
UniRef50_A7S7D9 Cluster: Predicted protein; n=1; Nematostella ve...    51   3e-05
UniRef50_A2E9I9 Cluster: Small GTP-binding protein, putative; n=...    51   3e-05
UniRef50_A0JBW4 Cluster: Small G Protein RAB; n=4; Oxymonadida|R...    51   3e-05
UniRef50_Q00246 Cluster: GTP-binding protein RHO4 precursor; n=4...    51   3e-05
UniRef50_Q9UNT1 Cluster: Rab-like protein 2B; n=34; Eukaryota|Re...    51   3e-05
UniRef50_O14807 Cluster: Ras-related protein M-Ras precursor; n=...    51   3e-05
UniRef50_Q38912 Cluster: Rac-like GTP-binding protein ARAC3 prec...    51   3e-05
UniRef50_P48554 Cluster: Ras-related protein Rac2 precursor; n=7...    51   3e-05
UniRef50_Q96AH8 Cluster: Ras-related protein Rab-7b; n=21; Tetra...    51   3e-05
UniRef50_Q9NRW1 Cluster: Ras-related protein Rab-6B; n=171; Euka...    51   3e-05
UniRef50_Q9UL25 Cluster: Ras-related protein Rab-21; n=35; Eukar...    51   3e-05
UniRef50_UPI0000F2E154 Cluster: PREDICTED: hypothetical protein;...    51   4e-05
UniRef50_Q7QWP4 Cluster: GLP_26_45744_45106; n=3; Giardia intest...    51   4e-05
UniRef50_Q5NT37 Cluster: Small GTPase EhRabC7; n=3; Entamoeba hi...    51   4e-05
UniRef50_Q22ZG1 Cluster: Ras family protein; n=1; Tetrahymena th...    51   4e-05
UniRef50_A2EVM8 Cluster: Ras family protein; n=1; Trichomonas va...    51   4e-05
UniRef50_A2EMB9 Cluster: Small GTP-binding protein, putative; n=...    51   4e-05
UniRef50_A2EKW5 Cluster: Small GTP-binding protein, putative; n=...    51   4e-05
UniRef50_P25766 Cluster: Ras-related protein RGP1; n=23; Magnoli...    51   4e-05
UniRef50_Q4UB16 Cluster: Ras-related protein Rab-1; n=19; Eukary...    51   4e-05
UniRef50_UPI00005848D3 Cluster: PREDICTED: similar to GTPase Rab...    50   5e-05
UniRef50_Q4DUK2 Cluster: Guanin nucleotide-binding protein, puta...    50   5e-05
UniRef50_A7SHS5 Cluster: Predicted protein; n=1; Nematostella ve...    50   5e-05
UniRef50_A2FBG0 Cluster: Small GTP-binding protein, putative; n=...    50   5e-05
UniRef50_A2DLU9 Cluster: Small GTP-binding protein, putative; n=...    50   5e-05
UniRef50_Q8SS52 Cluster: RAS-RELATED GTP-BINDING PROTEIN RAB11; ...    50   5e-05
UniRef50_P17610 Cluster: GTP-binding protein ypt3; n=100; Eukary...    50   5e-05
UniRef50_P33153 Cluster: GTP-binding RHO-like protein precursor;...    50   5e-05
UniRef50_P28188 Cluster: Ras-related protein ARA-5; n=106; Eukar...    50   5e-05
UniRef50_Q7YWU5 Cluster: Putative uncharacterized protein glo-1;...    50   6e-05
UniRef50_Q583N0 Cluster: Small GTP-binding protein Rab28, putati...    50   6e-05
UniRef50_Q4Q595 Cluster: Rab11B GTPase, putative; n=4; Trypanoso...    50   6e-05
UniRef50_A2G1T1 Cluster: Small GTP-binding protein, putative; n=...    50   6e-05
UniRef50_A2DZJ4 Cluster: Small GTP-binding protein, putative; n=...    50   6e-05
UniRef50_A2DSZ8 Cluster: Small GTP-binding protein, putative; n=...    50   6e-05
UniRef50_Q9BW83 Cluster: Putative GTP-binding protein RAY-like; ...    50   6e-05
UniRef50_UPI00006CB8C7 Cluster: Ras family protein; n=1; Tetrahy...    50   8e-05
UniRef50_Q4SZ30 Cluster: Chromosome undetermined SCAF11859, whol...    50   8e-05
UniRef50_Q6AW59 Cluster: EhRabC2 protein; n=2; Entamoeba histoly...    50   8e-05
UniRef50_Q3SDT9 Cluster: Rab_C89 protein; n=1; Paramecium tetrau...    50   8e-05
UniRef50_Q3SDP9 Cluster: Rab_C29 protein; n=2; Oligohymenophorea...    50   8e-05
UniRef50_A2E8Q4 Cluster: Small GTP-binding protein, putative; n=...    50   8e-05
UniRef50_A0BG93 Cluster: Chromosome undetermined scaffold_105, w...    50   8e-05
UniRef50_O00212 Cluster: Rho-related GTP-binding protein RhoD pr...    50   8e-05
UniRef50_Q9GPS0 Cluster: RAS-related protein racG precursor; n=2...    50   8e-05
UniRef50_Q8MXS1 Cluster: Ras-related protein Rab-18; n=8; Fungi/...    50   8e-05
UniRef50_UPI000069F5CB Cluster: RAB44, member RAS oncogene famil...    49   1e-04
UniRef50_Q7T015 Cluster: Novel Ras family member; n=2; Danio rer...    49   1e-04
UniRef50_Q9BLE7 Cluster: Small GTPase RabF1; n=2; Entamoeba hist...    49   1e-04
UniRef50_Q4F7H0 Cluster: Rab protein; n=1; Euplotes octocarinatu...    49   1e-04
UniRef50_Q3SDR7 Cluster: Rab_C69 protein; n=6; Paramecium tetrau...    49   1e-04
UniRef50_Q38CS2 Cluster: Small GTPase, putative; n=2; Trypanosom...    49   1e-04
UniRef50_Q23C10 Cluster: Ras family protein; n=3; Oligohymenopho...    49   1e-04
UniRef50_A7SI96 Cluster: Predicted protein; n=1; Nematostella ve...    49   1e-04
UniRef50_A2DIT5 Cluster: Small GTP-binding protein, putative; n=...    49   1e-04
UniRef50_A2DAL1 Cluster: Ras family protein; n=2; Trichomonas va...    49   1e-04
UniRef50_A6NNR4 Cluster: Uncharacterized protein RAP1A; n=7; Eut...    49   1e-04
UniRef50_Q8SW02 Cluster: Similarity to RAS-LIKE GTP-BINDING PROT...    49   1e-04
UniRef50_Q5K854 Cluster: Rho GTPase, putative; n=6; Fungi/Metazo...    49   1e-04
UniRef50_Q96AX2 Cluster: Ras-related protein Rab-37; n=42; Eumet...    49   1e-04
UniRef50_UPI0000E22FA3 Cluster: PREDICTED: similar to novel Ras ...    46   1e-04
UniRef50_Q9VC31 Cluster: CG31118-PA; n=8; Eumetazoa|Rep: CG31118...    49   1e-04
UniRef50_Q868I4 Cluster: Tem-1-like protein; n=3; Giardia intest...    49   1e-04
UniRef50_Q5NT34 Cluster: Small GTPase EhRabF4; n=1; Entamoeba hi...    49   1e-04
UniRef50_Q5NSZ6 Cluster: Small GTPase EhRabX20; n=1; Entamoeba h...    49   1e-04
UniRef50_Q54GY8 Cluster: Rab GTPase; n=1; Dictyostelium discoide...    49   1e-04
UniRef50_Q3SD55 Cluster: Rab_C21 protein; n=6; Paramecium tetrau...    49   1e-04
UniRef50_Q3SD16 Cluster: Rab_B01 protein; n=4; Paramecium tetrau...    49   1e-04
UniRef50_Q23R92 Cluster: Ras family protein; n=2; Tetrahymena th...    49   1e-04
UniRef50_O76901 Cluster: CG14791-PB, isoform B; n=2; Drosophila ...    49   1e-04
UniRef50_A2FAP9 Cluster: Ras family protein; n=1; Trichomonas va...    49   1e-04
UniRef50_A2DZN5 Cluster: Small GTP-binding protein, putative; n=...    49   1e-04
UniRef50_A0DMK2 Cluster: Chromosome undetermined scaffold_56, wh...    49   1e-04
UniRef50_P61018 Cluster: Ras-related protein Rab-4B; n=44; Eukar...    49   1e-04
UniRef50_Q13637 Cluster: Ras-related protein Rab-32; n=32; cellu...    49   1e-04
UniRef50_UPI000065FB15 Cluster: Rho-related GTP-binding protein ...    48   2e-04
UniRef50_Q26GC5 Cluster: GTP-binding protein, Ras family; n=1; F...    48   2e-04
UniRef50_Q5NT07 Cluster: Small GTPase EhRabX9; n=1; Entamoeba hi...    48   2e-04
UniRef50_Q54Y59 Cluster: Small GTPase; n=1; Dictyostelium discoi...    48   2e-04
UniRef50_Q4G2B7 Cluster: Small Rab GTPase RabC2; n=4; Trichomona...    48   2e-04
UniRef50_Q3SCZ5 Cluster: Rac_A26 protein; n=8; Oligohymenophorea...    48   2e-04
UniRef50_Q22AS0 Cluster: Ras family protein; n=1; Tetrahymena th...    48   2e-04
UniRef50_O02046 Cluster: Rab family protein 37; n=4; Caenorhabdi...    48   2e-04
UniRef50_A2GDJ2 Cluster: Small GTP-binding protein, putative; n=...    48   2e-04
UniRef50_A2G7B3 Cluster: Small GTP-binding protein, putative; n=...    48   2e-04
UniRef50_A2EII0 Cluster: Small GTP-binding protein, putative; n=...    48   2e-04
UniRef50_A2EDH4 Cluster: Small GTP-binding protein, putative; n=...    48   2e-04
UniRef50_A2DBC9 Cluster: Ras family protein; n=2; Trichomonas va...    48   2e-04
UniRef50_A0DZ33 Cluster: Chromosome undetermined scaffold_7, who...    48   2e-04
UniRef50_P07560 Cluster: Ras-related protein SEC4; n=29; Eukaryo...    48   2e-04
UniRef50_A4D1S5 Cluster: Ras-related protein Rab-19; n=41; Metaz...    48   2e-04
UniRef50_UPI00005A1898 Cluster: PREDICTED: similar to Rho-relate...    48   3e-04
UniRef50_Q6DI36 Cluster: Zgc:86635; n=9; Deuterostomia|Rep: Zgc:...    48   3e-04
UniRef50_Q3SDQ7 Cluster: Rab_C53 protein; n=1; Paramecium tetrau...    48   3e-04
UniRef50_Q3SDN6 Cluster: Rab_C05 protein; n=3; Paramecium tetrau...    48   3e-04
UniRef50_Q3SD05 Cluster: Rab_A48 protein; n=2; Paramecium tetrau...    48   3e-04
UniRef50_Q24CZ5 Cluster: Ras family protein; n=1; Tetrahymena th...    48   3e-04
UniRef50_Q23W08 Cluster: Ras family protein; n=1; Tetrahymena th...    48   3e-04
UniRef50_A2G974 Cluster: Small GTP-binding protein, putative; n=...    48   3e-04
UniRef50_A2FV67 Cluster: Small GTP-binding protein, putative; n=...    48   3e-04
UniRef50_Q5KKU3 Cluster: RAS1, putative; n=2; Filobasidiella neo...    48   3e-04
UniRef50_Q9CZE3 Cluster: Ras-related protein Rab-32; n=56; Eukar...    48   3e-04
UniRef50_P19892 Cluster: Ras-related protein ARA-1; n=17; Magnol...    48   3e-04
UniRef50_UPI00015B49B2 Cluster: PREDICTED: similar to GH21984p; ...    48   3e-04
UniRef50_UPI00006CF311 Cluster: Ras family protein; n=1; Tetrahy...    48   3e-04
UniRef50_Q4RHN8 Cluster: Chromosome 19 SCAF15045, whole genome s...    48   3e-04
UniRef50_Q8CB87 Cluster: Adult male bone cDNA, RIKEN full-length...    48   3e-04
UniRef50_A7QPP4 Cluster: Chromosome chr10 scaffold_138, whole ge...    48   3e-04
UniRef50_Q9TS94 Cluster: Epidermal growth factor inhibitor; n=2;...    48   3e-04
UniRef50_Q5NT10 Cluster: Small GTPase EhRabX6; n=2; Entamoeba hi...    48   3e-04
UniRef50_Q5NSY1 Cluster: Small GTPase EhRabX35; n=1; Entamoeba h...    48   3e-04
UniRef50_Q5F2Q2 Cluster: Rab11B protein; n=12; Apicomplexa|Rep: ...    48   3e-04
UniRef50_Q5DGE6 Cluster: SJCHGC06157 protein; n=2; Schistosoma j...    48   3e-04
UniRef50_Q54N82 Cluster: Rho GTPase; n=1; Dictyostelium discoide...    48   3e-04
UniRef50_Q4Q7C3 Cluster: Small GTP-binding protein Rab28, putati...    48   3e-04
UniRef50_A2FSA5 Cluster: Small GTP-binding protein, putative; n=...    48   3e-04
UniRef50_A2EX11 Cluster: Small GTP-binding protein, putative; n=...    48   3e-04
UniRef50_A2E619 Cluster: Small GTP-binding protein, putative; n=...    48   3e-04
UniRef50_A2DXY3 Cluster: Ras family protein; n=1; Trichomonas va...    48   3e-04
UniRef50_Q9GP33 Cluster: Probable Ras-related protein Rab-4A; n=...    48   3e-04
UniRef50_UPI0000E496A9 Cluster: PREDICTED: hypothetical protein ...    47   4e-04
UniRef50_A6ELT5 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_Q5NSZ2 Cluster: Small GTPase EhRabX24; n=1; Entamoeba h...    47   4e-04
UniRef50_Q5NSY5 Cluster: Small GTPase EhRabX31; n=1; Entamoeba h...    47   4e-04
UniRef50_Q55E31 Cluster: Rab GTPase; n=1; Dictyostelium discoide...    47   4e-04
UniRef50_Q54Z85 Cluster: Rho GTPase; n=2; Dictyostelium discoide...    47   4e-04
UniRef50_Q4CZR0 Cluster: Small GTP-binding protein Rab1, putativ...    47   4e-04
UniRef50_Q3SDL1 Cluster: Rab_B12 protein; n=2; Paramecium tetrau...    47   4e-04
UniRef50_Q3SDI0 Cluster: Rab_B66 protein; n=2; Paramecium tetrau...    47   4e-04
UniRef50_Q3SD56 Cluster: Rab_C22 protein; n=1; Paramecium tetrau...    47   4e-04
UniRef50_Q24D93 Cluster: Ras family protein; n=1; Tetrahymena th...    47   4e-04
UniRef50_O76774 Cluster: GTP binding protein RARE7L; n=5; Dictyo...    47   4e-04
UniRef50_A2HCS5 Cluster: Small GTP-binding protein, putative; n=...    47   4e-04
UniRef50_A2FVK0 Cluster: Small GTP-binding protein, putative; n=...    47   4e-04
UniRef50_P38146 Cluster: GTP-binding protein YPT10; n=2; Sacchar...    47   4e-04
UniRef50_P57735 Cluster: Ras-related protein Rab-25; n=14; Eukar...    47   4e-04
UniRef50_Q96HU8 Cluster: GTP-binding protein Di-Ras2; n=43; Bila...    47   4e-04
UniRef50_UPI00006CF1FB Cluster: Ras family protein; n=2; Tetrahy...    47   6e-04
UniRef50_Q9U466 Cluster: Rab1 protein; n=10; Plasmodium|Rep: Rab...    47   6e-04
UniRef50_Q5NSZ1 Cluster: Small GTPase EhRabX25; n=1; Entamoeba h...    47   6e-04
UniRef50_A2F926 Cluster: Small GTP-binding protein, putative; n=...    47   6e-04
UniRef50_A2EW65 Cluster: Small GTP-binding protein, putative; n=...    47   6e-04
UniRef50_A2EVE6 Cluster: Small GTP-binding protein, putative; n=...    47   6e-04
UniRef50_A2DZ39 Cluster: Small GTP-binding protein, putative; n=...    47   6e-04
UniRef50_A2DUG0 Cluster: GTP-binding protein YPTM1, putative; n=...    47   6e-04
UniRef50_A2DRC7 Cluster: Ras family protein; n=2; Trichomonas va...    47   6e-04
UniRef50_A2DAY7 Cluster: Ras family protein; n=1; Trichomonas va...    47   6e-04
UniRef50_A1XKR5 Cluster: Rab1-like; n=1; Suberites domuncula|Rep...    47   6e-04
UniRef50_A0ED86 Cluster: Chromosome undetermined scaffold_9, who...    47   6e-04
UniRef50_Q8SQQ1 Cluster: GTP-BINDING PROTEIN; n=1; Encephalitozo...    47   6e-04
UniRef50_UPI0000E4A02F Cluster: PREDICTED: similar to Rab5 like ...    46   8e-04
UniRef50_UPI00005888CB Cluster: PREDICTED: similar to ras homolo...    46   8e-04
UniRef50_Q6DUF8 Cluster: Rab GTPase; n=17; Euplotes octocarinatu...    46   8e-04
UniRef50_Q6AW61 Cluster: EhRab7H protein; n=1; Entamoeba histoly...    46   8e-04
UniRef50_Q5NT29 Cluster: Small GTPase EhRab2A; n=1; Entamoeba hi...    46   8e-04
UniRef50_Q5C3M5 Cluster: SJCHGC02927 protein; n=2; Schistosoma j...    46   8e-04
UniRef50_Q54RY4 Cluster: Rab GTPase; n=1; Dictyostelium discoide...    46   8e-04
UniRef50_Q3SDM9 Cluster: Rab_B54 protein; n=2; Paramecium tetrau...    46   8e-04
UniRef50_Q175V5 Cluster: Rab; n=2; Culicidae|Rep: Rab - Aedes ae...    46   8e-04
UniRef50_A2EEL9 Cluster: Ras family protein; n=1; Trichomonas va...    46   8e-04
UniRef50_A2DJN0 Cluster: Small GTP-binding protein, putative; n=...    46   8e-04
UniRef50_A0DH45 Cluster: Chromosome undetermined scaffold_50, wh...    46   8e-04
UniRef50_A0CZZ9 Cluster: Chromosome undetermined scaffold_32, wh...    46   8e-04
UniRef50_UPI00015B638A Cluster: PREDICTED: similar to ras-relate...    46   0.001
UniRef50_UPI000150A159 Cluster: Ras family protein; n=1; Tetrahy...    46   0.001
UniRef50_Q7R025 Cluster: GLP_456_58971_58135; n=2; Giardia intes...    46   0.001
UniRef50_Q7QX61 Cluster: GLP_192_7961_8611; n=3; Giardia intesti...    46   0.001
UniRef50_Q5NSZ9 Cluster: Small GTPase EhRabX17; n=1; Entamoeba h...    46   0.001
UniRef50_Q55ET3 Cluster: Rab GTPase; n=1; Dictyostelium discoide...    46   0.001
UniRef50_Q553M1 Cluster: Rab GTPase; n=2; Dictyostelium discoide...    46   0.001
UniRef50_Q3SDQ2 Cluster: Rab_A68 protein; n=1; Paramecium tetrau...    46   0.001
UniRef50_Q233Y6 Cluster: Ras family protein; n=1; Tetrahymena th...    46   0.001
UniRef50_Q16ZY0 Cluster: Ras-related protein, putative; n=1; Aed...    46   0.001
UniRef50_A7SI95 Cluster: Predicted protein; n=1; Nematostella ve...    46   0.001
UniRef50_A2DY65 Cluster: Small GTP-binding protein, putative; n=...    46   0.001
UniRef50_A1XKT2 Cluster: Rab39; n=1; Suberites domuncula|Rep: Ra...    46   0.001
UniRef50_Q6CER4 Cluster: Similar to tr|Q96WY0 Emericella nidulan...    46   0.001
UniRef50_Q0CE10 Cluster: Predicted protein; n=1; Aspergillus ter...    46   0.001
UniRef50_Q8WUD1 Cluster: Ras-related protein Rab-2B; n=56; Eukar...    46   0.001
UniRef50_P59190-2 Cluster: Isoform 2 of P59190 ; n=2; Homo sapie...    46   0.001
UniRef50_Q9NDI3 Cluster: RabB; n=3; Entamoeba|Rep: RabB - Entamo...    46   0.001
UniRef50_Q86EN0 Cluster: Clone ZZD161 mRNA sequence; n=2; Schist...    46   0.001
UniRef50_Q769I8 Cluster: Ras-related protein 4; n=1; Entamoeba h...    46   0.001
UniRef50_Q5NSY2 Cluster: Small GTPase EhRabX34; n=1; Entamoeba h...    46   0.001
UniRef50_Q5DBC2 Cluster: SJCHGC02879 protein; n=1; Schistosoma j...    46   0.001
UniRef50_Q4G2B4 Cluster: Small Rab GTPase RabD1; n=12; Trichomon...    46   0.001
UniRef50_Q3SD65 Cluster: Rab_C37 protein; n=2; Paramecium tetrau...    46   0.001
UniRef50_A1XKS7 Cluster: Rab21-like; n=2; Metazoa|Rep: Rab21-lik...    46   0.001
UniRef50_Q4S6M6 Cluster: Chromosome undetermined SCAF14725, whol...    45   0.002
UniRef50_Q5NSY3 Cluster: Small GTPase EhRabX33; n=2; Entamoeba h...    45   0.002
UniRef50_Q5DAL3 Cluster: SJCHGC06676 protein; n=2; Platyhelminth...    45   0.002
UniRef50_Q552H0 Cluster: ADP-ribosylation factor-related; n=2; D...    45   0.002
UniRef50_Q29R39 Cluster: RE46661p; n=4; Bilateria|Rep: RE46661p ...    45   0.002
UniRef50_Q24805 Cluster: Rap homologue 2; n=6; Eukaryota|Rep: Ra...    45   0.002
UniRef50_Q22R58 Cluster: Ras family protein; n=1; Tetrahymena th...    45   0.002
UniRef50_Q22NH8 Cluster: Ras family protein; n=3; Tetrahymena th...    45   0.002
UniRef50_Q22M81 Cluster: Ras family protein; n=1; Tetrahymena th...    45   0.002
UniRef50_A7SI94 Cluster: Predicted protein; n=1; Nematostella ve...    45   0.002
UniRef50_A2EU59 Cluster: Small GTP-binding protein, putative; n=...    45   0.002
UniRef50_A2DV63 Cluster: Small GTP-binding protein, putative; n=...    45   0.002
UniRef50_A2D9R4 Cluster: Small GTP-binding protein, putative; n=...    45   0.002
UniRef50_A0E1H9 Cluster: Chromosome undetermined scaffold_73, wh...    45   0.002
UniRef50_Q8SQL3 Cluster: RAS-RELATED PROTEIN GTP-BINDING PROTEIN...    45   0.002
UniRef50_P38987 Cluster: Protein TEM1; n=3; Saccharomycetales|Re...    45   0.002
UniRef50_Q24192 Cluster: Ras-like GTP-binding protein RhoL precu...    45   0.002
UniRef50_Q14088 Cluster: Ras-related protein Rab-33A; n=47; Coel...    45   0.002
UniRef50_UPI0000F216A0 Cluster: PREDICTED: hypothetical protein;...    45   0.002
UniRef50_UPI0000EBE319 Cluster: PREDICTED: hypothetical protein;...    45   0.002
UniRef50_UPI0000E482C3 Cluster: PREDICTED: similar to small GTPa...    45   0.002
UniRef50_UPI0000D55687 Cluster: PREDICTED: similar to CG9366-PA;...    45   0.002
UniRef50_UPI0000498A76 Cluster: Rho family GTPase; n=2; Entamoeb...    45   0.002
UniRef50_Q4SPI1 Cluster: Chromosome 16 SCAF14537, whole genome s...    45   0.002
UniRef50_Q5NT17 Cluster: Small GTPase EhRabM1; n=3; Entamoeba hi...    45   0.002
UniRef50_Q1ZXC0 Cluster: Rab GTPase domain-containing protein; n...    45   0.002
UniRef50_O44026 Cluster: GTP binding protein; n=2; Trypanosoma|R...    45   0.002
UniRef50_A4VE74 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A2F8E0 Cluster: Small GTP-binding protein, putative; n=...    45   0.002
UniRef50_A2F3B3 Cluster: Small GTP-binding protein, putative; n=...    45   0.002
UniRef50_A2ESY7 Cluster: Small GTP-binding protein, putative; n=...    45   0.002
UniRef50_A2E0L1 Cluster: Small GTP-binding protein, putative; n=...    45   0.002
UniRef50_A2DFV5 Cluster: Small GTP-binding protein, putative; n=...    45   0.002
UniRef50_A1XKT4 Cluster: Rab-like1; n=1; Suberites domuncula|Rep...    45   0.002
UniRef50_P62745 Cluster: Rho-related GTP-binding protein RhoB pr...    45   0.002
UniRef50_Q9D0P8 Cluster: Putative GTP-binding protein RAY-like; ...    45   0.002
UniRef50_UPI0000D56701 Cluster: PREDICTED: similar to CG3870-PA;...    44   0.003
UniRef50_UPI00006CBCD6 Cluster: Ras family protein; n=1; Tetrahy...    44   0.003
UniRef50_Q9BLE5 Cluster: Small GTPase RabH; n=2; Entamoeba histo...    44   0.003
UniRef50_Q5NT05 Cluster: Small GTPase EhRabX11; n=1; Entamoeba h...    44   0.003
UniRef50_Q4QHT9 Cluster: Ras family protein-like protein; n=3; L...    44   0.003
UniRef50_Q3SDS8 Cluster: Rab_B79 protein; n=2; Paramecium tetrau...    44   0.003
UniRef50_Q3SD28 Cluster: Rab_B25 protein; n=2; Paramecium tetrau...    44   0.003
UniRef50_Q3SCY9 Cluster: Rab_A15 protein; n=3; Paramecium tetrau...    44   0.003
UniRef50_O02139 Cluster: Sperm-specific family, class r protein ...    44   0.003
UniRef50_A7T133 Cluster: Predicted protein; n=2; Nematostella ve...    44   0.003
UniRef50_A2FNU5 Cluster: Small GTP-binding protein, putative; n=...    44   0.003
UniRef50_A2FFY5 Cluster: Small GTP-binding protein, putative; n=...    44   0.003
UniRef50_A2EVR7 Cluster: Small GTP-binding protein, putative; n=...    44   0.003
UniRef50_A2ELD9 Cluster: Ras family protein; n=1; Trichomonas va...    44   0.003
UniRef50_A2EF66 Cluster: Ras family protein; n=6; Eukaryota|Rep:...    44   0.003
UniRef50_A2DWM5 Cluster: Small GTP-binding protein, putative; n=...    44   0.003
UniRef50_A2DCC5 Cluster: Small GTP-binding protein, putative; n=...    44   0.003
UniRef50_A0CU45 Cluster: Chromosome undetermined scaffold_28, wh...    44   0.003
UniRef50_Q75D41 Cluster: ABR182Wp; n=2; Ascomycota|Rep: ABR182Wp...    44   0.003
UniRef50_Q22038 Cluster: RAS-like GTP-binding protein rhoA precu...    44   0.003
UniRef50_Q20365 Cluster: Ras-related protein Rab-33; n=6; Eumeta...    44   0.003
UniRef50_P28187 Cluster: Ras-related protein ARA-4; n=35; Magnol...    44   0.003
UniRef50_UPI00006CC2EE Cluster: Ras family protein; n=1; Tetrahy...    44   0.004
UniRef50_UPI00005A26A8 Cluster: PREDICTED: similar to RAS and EF...    44   0.004
UniRef50_Q5NT32 Cluster: Small GTPase EhRabF2; n=1; Entamoeba hi...    44   0.004
UniRef50_Q5NT26 Cluster: Small GTPase EhRabX2; n=1; Entamoeba hi...    44   0.004
UniRef50_Q4N6G6 Cluster: GTP-binding protein rab11, putative; n=...    44   0.004
UniRef50_Q24CZ6 Cluster: Ras family protein; n=1; Tetrahymena th...    44   0.004
UniRef50_Q22SM7 Cluster: Ras-related protein Rab-4A, putative; n...    44   0.004
UniRef50_O43991 Cluster: GTPase rab11b; n=2; Dictyostelium disco...    44   0.004
UniRef50_O18337 Cluster: Rab-related protein 4; n=3; Sophophora|...    44   0.004
UniRef50_A7SIS3 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.004
UniRef50_A2GGN6 Cluster: Multidrug resistance protein, putative;...    44   0.004
UniRef50_A2G3A8 Cluster: Small GTP-binding protein, putative; n=...    44   0.004
UniRef50_A2FXD4 Cluster: Ras family protein; n=1; Trichomonas va...    44   0.004
UniRef50_A2FSZ4 Cluster: Small GTP-binding protein, putative; n=...    44   0.004
UniRef50_A2FJ75 Cluster: Small GTP-binding protein, putative; n=...    44   0.004
UniRef50_A2DWP5 Cluster: Small GTP-binding protein, putative; n=...    44   0.004
UniRef50_A2DC18 Cluster: Small GTP-binding protein, putative; n=...    44   0.004
UniRef50_A0D7M2 Cluster: Chromosome undetermined scaffold_40, wh...    44   0.004
UniRef50_Q75E12 Cluster: ABL139Cp; n=2; Saccharomycetaceae|Rep: ...    44   0.004
UniRef50_Q6FT32 Cluster: Similar to sp|P53879 Saccharomyces cere...    44   0.004
UniRef50_Q00245 Cluster: GTP-binding protein RHO3 precursor; n=1...    44   0.004
UniRef50_P61019 Cluster: Ras-related protein Rab-2A; n=32; Bilat...    44   0.004
UniRef50_Q8WQ53 Cluster: Ras-related protein Rab-21; n=9; Metazo...    44   0.004
UniRef50_P61106 Cluster: Ras-related protein Rab-14; n=109; Euka...    44   0.004
UniRef50_UPI0001555EA1 Cluster: PREDICTED: similar to Chain A, S...    44   0.006
UniRef50_UPI00006CFAE9 Cluster: Ras family protein; n=1; Tetrahy...    44   0.006
UniRef50_UPI000023CCF0 Cluster: hypothetical protein FG07573.1; ...    44   0.006
UniRef50_A2TRH3 Cluster: Putative uncharacterized protein; n=2; ...    44   0.006
UniRef50_Q9W0N7 Cluster: CG12015-PA; n=8; Endopterygota|Rep: CG1...    44   0.006
UniRef50_Q9VIW6 Cluster: CG9994-PA; n=6; Endopterygota|Rep: CG99...    44   0.006
UniRef50_Q8MZS7 Cluster: Small GTP-binding protein; n=1; Babesia...    44   0.006
UniRef50_Q70J56 Cluster: Ral protein; n=2; Echinococcus multiloc...    44   0.006
UniRef50_Q5NT01 Cluster: Small GTPase EhRabX15; n=1; Entamoeba h...    44   0.006
UniRef50_Q3SDQ3 Cluster: Rab_C42 protein; n=2; Paramecium tetrau...    44   0.006
UniRef50_Q3SD06 Cluster: Rab_A51 protein; n=2; Paramecium tetrau...    44   0.006
UniRef50_Q1ZXE7 Cluster: Rab GTPase; n=1; Dictyostelium discoide...    44   0.006
UniRef50_A2G189 Cluster: Small GTP-binding protein, putative; n=...    44   0.006
UniRef50_A2ES63 Cluster: Small GTP-binding protein, putative; n=...    44   0.006
UniRef50_A2EPG0 Cluster: Ras family protein; n=3; Trichomonas va...    44   0.006
UniRef50_A1XKT6 Cluster: Rab-like3; n=1; Suberites domuncula|Rep...    44   0.006
UniRef50_A5DVM9 Cluster: GTP-binding protein RHO1; n=1; Lodderom...    44   0.006
UniRef50_P61225 Cluster: Ras-related protein Rap-2b precursor; n...    44   0.006
UniRef50_P49104 Cluster: Ras-related protein Rab-2-B; n=21; Euka...    44   0.006
UniRef50_UPI00015B5A8C Cluster: PREDICTED: similar to ras homolo...    43   0.007
UniRef50_Q5NT33 Cluster: Small GTPase EhRabF3; n=1; Entamoeba hi...    43   0.007
UniRef50_Q5NSZ0 Cluster: Small GTPase EhRabX26; n=1; Entamoeba h...    43   0.007
UniRef50_Q55CB9 Cluster: Ras GTPase; n=6; Dictyostelium discoide...    43   0.007
UniRef50_Q3SDT6 Cluster: Rab_C84 protein; n=1; Paramecium tetrau...    43   0.007
UniRef50_Q3SDM4 Cluster: Rab_B46 protein; n=2; Paramecium tetrau...    43   0.007
UniRef50_A2G0V9 Cluster: Small GTP-binding protein, putative; n=...    43   0.007
UniRef50_A2ELV0 Cluster: Small GTP-binding protein, putative; n=...    43   0.007
UniRef50_A2EDH5 Cluster: Small GTP-binding protein, putative; n=...    43   0.007
UniRef50_A2E0C0 Cluster: Ras family protein; n=1; Trichomonas va...    43   0.007
UniRef50_A1XKT9 Cluster: Rab-like6; n=1; Suberites domuncula|Rep...    43   0.007
UniRef50_Q8SRC8 Cluster: RAS-RELATED PROTEIN RAB5; n=1; Encephal...    43   0.007
UniRef50_Q6AW63 Cluster: EhRab7F protein; n=1; Entamoeba histoly...    43   0.010
UniRef50_Q5NT03 Cluster: Small GTPase EhRabX13; n=2; Entamoeba h...    43   0.010
UniRef50_Q55EG6 Cluster: Rab GTPase; n=2; Dictyostelium discoide...    43   0.010
UniRef50_Q4D6H4 Cluster: Small GTPase, putative; n=2; Trypanosom...    43   0.010
UniRef50_Q3SDR0 Cluster: Rab_C61 protein; n=5; Paramecium tetrau...    43   0.010
UniRef50_Q3SD70 Cluster: Rab_C45 protein; n=1; Paramecium tetrau...    43   0.010
UniRef50_Q231B4 Cluster: Ras family protein; n=18; Oligohymenoph...    43   0.010
UniRef50_A2G648 Cluster: Small GTP-binding protein, putative; n=...    43   0.010
UniRef50_A2F4Z4 Cluster: Small GTP-binding protein, putative; n=...    43   0.010
UniRef50_A2E5L9 Cluster: Small GTP-binding protein, putative; n=...    43   0.010
UniRef50_A0D8C9 Cluster: Chromosome undetermined scaffold_401, w...    43   0.010
UniRef50_Q5KEV2 Cluster: Rho small monomeric GTPase, putative; n...    43   0.010
UniRef50_A2QE33 Cluster: Remark: alternate name for S. cerevisia...    43   0.010
UniRef50_Q9Y272 Cluster: Dexamethasone-induced Ras-related prote...    43   0.010
UniRef50_P08645 Cluster: Ras-like protein 3 precursor; n=24; Fun...    43   0.010
UniRef50_UPI0000DB79F9 Cluster: PREDICTED: similar to RAB34, mem...    42   0.013
UniRef50_UPI0000DB76C8 Cluster: PREDICTED: similar to chrowded C...    42   0.013
UniRef50_UPI0000D55688 Cluster: PREDICTED: similar to abnormal c...    42   0.013
UniRef50_Q5NT42 Cluster: Small GTPase EhRab11D; n=2; Entamoeba h...    42   0.013
UniRef50_Q5NT13 Cluster: Small GTPase EhRabP1; n=2; Entamoeba hi...    42   0.013
UniRef50_Q4QH98 Cluster: Rab1 small GTP-binding protein, putativ...    42   0.013

>UniRef50_Q9VUN3 Cluster: GTP-binding nuclear protein Ran-like;
           n=88; Eukaryota|Rep: GTP-binding nuclear protein
           Ran-like - Drosophila melanogaster (Fruit fly)
          Length = 217

 Score =  144 bits (349), Expect = 2e-33
 Identities = 71/131 (54%), Positives = 84/131 (64%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GDGGTGKTT VKRHLTGEF+ +Y ATLGVEV  L+F+TNRG F +       + 
Sbjct: 11  FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQE 70

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRK 472
               L      +     +MFDV S  TY NV  WHRDLVRVC  IPIV+CGNKVDI  +K
Sbjct: 71  RYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKK 130

Query: 473 VKAKTIVFHRK 505
              K + F RK
Sbjct: 131 TWKKGVDFDRK 141



 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 50/135 (37%), Positives = 75/135 (55%)
 Frame = +1

Query: 259 RFNVWDTAGQEKFGGLRDGYYIQGQCAISHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCL 438
           R +VWDTAGQE++GGLRDGY++Q QCAI       S+                   P  +
Sbjct: 60  RIDVWDTAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVI 119

Query: 439 VRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAM 618
              +     +K+  +   F ++ ++   ++SAKSNYN EKPF++L RKL+GD +L+ V  
Sbjct: 120 CGNKVDIMHKKTWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQS 179

Query: 619 PALLPPEVTMGSSMA 663
           PA+ PP+V     M+
Sbjct: 180 PAIQPPKVVFTDEMS 194


>UniRef50_Q554Y4 Cluster: GTP-binding nuclear protein Ran; n=5;
           Eukaryota|Rep: GTP-binding nuclear protein Ran -
           Dictyostelium discoideum AX4
          Length = 754

 Score =  127 bits (306), Expect = 3e-28
 Identities = 65/133 (48%), Positives = 89/133 (66%), Gaps = 2/133 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDKR 292
           K +LVGD G GKTTF+KRH+ GEF+K ++ T+GVE+  L+ +TN G     +  T  D++
Sbjct: 54  KLILVGDSGVGKTTFLKRHIIGEFQKSHIPTVGVELSNLILYTNIGNVNFDIWDTCGDEK 113

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
             V      +     + +MFDV+SRV+Y+NVP+W  +L + +   IPI+L GNKVDIKDR
Sbjct: 114 FEVFRHLYYVGSQCAI-IMFDVSSRVSYRNVPSWFNELTKELGNNIPIILVGNKVDIKDR 172

Query: 470 KVKAKTIVFHRKK 508
           KVKAK I FHR K
Sbjct: 173 KVKAKEINFHRSK 185



 Score =  108 bits (259), Expect = 2e-22
 Identities = 55/141 (39%), Positives = 79/141 (56%), Gaps = 1/141 (0%)
 Frame = +2

Query: 89  KMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM 268
           K  D+    K VL+GDGG GK+T++ R LTGEFE +YVAT G  VH   F T  G     
Sbjct: 505 KKFDNTKEIKLVLIGDGGVGKSTYINRLLTGEFETQYVATFGCSVHKFNFKTTIGDVNFS 564

Query: 269 CGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCG 445
                  R    +  D +       +MFDV SR +Y++V +W  +L+R+  + +P+VL G
Sbjct: 565 IWDMAFTRLPGAMRDDYMTGAECAIIMFDVCSRESYRSVNDWFNELLRITGKVVPMVLVG 624

Query: 446 NKVDIKDRKVKAKTIVFHRKK 508
           NKV+   +++    I+FHRKK
Sbjct: 625 NKVESMGKRINPSQIIFHRKK 645



 Score = 70.1 bits (164), Expect = 6e-11
 Identities = 48/133 (36%), Positives = 68/133 (51%), Gaps = 7/133 (5%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAI------SHVR-RNLSSYVQKCT*LA*RFGPC 414
           + F++WDT G EKF   R  YY+  QCAI      S V  RN+ S+  + T      G  
Sbjct: 101 VNFDIWDTCGDEKFEVFRHLYYVGSQCAIIMFDVSSRVSYRNVPSWFNELTK---ELGN- 156

Query: 415 M*RYPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGD 594
               P  LV  +     +K   +   F + K++ Y +IS+KSNY FE PF+ L + L G+
Sbjct: 157 --NIPIILVGNKVDIKDRKVKAKEINFHRSKNIHYCEISSKSNYKFETPFIQLIKILSGN 214

Query: 595 GNLEFVAMPALLP 633
            N+ FV+   LLP
Sbjct: 215 DNVRFVSPLPLLP 227



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 4/126 (3%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAISHV----RRNLSSYVQKCT*LA*RFGPCM*R 423
           + F++WD A     G +RD Y    +CAI       R +  S       L    G  +  
Sbjct: 561 VNFSIWDMAFTRLPGAMRDDYMTGAECAIIMFDVCSRESYRSVNDWFNELLRITGKVV-- 618

Query: 424 YPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNL 603
            P  LV  +     ++       F ++K++ Y+++S ++N+N EKPFL L R L G+ N+
Sbjct: 619 -PMVLVGNKVESMGKRINPSQIIFHRKKNISYFELSVRTNFNLEKPFLKLIRLLSGNDNV 677

Query: 604 EFVAMP 621
           + +  P
Sbjct: 678 DLIPSP 683


>UniRef50_P38543 Cluster: GTP-binding nuclear protein Ran; n=2;
           Giardia intestinalis|Rep: GTP-binding nuclear protein
           Ran - Giardia lamblia (Giardia intestinalis)
          Length = 226

 Score =  120 bits (290), Expect = 3e-26
 Identities = 63/153 (41%), Positives = 90/153 (58%), Gaps = 17/153 (11%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHT------NRGQFV 262
           D  +FK +LVGDG TGKTTFV RH+TGEF K+Y++T+GVE+  L F+       N  + +
Sbjct: 3   DPISFKVILVGDGATGKTTFVTRHITGEFRKQYISTIGVEIRQLPFYVAGQSCPNGREVL 62

Query: 263 LMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-------- 418
           L       +     L        +   + FDVT+RVTYKNV +W+RD+ R+C        
Sbjct: 63  LNVHDTAGQEKFGGLRDGYYVDSDACLLFFDVTNRVTYKNVESWYRDVFRICPTRRDAST 122

Query: 419 ---EGIPIVLCGNKVDIKDRKVKAKTIVFHRKK 508
              + + IVL GNK D+KDR+++ +T+ FHR K
Sbjct: 123 GEEKPLAIVLVGNKCDVKDREIRTQTVKFHRSK 155



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 53/157 (33%), Positives = 77/157 (49%), Gaps = 11/157 (7%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYYIQGQ-CAISHVRRNLSSYVQKCT*LA*RFGPCM*R- 423
           R +  NV DTAGQEKFGGLRDGYY+    C +     N  +Y    +     F  C  R 
Sbjct: 59  REVLLNVHDTAGQEKFGGLRDGYYVDSDACLLFFDVTNRVTYKNVESWYRDVFRICPTRR 118

Query: 424 ---------YPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLA 576
                        LV  +     ++   +   F + K++ Y +ISAK N+N+E P L + 
Sbjct: 119 DASTGEEKPLAIVLVGNKCDVKDREIRTQTVKFHRSKNIPYVEISAKDNFNYELPILSIL 178

Query: 577 RKLIGDGNLEFVAMPALLPPEVTMGSSMAEPN*KDLQ 687
           R L+ D  ++F   PALLP ++ M ++  E   KDL+
Sbjct: 179 RTLLNDPTIQFSQAPALLPADIGMDAATREQINKDLE 215


>UniRef50_Q6E6E6 Cluster: GTP-binding nuclear protein-like protein;
           n=1; Antonospora locustae|Rep: GTP-binding nuclear
           protein-like protein - Antonospora locustae (Nosema
           locustae)
          Length = 213

 Score =  116 bits (279), Expect = 6e-25
 Identities = 65/137 (47%), Positives = 83/137 (60%), Gaps = 4/137 (2%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           +AD    FK VLVGDGGTGKTT++ R L G F K YVAT G  V+ + F+TN G  +   
Sbjct: 2   VADRRTKFKVVLVGDGGTGKTTYIHRILEGVFIKDYVATCGARVYQINFNTNYGFQLEFD 61

Query: 272 GTQPDKRSLVVLETDTIF-KDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG---IPIVL 439
                 + L  + +D  +   +   + FDVTS+VT+ NVPNW R +  VC G   IPIVL
Sbjct: 62  VWDTAGQELKSMLSDAYYINSDAAMIFFDVTSKVTFVNVPNWLRRIQAVCCGDKHIPIVL 121

Query: 440 CGNKVDIKDRKVKAKTI 490
           CGNKVD  +RKVK + I
Sbjct: 122 CGNKVDCSNRKVKEQFI 138



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 51/145 (35%), Positives = 67/145 (46%), Gaps = 6/145 (4%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAISHVR-RNLSSYVQKCT*LA*RFGPCM*--RY 426
           + F+VWDTAGQE    L D YYI    A+      +  ++V     L      C      
Sbjct: 58  LEFDVWDTAGQELKSMLSDAYYINSDAAMIFFDVTSKVTFVNVPNWLRRIQAVCCGDKHI 117

Query: 427 PYCLVRKQSGY*RQKS*GENYCFPQEKD--LQYYDISAKSNYNFEKPFLWLARKLIGDGN 600
           P  L   +     +K   E +     K     Y +ISAK+NYNFE PFL LARKL G  N
Sbjct: 118 PIVLCGNKVDCSNRKV-KEQFIARSLKSGITMYVEISAKTNYNFELPFLALARKLTGIDN 176

Query: 601 LEFVAMPALLPPEVTMG-SSMAEPN 672
           L FV+   L P ++ +   S+ E N
Sbjct: 177 LTFVSNLNLKPADIPIDIKSIEESN 201


>UniRef50_UPI00005A251C Cluster: PREDICTED: similar to RAN, member
           RAS oncogene family; n=1; Canis lupus familiaris|Rep:
           PREDICTED: similar to RAN, member RAS oncogene family -
           Canis familiaris
          Length = 196

 Score =  107 bits (256), Expect = 4e-22
 Identities = 54/100 (54%), Positives = 68/100 (68%)
 Frame = +2

Query: 209 LGVEVHPLVFHTNRGQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVP 388
           L VE+HPLVFHTNRG    +     D+     L   +  +    ++MFD+T+R+T +   
Sbjct: 51  LSVEIHPLVFHTNRGPIKFLVLDMADQEKFAGLRDGSDIQA-WYAIMFDITTRITSR--- 106

Query: 389 NWHRDLVRVCEGIPIVLCGNKVDIKDRKVKAKTIVFHRKK 508
             HRDLV+VCE IPI LCGNKVDIKDRKVKAK+IVFH+KK
Sbjct: 107 --HRDLVQVCEDIPIALCGNKVDIKDRKVKAKSIVFHQKK 144



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 53/136 (38%), Positives = 70/136 (51%), Gaps = 5/136 (3%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAI-----SHVRRNLSSYVQKCT*LA*RFGPCM* 420
           I+F V D A QEKF GLRDG  IQ   AI     + +       VQ C  +         
Sbjct: 67  IKFLVLDMADQEKFAGLRDGSDIQAWYAIMFDITTRITSRHRDLVQVCEDI--------- 117

Query: 421 RYPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGN 600
             P  L   +     +K   ++  F Q+K+LQYYDISAK+    +  FLWLA KL GD N
Sbjct: 118 --PIALCGNKVDIKDRKVKAKSIVFHQKKNLQYYDISAKT---LKGSFLWLAIKLTGDPN 172

Query: 601 LEFVAMPALLPPEVTM 648
           LEF+ +P L PP++ +
Sbjct: 173 LEFITVPPLAPPDIVI 188


>UniRef50_A1C5M7 Cluster: RAN small monomeric GTPase (Ran),
           putative; n=1; Aspergillus clavatus|Rep: RAN small
           monomeric GTPase (Ran), putative - Aspergillus clavatus
          Length = 472

 Score =  100 bits (240), Expect = 3e-20
 Identities = 53/144 (36%), Positives = 79/144 (54%), Gaps = 5/144 (3%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           MA  M  FK +L+G+ G GKT F++R+L   +E     T+GVE H +V  T  G      
Sbjct: 1   MAATMRIFKVLLIGNSGVGKTAFLRRYLQSRYEDTIEPTIGVEKHVIVLSTTAGDIRYEI 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG----IPIVL 439
                 + +  L+++    D  + +MFD+T+R++Y NVPNW++ +V         +PI +
Sbjct: 61  WDVSGSQKISALQSEEYNADGAI-IMFDLTNRISYNNVPNWYQTIVHKDRSGRNPMPICI 119

Query: 440 CGNKVDI-KDRKVKAKTIVFHRKK 508
           C NK D   D K+ AKTI F RKK
Sbjct: 120 CANKYDAPSDSKLPAKTITFPRKK 143



 Score = 39.9 bits (89), Expect = 0.068
 Identities = 32/128 (25%), Positives = 52/128 (40%), Gaps = 4/128 (3%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAISHVRRNLSSYVQKCT*---LA*RFGPCM*RY 426
           IR+ +WD +G +K   L+   Y      I     N  SY         +  +        
Sbjct: 56  IRYEIWDVSGSQKISALQSEEYNADGAIIMFDLTNRISYNNVPNWYQTIVHKDRSGRNPM 115

Query: 427 PYCL-VRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNL 603
           P C+   K       K   +   FP++K   Y ++S  +     +PFL LAR+L+ D  +
Sbjct: 116 PICICANKYDAPSDSKLPAKTITFPRKKGTGYAEVSVMTLQGINEPFLDLARRLLRDPTV 175

Query: 604 EFVAMPAL 627
           ++  MP L
Sbjct: 176 QYEYMPDL 183


>UniRef50_Q8SS11 Cluster: GTP-BINDING NUCLEAR PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: GTP-BINDING NUCLEAR
           PROTEIN - Encephalitozoon cuniculi
          Length = 214

 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 50/131 (38%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL--MCGTQP 283
           T+K  L+GDGG GKTT++ R L G FEK Y AT+G   HP+ F  ++G  +   +  T  
Sbjct: 7   TYKICLIGDGGVGKTTYINRVLDGRFEKNYNATVGAVNHPVTFLDDQGNVIKFNVWDTAG 66

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDI 460
            ++  V+ +   I     +   FDVTSR+T +N+  W ++   V     PIV+C NK+DI
Sbjct: 67  QEKKAVLKDVYYIGASGAI-FFFDVTSRITCQNLARWVKEFQAVVGNEAPIVVCANKIDI 125

Query: 461 KDRKVKAKTIV 493
           K+R+  +K +V
Sbjct: 126 KNRQKISKKLV 136



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 51/137 (37%), Positives = 71/137 (51%), Gaps = 8/137 (5%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAI------SHVR-RNLSSYVQKCT*LA*RFGPC 414
           I+FNVWDTAGQEK   L+D YYI    AI      S +  +NL+ +V++   +     P 
Sbjct: 57  IKFNVWDTAGQEKKAVLKDVYYIGASGAIFFFDVTSRITCQNLARWVKEFQAVVGNEAPI 116

Query: 415 M*RYPYCLVRKQSGY*RQKS*GENYC-FPQEKDLQYYDISAKSNYNFEKPFLWLARKLIG 591
           +     C   K     RQK   +      + K+ +Y++ISAK+ +NF  PFL LAR   G
Sbjct: 117 V----VC-ANKIDIKNRQKISKKLVMEVLKGKNYEYFEISAKTAHNFGLPFLHLARIFTG 171

Query: 592 DGNLEFVAMPALLPPEV 642
             +L FV+   L P EV
Sbjct: 172 RPDLIFVSNVNLEPTEV 188


>UniRef50_Q4WDZ1 Cluster: RAN small monomeric GTPase (Ran),
           putative; n=2; Trichocomaceae|Rep: RAN small monomeric
           GTPase (Ran), putative - Aspergillus fumigatus (Sartorya
           fumigata)
          Length = 480

 Score = 92.7 bits (220), Expect = 9e-18
 Identities = 54/145 (37%), Positives = 72/145 (49%), Gaps = 6/145 (4%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M  D  TF  +LVG+ G GKT F+ R+L   FE     T  VE H ++ HT  G      
Sbjct: 1   MTKDTRTFNVLLVGNSGVGKTAFLHRYLKKRFEHSPPVTANVEKHDVLLHTTVGPVRYEI 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIV 436
                K+   VL +      +   +MFD+T RV+Y NVPNW++ LV     R+   IPI 
Sbjct: 61  WDVSGKQKPTVLASREFDDIDAAIIMFDLTDRVSYNNVPNWYKSLVNKDGMRLGRYIPIC 120

Query: 437 LCGNKVDIK-DRKVKAKTIVFHRKK 508
           +CGNK D   D K+    I F + K
Sbjct: 121 ICGNKNDASMDAKLPPNAITFPKNK 145


>UniRef50_UPI0000EBD6B3 Cluster: PREDICTED: similar to Chain A,
           Canine Gdp-Ran R76e Mutant; n=2; Bos taurus|Rep:
           PREDICTED: similar to Chain A, Canine Gdp-Ran R76e
           Mutant - Bos taurus
          Length = 123

 Score = 83.4 bits (197), Expect = 6e-15
 Identities = 38/56 (67%), Positives = 45/56 (80%)
 Frame = +2

Query: 344 VMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRKVKAKTIVFHRKKI 511
           +MF+VTSRVTY+NVPN HRDL  VCE IPIVLCGNKVDIKD KVK   +   +++I
Sbjct: 20  IMFEVTSRVTYRNVPNQHRDLRPVCETIPIVLCGNKVDIKDVKVKTSQLSSTKRRI 75


>UniRef50_UPI0000DC0923 Cluster: UPI0000DC0923 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC0923 UniRef100 entry -
           Rattus norvegicus
          Length = 133

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 53/133 (39%), Positives = 65/133 (48%), Gaps = 6/133 (4%)
 Frame = +2

Query: 347 MFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRKVKAKTI---VF--HRKKI 511
           MF+ TSRVTYKN+PNWHRDLV +C+ IPIVLCGNKVDI   K K K I   +F    K+ 
Sbjct: 1   MFEGTSRVTYKNIPNWHRDLVCMCKNIPIVLCGNKVDINSVKKKRKEIEDKIFCLPLKEK 60

Query: 512 CXXXXXXXXXXXXXKNPSCG*LEN*LVTVTLSLLPCLPFCHQKLQWDPQWQNPIEKIFRC 691
                         + P             L  +  L F   ++  DP      E     
Sbjct: 61  HSEYYDILPKVTQLRKPFLWLSRKLTGDPNLEFVAMLAFASSEVVMDPPLAAQYEHDLEV 120

Query: 692 T-NTALPEEDEDL 727
           T  TALP+ED+DL
Sbjct: 121 TQRTALPDEDDDL 133



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query: 487 YCFP-QEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAMPALLPPEVTMGSSMA 663
           +C P +EK  +YYDI  K      KPFLWL+RKL GD NLEFVAM A    EV M   +A
Sbjct: 53  FCLPLKEKHSEYYDILPKVT-QLRKPFLWLSRKLTGDPNLEFVAMLAFASSEVVMDPPLA 111

Query: 664 EPN*KDLQM 690
                DL++
Sbjct: 112 AQYEHDLEV 120


>UniRef50_UPI0000D63BDB Cluster: UPI0000D63BDB related cluster; n=1;
           Mus musculus|Rep: UPI0000D63BDB UniRef100 entry - Mus
           musculus
          Length = 161

 Score = 79.4 bits (187), Expect = 9e-14
 Identities = 46/103 (44%), Positives = 57/103 (55%)
 Frame = +2

Query: 164 KRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRSLVVLETDTIFKDNVLS 343
           K+H+  E     VATL V+VH  V HTNR    L    +  +         T  K  VL 
Sbjct: 26  KQHMASEA----VATLSVDVHLFVLHTNRQSIKLNVWDKTGQEMFGDNLIATTSKPGVLL 81

Query: 344 VMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRK 472
            +   TSRVTY N+PN H DLV +CE I IVLC N+VDI+DR+
Sbjct: 82  RLRQGTSRVTYVNIPNGHEDLVHMCENILIVLCSNQVDIQDRR 124



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 25/37 (67%), Positives = 28/37 (75%)
 Frame = +1

Query: 499 QEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEF 609
           + +  QYYD   KSNY+FEKPFLWLARKLI D NL F
Sbjct: 125 ERRIFQYYDCYVKSNYSFEKPFLWLARKLIRDPNLVF 161


>UniRef50_Q5EHZ5 Cluster: GekBS156P; n=1; Gekko japonicus|Rep:
           GekBS156P - Gecko japonicus (Japanese gecko)
          Length = 81

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 33/36 (91%), Positives = 35/36 (97%)
 Frame = +1

Query: 502 EKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEF 609
           +K+LQYYDISAKSNYNFEKPFLWLARKLIGD NLEF
Sbjct: 25  KKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF 60


>UniRef50_Q676W1 Cluster: GTP-binding nuclear protein RAN; n=1;
           Hyacinthus orientalis|Rep: GTP-binding nuclear protein
           RAN - Hyacinthus orientalis (Common hyacinth)
          Length = 231

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 54/132 (40%), Positives = 63/132 (47%), Gaps = 4/132 (3%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAI---SHVRRNLSSYVQKCT*LA*RFGPCM*RY 426
           IRF  WDTAGQEKFGGLRDGYYI GQCAI       R L+   Q  T     F  C+  +
Sbjct: 69  IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARRLTRMSQPGT---VTFAGCVRTF 125

Query: 427 PYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARK-LIGDGNL 603
           P   V  +      +           +     +ISAKSNYNFE+      +K   G    
Sbjct: 126 PQSSVVTRLMRRIDRRRPSKRRSIGRRTCSIIEISAKSNYNFEQAVPVFGKKNCWGILTS 185

Query: 604 EFVAMPALLPPE 639
            FV  PAL PPE
Sbjct: 186 TFVESPALAPPE 197



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 28/64 (43%), Positives = 33/64 (51%)
 Frame = +2

Query: 176 TGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFD 355
           TGEFEKKY  T+GVEVHPL F TN G+    C     +     L            +MFD
Sbjct: 42  TGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFD 101

Query: 356 VTSR 367
           VT+R
Sbjct: 102 VTAR 105


>UniRef50_Q5NT00 Cluster: Small GTPase EhRabX16; n=1; Entamoeba
           histolytica|Rep: Small GTPase EhRabX16 - Entamoeba
           histolytica
          Length = 203

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 2/127 (1%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           +D   FK +++GD   GKT+ VKR++  EF K+   T+GV++     + N     L    
Sbjct: 5   NDSIVFKIIVIGDANVGKTSLVKRYVDREFYKELKPTIGVDIKNKTININEENICLTFFD 64

Query: 278 QPDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNK 451
              +     + TD+ FK      +++D+T  VT+ +V  W+  L   V + IP+++ GNK
Sbjct: 65  TAGQEKFAAV-TDSYFKGAKACIIVYDITKAVTFNSVDKWYNKLRNIVSDPIPVLIIGNK 123

Query: 452 VDIKDRK 472
            DI+ ++
Sbjct: 124 SDIEQQR 130


>UniRef50_UPI0000584AC6 Cluster: PREDICTED: similar to small
           GTP-binding protein; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to small GTP-binding
           protein - Strongylocentrotus purpuratus
          Length = 215

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 6/132 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK ++VGD   GKTTFV R+++G+F+  +  T+GV+        ++   V +       +
Sbjct: 12  FKVIIVGDSLVGKTTFVHRYVSGKFDPGFKTTVGVDFALKKIERSKQDIVRLQLWDIAGQ 71

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGNKV 454
             V   T   +KD +   +MFDVT R T+ NV NW  D+   V +  G  +P +L  NK+
Sbjct: 72  ERVSSLTRVYYKDASACVIMFDVTQRKTFNNVMNWKNDVEKKVALSNGSPVPCLLLANKI 131

Query: 455 DIKDRKVKAKTI 490
           D+    VK + I
Sbjct: 132 DLPSPNVKEEEI 143


>UniRef50_Q3SDJ2 Cluster: Rab_A31 protein; n=3;
           Oligohymenophorea|Rep: Rab_A31 protein - Paramecium
           tetraurelia
          Length = 218

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 36/126 (28%), Positives = 73/126 (57%), Gaps = 3/126 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK ++VGD   GK+  +  +  G+F++++ AT+GVE     F     QF +       + 
Sbjct: 8   FKFIIVGDTSVGKSCLLLNYTEGKFKEEHDATIGVEFGSQGFKHKNKQFKIQIWDTAGQE 67

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIK- 463
           S   + T + +K ++ + ++FD+T+R ++ N+  W+ +++    E + IV+ GNK+D++ 
Sbjct: 68  SFRSI-TRSYYKGSIGVLLVFDITNRQSFHNIVRWYNEILDCAHESVDIVIVGNKIDLES 126

Query: 464 DRKVKA 481
           +R+V A
Sbjct: 127 ERQVSA 132


>UniRef50_A6R1W3 Cluster: GTP-binding nuclear protein GSP1/Ran; n=1;
           Ajellomyces capsulatus NAm1|Rep: GTP-binding nuclear
           protein GSP1/Ran - Ajellomyces capsulatus NAm1
          Length = 418

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 29/36 (80%), Positives = 32/36 (88%)
 Frame = +2

Query: 125 LVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL 232
           LVGDGG GKTTFVKRHL GEF++K + TLGVEVHPL
Sbjct: 47  LVGDGGVGKTTFVKRHLCGEFDEKSIPTLGVEVHPL 82



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/55 (45%), Positives = 32/55 (58%)
 Frame = +1

Query: 502 EKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAMPALLPPEVTMGSSMAE 666
           E  LQYYDIS K ++N ++PFLWLARKL+ +  L    MP    P  T   S  +
Sbjct: 118 EAGLQYYDISVKRDFNIKEPFLWLARKLVENAGLVRQPMPPSSTPPNTAEKSCGQ 172


>UniRef50_Q6AW62 Cluster: EhRab7G protein; n=1; Entamoeba
           histolytica|Rep: EhRab7G protein - Entamoeba histolytica
          Length = 190

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 34/127 (26%), Positives = 69/127 (54%), Gaps = 3/127 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDKR 292
           K +L+G+ G GKT+ ++R++  +FE  Y  T+G + +   V+  N+   + +  T   ++
Sbjct: 3   KLILIGESGVGKTSLIQRYVMNKFEPTYKTTIGCDFLAKTVYVENKEYNLQIWDTAGHEK 62

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIKD 466
              ++ +     D  + ++FDVT+  ++  +  W  +  R   G  +PI++CGNKVD + 
Sbjct: 63  FSSMVSSFYRGSDGAI-IVFDVTNTSSFTAIDTWISEYSRALNGKDVPIIICGNKVDCQP 121

Query: 467 RKVKAKT 487
           R V  ++
Sbjct: 122 RLVSTES 128


>UniRef50_A2EKA1 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 194

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 1/132 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K ++VGD   GKT+ + R++ GEF+   +AT+G++        N  +  L       +  
Sbjct: 7   KIIVVGDSSVGKTSVIHRYVKGEFDSTIIATIGIDYRAKDIEINGQKIKLQIWDTIGQEK 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKDRK 472
              L      + + + + +D T + ++ ++ NW   ++   +  IP++L GNKVD+ +  
Sbjct: 67  YRSLAPQYFRRADGVILFYDTTVKTSFTHLQNWLDSIINNAQSSIPVILVGNKVDLPEVV 126

Query: 473 VKAKTIVFHRKK 508
            K   I F R K
Sbjct: 127 PKEHAIDFARDK 138


>UniRef50_P51151 Cluster: Ras-related protein Rab-9; n=43;
           Eukaryota|Rep: Ras-related protein Rab-9 - Homo sapiens
           (Human)
          Length = 201

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 40/137 (29%), Positives = 67/137 (48%), Gaps = 6/137 (4%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM- 268
           MA     FK +L+GDGG GK++ + R++T +F+ +   T+GVE        + G FV M 
Sbjct: 1   MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVD-GHFVTMQ 59

Query: 269 CGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-----VRVCEGIPI 433
                 +     L T      +   + F V    +++N+ NW ++      V+  E  P 
Sbjct: 60  IWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPF 119

Query: 434 VLCGNKVDIKDRKVKAK 484
           V+ GNK+DI +R+V  +
Sbjct: 120 VILGNKIDISERQVSTE 136


>UniRef50_A2DC35 Cluster: Ras family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 200

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 36/117 (30%), Positives = 55/117 (47%), Gaps = 1/117 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VLVGDG  GKT+ + R  +  F      T+     P+  + N  + VL         
Sbjct: 17  FKVVLVGDGYVGKTSIINRFYSDHFSTNEPPTIAASFLPIAMNKNGKRVVLNIWDTAGHE 76

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPI-VLCGNKVDI 460
               L        N L V+FD+T+ +T++N   W+   +     IP+ +LCGNK+D+
Sbjct: 77  KFHCLVPLYARAANTLIVVFDLTNEMTFENAKEWYTKTILDVGQIPVCILCGNKLDL 133


>UniRef50_Q4G298 Cluster: Small Rab GTPase RabX10; n=2; Trichomonas
           vaginalis|Rep: Small Rab GTPase RabX10 - Trichomonas
           vaginalis
          Length = 196

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 29/120 (24%), Positives = 59/120 (49%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK ++VG+ G GKT  + R     FE+ +++T+GV+        +  +  L       + 
Sbjct: 8   FKLLIVGESGVGKTCMLLRFADNSFEENFLSTIGVDFKVREIDVDGKRVKLQIWDSAGQE 67

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRK 472
               + T        + +++D+T   T+  V  W  D+ ++   +P++L GNK D++D++
Sbjct: 68  RFRNITTSYYRNCGGIIIVYDITRHDTFTKVTEWIEDVRKITSNVPLLLVGNKADLEDKR 127


>UniRef50_A2DTS3 Cluster: Ras family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 239

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 45/129 (34%), Positives = 57/129 (44%), Gaps = 1/129 (0%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAISHV-RRNLSSYVQKCT*LA*RFGPCM*RYPY 432
           I +N+WDT GQE+FG LRD YY+     I  +   N  SYV     +      C      
Sbjct: 56  IEYNIWDTFGQERFGLLRDAYYLDASAVILFIDLTNRDSYVHLARWIRFVKQLCPDACVV 115

Query: 433 CLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFV 612
               K     R     E   F Q+ D  Y +IS+ +NYN    F  L RKL+GD N+   
Sbjct: 116 VAATKIDAPNRILP-VEKILFHQKHDYPYIEISSSTNYNIAALFEVLTRKLMGDMNIIIS 174

Query: 613 AMPALLPPE 639
               L PPE
Sbjct: 175 KPIKLCPPE 183



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 38/132 (28%), Positives = 68/132 (51%), Gaps = 2/132 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKR-HLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           K +L+GDGG GKT F+ R ++ G   KKY   LG+  +    +T+ G           + 
Sbjct: 9   KVILLGDGGVGKTKFISRINVDGMVVKKY-RRLGITEYTFPVYTSIGMIEYNIWDTFGQE 67

Query: 293 SLVVLETDTIFKDNVLSVMF-DVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDR 469
              +L  D  + D    ++F D+T+R +Y ++  W R + ++C    +V+   K+D  +R
Sbjct: 68  RFGLLR-DAYYLDASAVILFIDLTNRDSYVHLARWIRFVKQLCPDACVVVAATKIDAPNR 126

Query: 470 KVKAKTIVFHRK 505
            +  + I+FH+K
Sbjct: 127 ILPVEKILFHQK 138


>UniRef50_A7RR98 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 191

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           +FK ++VGD G GKT+ ++R   G F     +T+GV+V   V   +  +  L C     +
Sbjct: 11  SFKVLVVGDPGVGKTSLIRRFTKGYFCDNSSSTVGVDVGTRVLDIHGDRVKLQCWDTAGQ 70

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKD 466
                +        + + ++FD+T+R T+ ++P W  ++ +   + I  VL GNK D+K 
Sbjct: 71  EKFRGITQSYYRNADAVILVFDITNRGTFASIPQWLMNVQKYTNKNILKVLVGNKTDLKG 130

Query: 467 RKVKAKT 487
              K  T
Sbjct: 131 ASRKVNT 137


>UniRef50_Q4PAV9 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 208

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 43/139 (30%), Positives = 67/139 (48%), Gaps = 7/139 (5%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL G  GTGKTTF  R  + + + K +  L    +P+   T+ G   L      +  
Sbjct: 7   FKVVLAGQFGTGKTTFATRVKSAKADSKEIKALKTTQYPVTLQTSAGSVTLRL-FDTNLH 65

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRV-----CEGIPIVLCGNKV 454
           +   L  D  F+  +   V FD+T   +Y  + +W+  +++       E +PI++ G K 
Sbjct: 66  AKGGLPDDGFFRTADAAIVFFDLTKEDSYTAMEDWYDAVIKANGRKGSEPLPILVVGTKA 125

Query: 455 -DIKDRKVKAKTIVFHRKK 508
            DIK R +K + I F RKK
Sbjct: 126 DDIKGRDIKPEAIEFPRKK 144



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 13/34 (38%), Positives = 24/34 (70%)
 Frame = +1

Query: 493 FPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGD 594
           FP++K+L Y +IS+ +NY  ++  L + + L+GD
Sbjct: 140 FPRKKELPYREISSNANYGVKELLLDVCKALLGD 173


>UniRef50_P51159 Cluster: Ras-related protein Rab-27A; n=74;
           Eumetazoa|Rep: Ras-related protein Rab-27A - Homo
           sapiens (Human)
          Length = 221

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 12/132 (9%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP--LVFH-------TNRGQFVLM 268
           K + +GD G GKT+ + ++  G+F  K++ T+G++     +V+        T RGQ + +
Sbjct: 11  KFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL 70

Query: 269 CGTQPDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLV--RVCEGIPIVL 439
                  +      T   F+D +   ++FD+T+  ++ NV NW   L     CE   IVL
Sbjct: 71  QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVL 130

Query: 440 CGNKVDIKDRKV 475
           CGNK D++D++V
Sbjct: 131 CGNKSDLEDQRV 142


>UniRef50_O18339 Cluster: CG7062-PA; n=5; Endopterygota|Rep:
           CG7062-PA - Drosophila melanogaster (Fruit fly)
          Length = 219

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 33/121 (27%), Positives = 59/121 (48%), Gaps = 1/121 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL+GD GTGKT  V R  TG + +++  T+GV+           Q  L       + 
Sbjct: 22  FKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQE 81

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               +        N + +++D+T R ++ N+  W  ++ R     + I+L GNK D++++
Sbjct: 82  RFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQ 141

Query: 470 K 472
           +
Sbjct: 142 R 142


>UniRef50_Q9VP48 Cluster: Ras-related protein Rab-26; n=3;
           Coelomata|Rep: Ras-related protein Rab-26 - Drosophila
           melanogaster (Fruit fly)
          Length = 388

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 6/133 (4%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFE-KKYVATLGVEVHPLVFHTNRGQFVL-MC 271
           DD    K +L+GD G GKT+F+ ++ TGEF    + AT+G+ +   V   +  +  L + 
Sbjct: 186 DDTVNHKTILLGDSGVGKTSFLVKYNTGEFRLGSFSATVGIALTNKVVVVDGTRVKLQIW 245

Query: 272 GTQPDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCG 445
            T   +R   V  T   ++D + L +++DVT++ TY N+  W  ++     E + IVL G
Sbjct: 246 DTAGQERFRSV--THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIG 303

Query: 446 NKVDI--KDRKVK 478
           NK D    +R+VK
Sbjct: 304 NKADCSGSERQVK 316


>UniRef50_A0E5M1 Cluster: Chromosome undetermined scaffold_8, whole
           genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_8,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 219

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 44/136 (32%), Positives = 66/136 (48%), Gaps = 5/136 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK VLVGD G GKT  + R++ G   K  V T+G+E          G+ V   +  T   
Sbjct: 13  FKVVLVGDAGVGKTHLMTRYVKGCLPKNAVPTIGIEFAGKTVTLQNGKKVKAQIWDTAGQ 72

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           +R   +  T    K     V++DVT   T+++V  W  DL    E  + I+L GNK+D+ 
Sbjct: 73  ERYRGITSTH-FRKAGGALVVYDVTKEKTFESVVKWMEDLRYQAEPDVVIMLVGNKIDLV 131

Query: 464 DRKVKAK--TIVFHRK 505
           +    A+   ++ HRK
Sbjct: 132 ENNGSARFLYLIMHRK 147


>UniRef50_UPI0000E464CF Cluster: PREDICTED: similar to LOC494641
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to LOC494641 protein -
           Strongylocentrotus purpuratus
          Length = 289

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 39/130 (30%), Positives = 67/130 (51%), Gaps = 11/130 (8%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFH-------TNRGQFVLMC 271
           K + +GD G GK++F+ ++  G F  K+++T+G++     V H       T RGQ V + 
Sbjct: 78  KFLALGDSGVGKSSFLYQYTDGTFNSKFISTVGIDFREKRVTHRPKGADPTTRGQRVHLQ 137

Query: 272 GTQPDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLV--RVCEGIPIVLC 442
                 +      T   F+D +   ++FD+T+  ++ N+ NW   L     CE   +VLC
Sbjct: 138 LWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFINIRNWMTQLQMHAYCENPDVVLC 197

Query: 443 GNKVDIKDRK 472
           GNK D+ D++
Sbjct: 198 GNKSDLDDQR 207


>UniRef50_A2EXZ8 Cluster: Small GTP-binding protein, putative; n=2;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 194

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 2/121 (1%)
 Frame = +2

Query: 107 PTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQP 283
           P FK V++GD   GKT+ V+R     F+     T+G      +  T+ GQ  L +  T  
Sbjct: 8   PEFKVVIMGDSSVGKTSIVQRFNQETFDYSMDTTIGASFLTKIVETDLGQVNLNVWDTAG 67

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDI 460
            +R   ++ T        + + +D T  VT++ VP+W  +L + C E +PI + GNK D+
Sbjct: 68  QERYRSLIPTYARGAHAAI-ICYDTTIMVTFEAVPSWIEELHKFCTEEVPIYIVGNKSDL 126

Query: 461 K 463
           K
Sbjct: 127 K 127


>UniRef50_A2EWL6 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 200

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 1/124 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           +PT+K ++VGD GTGKT+ V R +TG FE   + T+GVE        N  Q  L      
Sbjct: 4   IPTYKVLVVGDSGTGKTSLVDRIITGSFESSPLPTVGVEFKAYTTMANGSQIKLTIWDTA 63

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDI 460
            +     +            V+F + S  ++ +   W  D+   C     I+L GNK D+
Sbjct: 64  GQEKYRSVAKSYFRNGCGALVVFSINSAESFDHCEQWIEDIHNGCLPNAVILLVGNKCDL 123

Query: 461 KDRK 472
           + ++
Sbjct: 124 ESQR 127


>UniRef50_Q550H6 Cluster: Rab GTPase; n=2; Dictyostelium
           discoideum|Rep: Rab GTPase - Dictyostelium discoideum
           AX4
          Length = 224

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 4/128 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC-GTQPDK 289
           FK V++GD   GK+  + R    EF +K  AT+GV+        +       C  T   +
Sbjct: 11  FKIVIIGDSAVGKSNLLNRFTRNEFTEKTKATIGVDFGTKSIEIDNKTITAQCWDTAGQE 70

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           R   V  T   ++  V   +++D+TS++++KNV  W  +L  + E  I I++ GNK D++
Sbjct: 71  RFRAV--TSGYYRGAVGAMIVYDITSKISFKNVTRWLNELREMAEQDILIMMVGNKSDLE 128

Query: 464 -DRKVKAK 484
             R+V  K
Sbjct: 129 MSREVPTK 136



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 19/58 (32%), Positives = 28/58 (48%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           ++NL  +       EK +   G    + SI  + + I    WDTAGQE+F  +  GYY
Sbjct: 23  KSNLLNRFTRNEFTEKTKATIGVDFGTKSIEIDNKTITAQCWDTAGQERFRAVTSGYY 80


>UniRef50_Q9VNG6 Cluster: CG2108-PA; n=10; Coelomata|Rep: CG2108-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 268

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 2/133 (1%)
 Frame = +2

Query: 83  TTKMADDMP-TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF 259
           T+   DD+    K V+VG+GG GK++ ++R+  G F K Y  T+GV+        +    
Sbjct: 27  TSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDV 86

Query: 260 VLMCGTQPDKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEGIPIV 436
            +M      +     + T   ++    SV+ F  T R ++  + +W R +   C  IP V
Sbjct: 87  RIMLWDTAGQEEFDCI-TKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTV 145

Query: 437 LCGNKVDIKDRKV 475
           +  NK+D+ ++ V
Sbjct: 146 IVQNKIDLIEQAV 158


>UniRef50_Q6AW65 Cluster: EhRab7D protein; n=1; Entamoeba
           histolytica|Rep: EhRab7D protein - Entamoeba histolytica
          Length = 204

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 39/134 (29%), Positives = 66/134 (49%), Gaps = 7/134 (5%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-M 268
           MA     FK +L+GD G GKT+ + R++  +F   Y AT+G +        N  Q+ L +
Sbjct: 1   MAGRPALFKAILIGDSGVGKTSLINRYVNNQFSDVYKATIGSDFLIKPVTVNGAQYTLQI 60

Query: 269 CGTQPDKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-----GIP 430
             T   +R   V+   T ++ +   V+ FDVT+R ++ ++  W  + +          IP
Sbjct: 61  WDTAGHERYSCVV--TTFYRGSDCCVLCFDVTNRDSFNHLEKWKNEFIDGANATNPASIP 118

Query: 431 IVLCGNKVDIKDRK 472
           I + GNK+D +  K
Sbjct: 119 IYVVGNKIDCEPNK 132


>UniRef50_A2G211 Cluster: Ras family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 220

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 34/121 (28%), Positives = 57/121 (47%), Gaps = 2/121 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK V+VG+ G GKT+ ++R L G+F   ++ +L  + H   F          LM    P 
Sbjct: 10  FKVVVVGNSGVGKTSAMQRFLYGKFPDTHIKSLVSQFHEKSFDLKETAETIDLMIWDTPG 69

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKD 466
           +  L +L  D     N+  + +    + ++  +P W   + +V   I  VL  NKVD+ D
Sbjct: 70  RECLHLLAEDAYVNANIAVIFYSAVDKASFDAIPTWVDAVKKVTGPIQFVLVENKVDLTD 129

Query: 467 R 469
           +
Sbjct: 130 K 130


>UniRef50_A2E2M2 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 197

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 30/135 (22%), Positives = 67/135 (49%), Gaps = 1/135 (0%)
 Frame = +2

Query: 86  TKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL 265
           +++  + PT KC++VG  G GKT+ ++  + G+F +    T+ V+    +   +  +  +
Sbjct: 2   SEIKKETPTLKCIVVGSSGVGKTSLIEYLINGKFNENTQPTIAVDYKTTILEIDGQEVKM 61

Query: 266 MCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLC 442
                  +     L      K + + ++FD+T + +Y +   W+ ++++ C+    I+L 
Sbjct: 62  NIYDTAGQEKYKALSRSYFRKSDCVLLVFDLTEKQSYDDANAWYLEILQNCDFDSKILLV 121

Query: 443 GNKVDIKDRKVKAKT 487
           GNK D  + +V + T
Sbjct: 122 GNKADEINTRVISNT 136


>UniRef50_Q15286 Cluster: Ras-related protein Rab-35; n=30;
           Bilateria|Rep: Ras-related protein Rab-35 - Homo sapiens
           (Human)
          Length = 201

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK++ + R     F   Y+ T+GV+        N  +  L       + 
Sbjct: 9   FKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDR 469
               + T T ++  + + V++DVTS  ++ NV  W  ++ + C+ +  +L GNK D  +R
Sbjct: 69  RFRTI-TSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPER 127

Query: 470 KV 475
           KV
Sbjct: 128 KV 129


>UniRef50_Q8WR06 Cluster: Small GTP binding protein rab6; n=4;
           Piroplasmida|Rep: Small GTP binding protein rab6 -
           Babesia gibsoni
          Length = 227

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K VL+G+  TGKT+ V R +   F ++Y AT+G++    V   N     L       +  
Sbjct: 22  KIVLLGEQSTGKTSIVTRFVYDHFVQQYAATIGIDFLSKVVTVNGKTMRLQLWDTAGQER 81

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKDRK 472
              L    I   +   V++D+T+R +++ V  W +D+  +  +   IV+ GNK D+ D++
Sbjct: 82  FRTLMPSYIRDSSAAIVVYDITNRESFERVKEWVKDIKELRGDKAIIVIVGNKTDLLDKR 141


>UniRef50_Q5NT41 Cluster: Small GTPase EhRabC3; n=2; Entamoeba
           histolytica|Rep: Small GTPase EhRabC3 - Entamoeba
           histolytica
          Length = 208

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 36/121 (29%), Positives = 61/121 (50%), Gaps = 3/121 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHT-NRGQFVLMCGTQPDK 289
           FK +++G+ G GKT  ++R     FE  Y++T+GV+  P V    N+   + +  T    
Sbjct: 10  FKILIIGESGVGKTAIMQRFCENTFEPVYISTVGVDFKPKVIKVGNKTVKMQLWDTAGQD 69

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIP--IVLCGNKVDIK 463
           R   +  +       VL +++DVT R ++  V +W  ++    E  P  I+L GNK D+ 
Sbjct: 70  RFRNITASYYRGTQGVL-IVYDVTDRASFDKVSSWFTEVRDRTENDPPVIILVGNKTDLM 128

Query: 464 D 466
           D
Sbjct: 129 D 129


>UniRef50_Q5NT40 Cluster: Small GTPase EhRabC4; n=1; Entamoeba
           histolytica|Rep: Small GTPase EhRabC4 - Entamoeba
           histolytica
          Length = 203

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 28/117 (23%), Positives = 60/117 (51%), Gaps = 2/117 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK ++VGD G GKT  ++R+    F+++Y++T+GV+  P++ +       L       + 
Sbjct: 10  FKILIVGDSGVGKTAILQRYCNNTFDERYISTIGVDFKPMILNVGERTIKLQIWDTAGQE 69

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIV-LCGNKVD 457
             + +          + +++DV +R +   V +W+ ++  +  +  P++ L GNK D
Sbjct: 70  RFMNITAAYFRNTTAVIIVYDVNNRDSLSKVYSWYGEVNEKTTQQNPVIFLVGNKKD 126


>UniRef50_Q55BW0 Cluster: Ras GTPase; n=1; Dictyostelium discoideum
           AX4|Rep: Ras GTPase - Dictyostelium discoideum AX4
          Length = 278

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 39/130 (30%), Positives = 72/130 (55%), Gaps = 6/130 (4%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM--CGT 277
           M T+K V++G  GTGKT+   R + G+F + Y  T+  +++  V  TN+G+ +++    T
Sbjct: 1   MQTYKVVVLGASGTGKTSLTVRFVNGDFVETYDPTI-EDLYRKVIETNKGEHIMLEIMDT 59

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVT---YKNVPNWHRDLV-RVCEGIPIVLCG 445
              +R L + +   I       +++ +TSRV+    +N+ N+   +  R    IP+V+ G
Sbjct: 60  SGTERYLAMRDL-YIRNAQAFVLVYSITSRVSLLELENIKNYICQVKDRPISQIPMVVLG 118

Query: 446 NKVDIKDRKV 475
           NK D++D +V
Sbjct: 119 NKCDLEDTRV 128


>UniRef50_Q54ZJ8 Cluster: Rab GTPase; n=2; Dictyostelium
           discoideum|Rep: Rab GTPase - Dictyostelium discoideum
           AX4
          Length = 256

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 40/138 (28%), Positives = 74/138 (53%), Gaps = 6/138 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLMCGTQPDK 289
           K VL+G    GKT    R++ G F K+  +T+G       +    N+ ++++      D+
Sbjct: 11  KVVLLGSSDVGKTALSLRYVDGIFPKRLTSTIGASFLTRTINIEGNKIKYLIWDSAGQDR 70

Query: 290 -RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
            RSL  L     ++   ++++ FD+T + T+  V  W  +L   + E I +VLCGNK+D+
Sbjct: 71  FRSLATL----YYRGACVAILVFDITQQKTFDIVKGWVEELKANIQEEIIMVLCGNKIDL 126

Query: 461 -KDRKVKAKTIVFHRKKI 511
            ++R+VK++T   +  +I
Sbjct: 127 EQNRQVKSETAKLYADEI 144



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQC 336
           G    + +I  E   I++ +WD+AGQ++F  L   YY +G C
Sbjct: 43  GASFLTRTINIEGNKIKYLIWDSAGQDRFRSLATLYY-RGAC 83


>UniRef50_A2EX25 Cluster: Small GTP-binding protein, putative; n=4;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 190

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 1/125 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T K V+VG+   GK+  + R + G F+    AT+G      V  T+ G   L      
Sbjct: 1   MHTLKVVIVGETKVGKSCILSRFVQGSFDASMPATIGAAFLTKVITTSEGPMRLQLWDTA 60

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-RVCEGIPIVLCGNKVDI 460
            +     L        NV  +++DVTS+ + +++ +W  ++  +   GI +V+ GNK+D+
Sbjct: 61  GQEKFRSLAPMYYRSANVAVLVYDVTSKSSLESLEDWSAEIADKAPPGIKLVVIGNKIDM 120

Query: 461 KDRKV 475
           +  +V
Sbjct: 121 ESERV 125


>UniRef50_A2E735 Cluster: Ras family protein; n=4; Trichomonas
           vaginalis|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 206

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 37/132 (28%), Positives = 68/132 (51%), Gaps = 4/132 (3%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFH-TNRGQFVLM 268
           MA+    FK +++G  G GKT+ ++R    +F +   +T+G+E    V +  N+   +++
Sbjct: 1   MAESPLQFKFIVIGCSGAGKTSILRRLCEDKFNRGTQSTVGIEYFTYVTNIENKMVKMMI 60

Query: 269 CGTQPDKRSLVVLETDTIFKDNVLSV--MFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVL 439
             T   +R   +      +  N L V  ++D+T R ++  +P W RD  V       ++L
Sbjct: 61  WDTAGQERFYTIARA---YFRNALGVILVYDITDRKSFDQLPRWLRDARVEADPHCTVIL 117

Query: 440 CGNKVDIKDRKV 475
            GNK D+KD++V
Sbjct: 118 VGNKCDLKDQRV 129


>UniRef50_Q5BJK1 Cluster: Si:dkey-13a21.4; n=4; Euteleostomi|Rep:
           Si:dkey-13a21.4 - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 205

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 5/128 (3%)
 Frame = +2

Query: 107 PTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPD 286
           P  K +L+G+ G GK++F+ R +   F   Y AT+GV+        +R   +L       
Sbjct: 7   PHLKLILIGNSGVGKSSFMTRFVDHRFTNLYRATIGVDFLTKEITVDRRPVILQIWDTAG 66

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRD-LVRVC----EGIPIVLCGNK 451
                 L +      +   ++FDVTS V+++ +  W ++ LV+ C       P ++ GNK
Sbjct: 67  TERFHSLGSSLYRGAHCCLLVFDVTSSVSFEALDVWKKEFLVQACPSDPAAFPFIVLGNK 126

Query: 452 VDIKDRKV 475
           +D+  R+V
Sbjct: 127 IDLDHRQV 134


>UniRef50_Q231N6 Cluster: Ras family protein; n=2;
           Intramacronucleata|Rep: Ras family protein - Tetrahymena
           thermophila SB210
          Length = 227

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 31/122 (25%), Positives = 61/122 (50%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL+G+ G GK+  + R+    F + +  T+GV+      +    Q  L       + 
Sbjct: 32  FKLVLIGNSGVGKSCMLMRYAENTFTQNFYNTIGVDFKIKTINLQGKQIKLQIWDTAGQD 91

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKDR 469
               + T+     + + V++DVT +++++NV  W  ++ +   E +  +L GNK D+ D+
Sbjct: 92  RFKTITTNYYRGAHGIVVVYDVTDKLSFENVKTWMSEIEKYAQENVCKLLIGNKSDLSDK 151

Query: 470 KV 475
           +V
Sbjct: 152 RV 153


>UniRef50_Q8IZ41 Cluster: RAS and EF-hand domain-containing protein;
           n=30; Eumetazoa|Rep: RAS and EF-hand domain-containing
           protein - Homo sapiens (Human)
          Length = 740

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 40/129 (31%), Positives = 64/129 (49%), Gaps = 3/129 (2%)
 Frame = +2

Query: 89  KMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL- 265
           K       +K VL GD   GK++F+ R    EF +   ATLGV+        +  + VL 
Sbjct: 534 KSFSSQKAYKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQ 593

Query: 266 MCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR--VCEGIPIVL 439
           +  T   +R   + ++     D VL +++DVT   ++ N+  W  D++     E +PI+L
Sbjct: 594 LWDTAGQERFRSIAKSYFRKADGVL-LLYDVTCEKSFLNIREW-VDMIEDAAHETVPIML 651

Query: 440 CGNKVDIKD 466
            GNK DI+D
Sbjct: 652 VGNKADIRD 660


>UniRef50_Q7YT71 Cluster: Rif protein; n=1; Ciona intestinalis|Rep:
           Rif protein - Ciona intestinalis (Transparent sea
           squirt)
          Length = 249

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 1/125 (0%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           +  P  KCV+VGDGG GKT+ +  +  GEF + Y  T+  E +      NR + VL    
Sbjct: 14  EQQPKIKCVIVGDGGCGKTSMLVVYTEGEFPEVYTPTV-FENYSREVELNRKKAVLTLWD 72

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVP-NWHRDLVRVCEGIPIVLCGNKV 454
              +     L   +    +++ + +DVT+  +++NV   W  ++   C   P +L   K 
Sbjct: 73  TAGQEDYDRLRPLSYNNADIIIICYDVTNLSSFQNVEIRWSPEIRHFCPHTPTMLVACKT 132

Query: 455 DIKDR 469
           D++ +
Sbjct: 133 DLRSQ 137


>UniRef50_Q7RRJ8 Cluster: Rab6; n=1; Plasmodium yoelii yoelii|Rep:
           Rab6 - Plasmodium yoelii yoelii
          Length = 282

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 38/144 (26%), Positives = 67/144 (46%), Gaps = 3/144 (2%)
 Frame = +2

Query: 53  LYNHE*NSHKTTKMADD-MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP 229
           LYN     H     +D  +  +K V +G+   GKT+ + R +   F+  Y +T+G++   
Sbjct: 66  LYNPPCFIHFVFHFSDSGLNKYKLVFLGEQAVGKTSIITRFMYDTFDNNYQSTIGIDFLS 125

Query: 230 LVFHTNRGQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV 409
              + + G   L       +     L    I       V++D+T+R +++N   W +D++
Sbjct: 126 KTLYLDEGPVRLQLWDTAGQERFRSLIPSYIRDSAAAIVVYDITNRQSFENTTKWIQDIL 185

Query: 410 RV-CEGIPIVLCGNKVDIKD-RKV 475
               + + IVL GNK D+ D RKV
Sbjct: 186 NERGKDVIIVLVGNKTDLADLRKV 209


>UniRef50_A2FR00 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 199

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 36/121 (29%), Positives = 55/121 (45%), Gaps = 1/121 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD   GKT    +++ G F  K   T+G          N     L       + S
Sbjct: 12  KAILIGDANVGKTCIATKYVNGSFTDKIEPTVGAAYFTKDVVQNNVNIQLNIWDTAGQES 71

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDRK 472
              L         +  V++DVTS  T+K+V  W  D+ R V + I +++C NKVD ++R 
Sbjct: 72  YRYLVPMYYRNAQIAIVVYDVTSEHTFKDVNGWIEDVKRNVGDQIIVIVCANKVDAENRA 131

Query: 473 V 475
           V
Sbjct: 132 V 132



 Score = 33.9 bits (74), Expect = 4.5
 Identities = 15/29 (51%), Positives = 18/29 (62%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           I+ N+WDTAGQE +  L   YY   Q AI
Sbjct: 59  IQLNIWDTAGQESYRYLVPMYYRNAQIAI 87


>UniRef50_Q7YZQ9 Cluster: Rab1a; n=5; Apicomplexa|Rep: Rab1a -
           Babesia bovis
          Length = 214

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 1/116 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL+GD G GK+  + R     F   Y+ T+GV+           +  L       + 
Sbjct: 13  FKLVLIGDSGVGKSCVLLRFADDTFTDSYITTIGVDFRFRTIEVEGRRVKLQIWDTAGQE 72

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
               + +      + + ++FD+T +++++NVP+W +++ +   +GI  +L GNK D
Sbjct: 73  RFRTITSAYYRGADAIIIVFDITDKLSFENVPSWLQEVEKFAPDGIHKLLIGNKSD 128


>UniRef50_A2FJT8 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 191

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 32/131 (24%), Positives = 62/131 (47%), Gaps = 6/131 (4%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M   K +L+GD   GKTT + R+++GE+   + ATLG  +   ++  +            
Sbjct: 1   MKQCKVILLGDSCVGKTTLIHRYISGEYRNDFKATLGTNITTKIYTKDDKDIEAAIWDTA 60

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-----VRVCEGIPIVLCGN 448
                  + +      +   ++FD TS  T+ N+ NW +D+     ++  +  P ++ GN
Sbjct: 61  GTERFKSISSIHYRDADACILVFDYTSLETFHNLSNWRQDVLSSAGIKNLDSFPFIVAGN 120

Query: 449 KVDIK-DRKVK 478
           K D + DR+++
Sbjct: 121 KCDSQFDRQIE 131


>UniRef50_UPI0000D560ED Cluster: PREDICTED: similar to CG8024-PB,
           isoform B; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8024-PB, isoform B - Tribolium castaneum
          Length = 371

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 41/134 (30%), Positives = 71/134 (52%), Gaps = 6/134 (4%)
 Frame = +2

Query: 74  SHKTTKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRG 253
           ++KTT+  D +  +K +++GD G GKT+ +KR++   F + Y AT+GV+    V + +  
Sbjct: 158 ANKTTERKDHL--YKILVIGDLGAGKTSIIKRYVHRFFTQHYRATIGVDFALKVLNWDDN 215

Query: 254 QFVLMCGTQPDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCE 421
             + +       +      T   +K+ V   ++FDVT   T+++V  W  DL   V++ +
Sbjct: 216 TLIRLQLWDIAGQERYGNMTRVYYKEAVGAFIVFDVTRTNTFESVAKWKSDLDSKVQLSD 275

Query: 422 G--IPIVLCGNKVD 457
           G  IP VL  NK D
Sbjct: 276 GSPIPCVLLANKCD 289


>UniRef50_Q3SCZ1 Cluster: Rab_A18 protein; n=7; Paramecium
           tetraurelia|Rep: Rab_A18 protein - Paramecium
           tetraurelia
          Length = 217

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 35/127 (27%), Positives = 67/127 (52%), Gaps = 3/127 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK ++VGD   GK+  +  +   +F + +  T+GVE    +   N     +       + 
Sbjct: 8   FKYIIVGDTSVGKSCILLNYTEKKFNEDHETTIGVEFGSQLLKMNDRTIKIQIWDTAGQE 67

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIK- 463
           S   + T + +K ++ + ++FD+T + TY NV  WH +++    E + I L GNK+D++ 
Sbjct: 68  SFRSI-TRSYYKGSIGVVLVFDLTKKDTYYNVMKWHNEILDCTHEFVEISLVGNKLDLES 126

Query: 464 DRKVKAK 484
           +R+V +K
Sbjct: 127 ERQVSSK 133



 Score = 34.3 bits (75), Expect = 3.4
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           G    S  +    R I+  +WDTAGQE F  +   YY
Sbjct: 41  GVEFGSQLLKMNDRTIKIQIWDTAGQESFRSITRSYY 77


>UniRef50_O76225 Cluster: Small G-protein; n=3; Trypanosoma
           brucei|Rep: Small G-protein - Trypanosoma brucei
          Length = 226

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 34/117 (29%), Positives = 57/117 (48%), Gaps = 2/117 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDKR 292
           K +++GD   GK++ ++R +TG F  +Y  T+GVE +   V    R   V         +
Sbjct: 11  KVIVIGDENVGKSSLLRRFVTGTFSNQYNKTVGVEYMEKSVCLRQRSTTVNSFLWDTAGQ 70

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             V    D  + D  ++++ F   S  ++  +  W R + RVC  IP+VLC  K D+
Sbjct: 71  ETVSSVKDIYYLDAAVAILVFSTDSSESFARIEMWKRCVERVCGSIPMVLCQTKFDL 127


>UniRef50_Q40520 Cluster: Ras-related protein Rab11C; n=7;
           Magnoliophyta|Rep: Ras-related protein Rab11C -
           Nicotiana tabacum (Common tobacco)
          Length = 222

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 4/124 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLMCGTQPD 286
           FK VL+GD   GKT  + R    EF     AT+GVE     LV   ++     +  T   
Sbjct: 16  FKVVLIGDSAVGKTQILARFARNEFSLDSKATIGVEFQTRTLVIQ-HKSVKAQIWDTAGQ 74

Query: 287 KRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           +R   V  T   ++  V   +++D+T R T+ ++P W  +L       I I+L GNK D+
Sbjct: 75  ERYRAV--TSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIMLTGNKTDL 132

Query: 461 KDRK 472
           +D++
Sbjct: 133 EDQR 136


>UniRef50_Q15771 Cluster: Ras-related protein Rab-30; n=11;
           Tetrapoda|Rep: Ras-related protein Rab-30 - Homo sapiens
           (Human)
          Length = 203

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL+G+ G GKT  V+R   G F     AT+GV+        N  +  L       + 
Sbjct: 10  FKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQE 69

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGNKVDIKDR 469
               +        N L + +D+T   +++ +P W R++ +     +  VL GNK+D+ +R
Sbjct: 70  RFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAER 129

Query: 470 K 472
           +
Sbjct: 130 R 130


>UniRef50_Q6IME7 Cluster: Rbj-like protein; n=1; Phytophthora
           sojae|Rep: Rbj-like protein - Phytophthora sojae
          Length = 203

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 37/120 (30%), Positives = 67/120 (55%), Gaps = 6/120 (5%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFH--TNRGQFVLMCGTQP 283
           K + +G+ G GK+  +KR+   +F  KY++T+G++  V P++ +    R  F  + G  P
Sbjct: 40  KIISMGESGVGKSCVIKRYCEEKFVSKYISTIGIDYGVKPVMVNGAEVRVNFWDLSGL-P 98

Query: 284 DKRSLVVLETDTIFKDNVLSV-MFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGNKVD 457
           +   +     +  +KD    + MFDV+SR +++ + +W R+  +   G  P +LCGNKVD
Sbjct: 99  EYLEV----RNEFYKDTQGGILMFDVSSRRSFEALDSWLREAAKFGAGKFPCILCGNKVD 154


>UniRef50_Q9XXA4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 395

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 4/120 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLMCGTQPD 286
           FK V VGD   GKT F+ R     F+  + AT+GV+  V  +    NR   + +  T   
Sbjct: 203 FKVVFVGDSAVGKTCFLHRFCHNRFKPLFNATIGVDFTVKTMKIPPNRAIAMQLWDTAGQ 262

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLC--GNKVDI 460
           +R   + +      D V+ +MFDVTS  ++ NV NW  D VR       V+C  GNK+D+
Sbjct: 263 ERFRSITKQYFRKADGVV-LMFDVTSEQSFLNVRNW-IDSVRAGVDDATVMCLVGNKMDL 320


>UniRef50_Q4QHC3 Cluster: Small GTP-binding protein Rab11, putative;
           n=7; Trypanosomatidae|Rep: Small GTP-binding protein
           Rab11, putative - Leishmania major
          Length = 208

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 36/129 (27%), Positives = 69/129 (53%), Gaps = 2/129 (1%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPD 286
           +FK VL+GD G GK+  + R+ T EF ++  +T+GVE +   V   +R   + +  T   
Sbjct: 7   SFKIVLIGDSGVGKSNLMTRYTTNEFNQETPSTIGVEFMTKSVKIESRDAKIQIWDTAGQ 66

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           +R   +  +        + +++D+T++ ++ ++P W ++L V V     I L GNK D++
Sbjct: 67  ERFRAISRSIYHGAKGAM-LVYDITNQTSFDSIPTWLQELRVFVPATCCIFLIGNKCDLE 125

Query: 464 DRKVKAKTI 490
             +V  K +
Sbjct: 126 HLRVVKKEV 134


>UniRef50_P19073 Cluster: Cell division control protein 42
           precursor; n=25; Eukaryota|Rep: Cell division control
           protein 42 precursor - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 191

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 35/125 (28%), Positives = 59/125 (47%), Gaps = 1/125 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F   YV T+  + + +        + L      
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTV-FDNYAVTVMIGDEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +    +V  V F V S  +++NV   W  ++   C G+P ++ G ++D+
Sbjct: 60  GQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDL 119

Query: 461 KDRKV 475
           +D KV
Sbjct: 120 RDDKV 124


>UniRef50_Q9W5X0 Cluster: CG9575-PA; n=6; Coelomata|Rep: CG9575-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 201

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 34/122 (27%), Positives = 59/122 (48%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK++ + R     F   Y+ T+GV+           +  L       + 
Sbjct: 9   FKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDR 469
               + T T ++  + + V++DVT+  ++ NV  W  ++   C+ +  VL GNK D  DR
Sbjct: 69  RFRTI-TSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDR 127

Query: 470 KV 475
           KV
Sbjct: 128 KV 129


>UniRef50_A6NDS3 Cluster: Uncharacterized protein ENSP00000331047;
           n=20; Euteleostomi|Rep: Uncharacterized protein
           ENSP00000331047 - Homo sapiens (Human)
          Length = 173

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 2/123 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK V VG+   GKT+F++R     F     AT+G++      + +  Q  L       + 
Sbjct: 10  FKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWDTAGQE 69

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVD-IKD 466
               +      K + + VM+D+T + ++ +V  W   +   V + +P++L GNK+D  K+
Sbjct: 70  RYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKLDNEKE 129

Query: 467 RKV 475
           R+V
Sbjct: 130 REV 132


>UniRef50_Q86E82 Cluster: Clone ZZD836 mRNA sequence; n=1;
           Schistosoma japonicum|Rep: Clone ZZD836 mRNA sequence -
           Schistosoma japonicum (Blood fluke)
          Length = 211

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 35/121 (28%), Positives = 57/121 (47%), Gaps = 1/121 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV +GD G GKT  + R +   F++ Y AT+G++        N     L       +  
Sbjct: 15  KCVFLGDYGVGKTCIILRFMYETFDRAYKATIGIDFVSKTLCFNEKSVRLQLWDTAGQER 74

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIV-LCGNKVDIKDRK 472
              L    I    V  V++DVT+R ++    +W +++        +V L GNKVD++D +
Sbjct: 75  FRSLIPSYIKDSFVAIVVYDVTNRDSFIKASDWIKEIRAERSSKTLVFLVGNKVDLEDER 134

Query: 473 V 475
           V
Sbjct: 135 V 135


>UniRef50_Q3SDV8 Cluster: Rab_A34 protein; n=3; Paramecium
           tetraurelia|Rep: Rab_A34 protein - Paramecium
           tetraurelia
          Length = 205

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 5/123 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC---GTQP 283
           FK V +G    GK+  VKR +  +++ K   T+G        + N             Q 
Sbjct: 6   FKTVFLGSSNVGKSCIVKRIVNNQYDGKTEPTIGSSFLSKTININGEDITFQLWDTAGQE 65

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVD 457
             R+L  +    I +  +  +++D+T++ +++++  WH DL   C+G  + + LCGNKVD
Sbjct: 66  AFRALTKIYYRCI-QSQIAILVYDITNKDSFRSLARWHEDLKENCDGKRMILALCGNKVD 124

Query: 458 IKD 466
           +++
Sbjct: 125 LEN 127


>UniRef50_A2EBA3 Cluster: Small GTP-binding protein, putative; n=4;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 197

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 2/130 (1%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           MA    T K V++GD   GKT    R+LTGEF  +   T+            +    L+ 
Sbjct: 1   MAQTELTLKVVVIGDSSVGKTCVSLRYLTGEFSSQTRPTIAAGFCNAKVKLGKTDIDLLI 60

Query: 272 GTQPDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCG 445
                + +   L T   ++D  V  ++FD+T+  T  +V  WH+ L     E +  VL G
Sbjct: 61  WDTAGQEAYRGL-TSQYYRDAKVALIVFDLTNPATLNSVTEWHQRLTDANRESVVCVLVG 119

Query: 446 NKVDIKDRKV 475
           NK D+ +R+V
Sbjct: 120 NKSDLPNRQV 129


>UniRef50_Q9ULC3 Cluster: Ras-related protein Rab-23; n=23;
           Coelomata|Rep: Ras-related protein Rab-23 - Homo sapiens
           (Human)
          Length = 237

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 1/126 (0%)
 Frame = +2

Query: 92  MADDMPT-FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM 268
           + +DM    K V+VG+G  GK++ ++R+  G F K Y  T+GV+        N     LM
Sbjct: 2   LEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLM 61

Query: 269 CGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGN 448
                 +     +            ++F  T R +++ V +W   +V     IP VL  N
Sbjct: 62  LWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQN 121

Query: 449 KVDIKD 466
           K+D+ D
Sbjct: 122 KIDLLD 127


>UniRef50_Q3SD82 Cluster: Rab_C72 protein; n=4; Paramecium|Rep:
           Rab_C72 protein - Paramecium tetraurelia
          Length = 219

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 4/127 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHT-NRGQFVLMCGTQPDK 289
           FK +L+GD G GKT  ++R +  EF      T+GVE      +  N+     +  T   +
Sbjct: 13  FKIILIGDSGVGKTNILQRFVKNEFILDSKPTIGVEFSTKTINVENKSVKCQIWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD-I 460
           R   +  T+  ++  V   V +D+T  +T+ N+  W  ++     + I I++ GNK+D  
Sbjct: 73  RYRAI--TNAYYRGAVGAFVCYDITREITFTNIEKWLSEIKEYAPKNIVIMMIGNKIDQA 130

Query: 461 KDRKVKA 481
            DR V++
Sbjct: 131 NDRMVRS 137


>UniRef50_Q3SD45 Cluster: Rab_B58 protein; n=3; Paramecium
           tetraurelia|Rep: Rab_B58 protein - Paramecium
           tetraurelia
          Length = 262

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 35/122 (28%), Positives = 60/122 (49%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD   GKT+ +K+ +   F   Y  T+GVE +      N     L       + 
Sbjct: 15  FKFILIGDIAVGKTSLLKQFVEKRFCDDYNLTIGVEFNIKYIQVNDHVIKLQMWDTSGQE 74

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRD-LVRVCEGIPIVLCGNKVDIKD 466
           S   + T   ++    ++M +D+T R T++N+ NWHR+ L      +  +L GNK D++ 
Sbjct: 75  SFKSV-TRLYYRAAAGAIMVYDITRRETFENIRNWHREALDNGNSRMKFLLIGNKTDLQS 133

Query: 467 RK 472
            +
Sbjct: 134 HR 135


>UniRef50_Q8SVZ2 Cluster: Similarity to RAS-RELATED CELL DIVISION
           PROTEIN 42; n=1; Encephalitozoon cuniculi|Rep:
           Similarity to RAS-RELATED CELL DIVISION PROTEIN 42 -
           Encephalitozoon cuniculi
          Length = 179

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 34/129 (26%), Positives = 59/129 (45%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCVLVGD   GK+  +  ++TG   + Y+ TL    +  V +    ++ +      
Sbjct: 1   METIKCVLVGDPSVGKSWLISTYITGRNPEGYIPTL-FNNYSKVVNMGDKKYNMTLWDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIK 463
                  L   +  + +V  V + V + +++ N   W  +L R    +P++LCG K DI 
Sbjct: 60  GSEEYNKLRNLSFQETDVFLVCYAVNNILSFHNTRRWVEELARY--NVPMILCGTKCDII 117

Query: 464 DRKVKAKTI 490
           D  +  K +
Sbjct: 118 DGNIVDKEL 126


>UniRef50_Q54U62 Cluster: Small GTPase; n=1; Dictyostelium
           discoideum AX4|Rep: Small GTPase - Dictyostelium
           discoideum AX4
          Length = 260

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 28/127 (22%), Positives = 66/127 (51%), Gaps = 3/127 (2%)
 Frame = +2

Query: 119 CVLV-GDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           C+ + G+ G GK++ V++ +  +F  +Y  TL  + +    + +  ++ L       +  
Sbjct: 5   CICISGEPGVGKSSIVQQFVKNDFSTQYTPTLE-DFYNYELNLDEEKYNLEIIDTAGQEE 63

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKDR 469
              L+ + I   N   +++ +  + ++K V N   +++ +  C+ IPI++ GNK+DI ++
Sbjct: 64  FCDLKNNYILNGNAFIIVYSICCKGSFKEVKNIMDNIINIKDCQNIPIIIVGNKIDIDEK 123

Query: 470 KVKAKTI 490
           + K  T+
Sbjct: 124 ERKVSTL 130


>UniRef50_A2ESY6 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 198

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 34/118 (28%), Positives = 62/118 (52%), Gaps = 2/118 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDKR 292
           K VL+GD   GKT+   R++ G+F + Y  T+    +H LV   +    + +  T   + 
Sbjct: 7   KVVLIGDTLVGKTSIATRYVNGDFNESYKGTVAANFLHKLVEINDYSCDLAIWDTAGQEI 66

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIK 463
              +  T   ++D N+  ++FD+TS  T+K V +W  ++    + I I++ GNK D++
Sbjct: 67  YRTL--TPNYYRDANIAIIVFDITSMNTFKQVKSWINEVKTNVQDIIIMVVGNKHDLE 122


>UniRef50_A2EI68 Cluster: Ras family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 201

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 31/125 (24%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 89  KMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM 268
           K  +D+P +K V++GD   GKT+ + R +   F+  Y  T+G      V   +  + VL 
Sbjct: 5   KRKEDLPEYKVVMLGDSNVGKTSIIHRFIEKSFDHDYEPTVGASFLTKVMKVDTDKLVLN 64

Query: 269 CGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCG 445
                 +     L +      +   +++DV +  T+ NV  W  +L++  +  I + L  
Sbjct: 65  IWDTAGQERYKSLISTYARNAHAAILVYDVMNPDTFTNVEKWRDELLKYTKNDILLYLVA 124

Query: 446 NKVDI 460
           NK+D+
Sbjct: 125 NKIDL 129


>UniRef50_A2E160 Cluster: Small GTP-binding protein, putative; n=2;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 190

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 44/129 (34%), Positives = 68/129 (52%), Gaps = 7/129 (5%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL---GVEVHPLVFHTNRGQFVLMCG 274
           MP  K + +GD G GKT  ++R++ G+F+     TL      +   V + N    V    
Sbjct: 1   MPN-KVIFLGDAGVGKTKVIQRYICGKFDNVTKPTLVMDNASISVRVDNQNVPLEVWDTA 59

Query: 275 TQPDKRSLVVLETDTIFKDNVLSV-MFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCG 445
            Q   RS+V+    T  ++  L+V MFDV++ VT+ NV  W++ L+R       PI+L G
Sbjct: 60  GQEAYRSIVL----TYLRNVSLAVLMFDVSNNVTFTNVDEWYK-LIRAHSTPDCPIILVG 114

Query: 446 NKVDI-KDR 469
           NK D+ KD+
Sbjct: 115 NKYDLFKDQ 123


>UniRef50_A2DRV6 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 189

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 29/121 (23%), Positives = 56/121 (46%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           ++K V  GD   GKT+ +KR  T ++E+   +T+ V+        N   + L       +
Sbjct: 4   SYKIVFCGDSSVGKTSIIKRFTTQKYEQNTASTINVDFSSREIKVNDETYRLQVWDTAGQ 63

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDR 469
            +   +          + +++D+TSR T+  + +W   +     G+P V+ GNK D+ D 
Sbjct: 64  EAYRSISVSYFRNAKGIFLVYDLTSRETFNKLEDWIDLIQSNTLGVPFVIFGNKSDLVDN 123

Query: 470 K 472
           +
Sbjct: 124 Q 124


>UniRef50_O14966 Cluster: Ras-related protein Rab-7L1; n=22;
           Eumetazoa|Rep: Ras-related protein Rab-7L1 - Homo
           sapiens (Human)
          Length = 203

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 36/122 (29%), Positives = 59/122 (48%), Gaps = 6/122 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK ++VGD   GKT+ V+R+    F K Y +T+GV+    V   +  + V +       +
Sbjct: 8   FKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQ 67

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDL-----VRVCEGIPIVLCGNKV 454
                 T   ++D +   +MFDVT+  T+ N   W +DL     +   E +P +L  NK 
Sbjct: 68  ERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKC 127

Query: 455 DI 460
           D+
Sbjct: 128 DL 129


>UniRef50_Q08D03 Cluster: RAB9B, member RAS oncogene family; n=1;
           Xenopus tropicalis|Rep: RAB9B, member RAS oncogene
           family - Xenopus tropicalis (Western clawed frog)
           (Silurana tropicalis)
          Length = 201

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 32/125 (25%), Positives = 60/125 (48%), Gaps = 5/125 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GDGG GK++ + R++T +F+ +   T+GVE        +     L       +  
Sbjct: 9   KVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRLVTLQIWDTAGQER 68

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-----VRVCEGIPIVLCGNKVDI 460
              L T      +   + F V  R +++N+ +W ++      V+  +  P V+ GNKVD 
Sbjct: 69  FKSLRTPFYRGADCCLLTFSVDDRQSFENLSSWRKEFILYADVKEPDRFPFVVLGNKVDK 128

Query: 461 KDRKV 475
            +R++
Sbjct: 129 SEREI 133


>UniRef50_A2F1C1 Cluster: Small GTP-binding protein, putative; n=3;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 197

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 31/122 (25%), Positives = 68/122 (55%), Gaps = 4/122 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLMCGTQPD 286
           FK +++GD G GK+  + R+    F  ++++T+GV+  +H +     + +  +   T+  
Sbjct: 10  FKVIIIGDSGVGKSNILLRYTDDLFSNQFISTIGVDFRIHTIDVDDKKVKMQIW-DTEGQ 68

Query: 287 KRSLVVLETDTIF-KDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI 460
           +R L +  T + F   +V  +++D T++ +++ V  W  +L + C+  +  V+ GNK D+
Sbjct: 69  ERFLAI--TRSYFGYSHVALIVYDKTNKESFEKVSFWMNELDQKCDKNLLRVIVGNKADL 126

Query: 461 KD 466
           K+
Sbjct: 127 KE 128


>UniRef50_A0DCB6 Cluster: Chromosome undetermined scaffold_45, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_45,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 199

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 39/130 (30%), Positives = 67/130 (51%), Gaps = 5/130 (3%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM----CGT 277
           TFK VLVGD   GK+  + R    +FE+ +  T+GVE      +    +  L     CG 
Sbjct: 5   TFKIVLVGDPRVGKSNTLTRFAFDKFEEGHKITIGVEFAQKNVNIMGKEIKLAIWDTCGA 64

Query: 278 QPDKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKV 454
           +   R+L    T+  +K    +++ FD+T R +++N+  W +D+      I I+L  NK+
Sbjct: 65  E-QYRAL----TNIYYKGAAGALLIFDITDRSSFENLDKWLKDIESNTSSIVIMLVANKL 119

Query: 455 DIKDRKVKAK 484
           D+ D++  +K
Sbjct: 120 DLSDQRQVSK 129


>UniRef50_UPI00015B46B9 Cluster: PREDICTED: similar to GA21542-PA;
            n=2; Apocrita|Rep: PREDICTED: similar to GA21542-PA -
            Nasonia vitripennis
          Length = 1713

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113  FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
            FK VLVG+ G GKT  V+R   G F     AT+GV+           +  L       + 
Sbjct: 1516 FKVVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVENEKVKLQIWDTAGQE 1575

Query: 293  SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGNKVDIKDR 469
                +        + L +++D++ + T+  +P+W R++       +  +L GNK+D +DR
Sbjct: 1576 RFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIEEYASNKVLRILVGNKIDREDR 1635

Query: 470  KV 475
            ++
Sbjct: 1636 EI 1637


>UniRef50_UPI0000F3228D Cluster: UPI0000F3228D related cluster; n=1;
           Bos taurus|Rep: UPI0000F3228D UniRef100 entry - Bos
           Taurus
          Length = 115

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 37/83 (44%), Positives = 41/83 (49%)
 Frame = +2

Query: 128 VGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRSLVVL 307
           +GDGGTGKT  VKRHLTGEFE KYVAT            NRG+          +     L
Sbjct: 45  IGDGGTGKTMSVKRHLTGEFE-KYVAT-----------CNRGRITFKVWDTAGQEKSGGL 92

Query: 308 ETDTIFKDNVLSVMFDVTSRVTY 376
                 +      MFDVTSRVTY
Sbjct: 93  REGYHIQTQCAITMFDVTSRVTY 115



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/30 (76%), Positives = 26/30 (86%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAIS 345
           I F VWDTAGQEK GGLR+GY+IQ QCAI+
Sbjct: 76  ITFKVWDTAGQEKSGGLREGYHIQTQCAIT 105


>UniRef50_Q3SDM6 Cluster: Rab_C73 protein; n=7;
           Oligohymenophorea|Rep: Rab_C73 protein - Paramecium
           tetraurelia
          Length = 213

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 29/122 (23%), Positives = 60/122 (49%), Gaps = 2/122 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD G GKT  + R     F+  Y++T+G++           +  +       +  
Sbjct: 17  KVLLIGDSGVGKTNVLLRFCENNFQPTYLSTIGIDFKIKSIDVEGKKIKMQIWDTAGQER 76

Query: 296 LVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
              + T T +K  + + +++ +  R ++KN+ NW   + +   E +  +L GNK+D+ +R
Sbjct: 77  FKTI-TQTYYKGAMGIILVYSIDDRESFKNIQNWMSQIKQHASENVCKLLIGNKIDVPNR 135

Query: 470 KV 475
           +V
Sbjct: 136 QV 137


>UniRef50_A2FF55 Cluster: Small GTP-binding protein, putative; n=2;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 197

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 35/125 (28%), Positives = 55/125 (44%), Gaps = 1/125 (0%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M DD    K VL+GD G GKT+ V   ++G   +    T+G       F  N   F L  
Sbjct: 1   MEDDENAIKIVLLGDSGVGKTSIVSMFVSGAMPEVAAPTVGAAFVTKQFELNNNTFNLFI 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGN 448
                +     L        ++  ++FD++  VT+ +V  W  +L     E + IV+ GN
Sbjct: 61  WDTAGQELYRGLAPMYYRNASIAFIVFDISREVTFNSVAYWIEELRENSTEDVIIVIVGN 120

Query: 449 KVDIK 463
           K D++
Sbjct: 121 KNDLE 125


>UniRef50_A2D8H5 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 187

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 37/135 (27%), Positives = 68/135 (50%), Gaps = 2/135 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK V+VG+   GKT   +R   GEF ++  AT+G     +    N G+ + +       +
Sbjct: 3   FKVVIVGEADVGKTCIAQRASVGEFPERAKATVGAANCCIEVEVN-GELISLNIWDTAGQ 61

Query: 293 SLVVLETDTIFKDNVLSV-MFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKD 466
                 T   F    +++ +FD+T+  ++K +P +   L  +   G+ I+L GNK D+ D
Sbjct: 62  ERYRSLTQMYFTGASIAIAVFDITNLNSFKALPEFITMLKEKAGNGVKIILVGNKCDLTD 121

Query: 467 RKVKAKTIVFHRKKI 511
           R++  +T   ++K+I
Sbjct: 122 RQIDIETAKEYQKEI 136



 Score = 35.1 bits (77), Expect = 1.9
 Identities = 15/52 (28%), Positives = 24/52 (46%)
 Frame = +1

Query: 190 EKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAIS 345
           E+ +   G  +    +      I  N+WDTAGQE++  L   Y+     AI+
Sbjct: 29  ERAKATVGAANCCIEVEVNGELISLNIWDTAGQERYRSLTQMYFTGASIAIA 80


>UniRef50_Q22908 Cluster: RAS and EF-hand domain-containing protein
           homolog; n=2; Caenorhabditis|Rep: RAS and EF-hand
           domain-containing protein homolog - Caenorhabditis
           elegans
          Length = 656

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 34/120 (28%), Positives = 63/120 (52%), Gaps = 2/120 (1%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN-RGQFVLMCGTQPD 286
           TF+ V+ GD   GK++FV R +  +F  +  +TLGV+ H    + + R   + +  T   
Sbjct: 461 TFRIVMCGDAAVGKSSFVMRVIRRQFTNQLPSTLGVDFHVKTVNVDGRNVALQLWDTAGQ 520

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           +R   + ++     D  + +++DV +  ++  V +W   +    E  IPI+L GNKVD++
Sbjct: 521 ERFRSLCKSYFRRADGAI-LVYDVCAEQSFLRVRDWIETIKESTERSIPIILVGNKVDMR 579


>UniRef50_P62820 Cluster: Ras-related protein Rab-1A; n=163;
           Eukaryota|Rep: Ras-related protein Rab-1A - Homo sapiens
           (Human)
          Length = 205

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 30/122 (24%), Positives = 58/122 (47%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     + + Y++T+GV+        +     L       + 
Sbjct: 12  FKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQE 71

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + V++DVT + ++ NV  W +++ R   E +  +L GNK D+  +
Sbjct: 72  RFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTK 131

Query: 470 KV 475
           KV
Sbjct: 132 KV 133


>UniRef50_Q5NSZ4 Cluster: Small GTPase EhRabX22; n=2; Entamoeba
           histolytica|Rep: Small GTPase EhRabX22 - Entamoeba
           histolytica
          Length = 192

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V +GD   GKT  + R +TG+F   Y AT+G +              L       +  
Sbjct: 4   KIVFLGDSSVGKTCIIGRFMTGDFNTGYEATIGTDFSTKTMTFQNKSIQLQIWDTAGQER 63

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGNKVDIKDRK 472
              L    I   +   +++D+  R ++++V  W  D+    +G I + L GNK+D+  R+
Sbjct: 64  YRSLIPSYIRDSSAAVIVYDINDRQSFESVDKWIEDVRSKEKGEIFLFLVGNKLDLGHRE 123

Query: 473 VKAK 484
           V  K
Sbjct: 124 VTQK 127


>UniRef50_Q54HZ7 Cluster: Rho GTPase; n=1; Dictyostelium discoideum
           AX4|Rep: Rho GTPase - Dictyostelium discoideum AX4
          Length = 189

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 37/129 (28%), Positives = 68/129 (52%), Gaps = 7/129 (5%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHL-TGEFEKKYVAT-LGVEVHPLVFHTNRGQFVLM-- 268
           ++ T K V +GD G GKTT +  +  +G F ++YV T L   +H    +  +    +   
Sbjct: 2   NIKTIKIVTIGDYGVGKTTLLMTYTASGSFPQEYVPTALDNFIHEATINGKKASLSIWDT 61

Query: 269 CGTQ--PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVP-NWHRDLVRVCEGIPIVL 439
            G +   + R L+  ETD      +L ++F + +R ++ ++  NW  ++ +   GIPI+L
Sbjct: 62  AGGEYYHELRPLIYPETD------ILLLLFAIENRESFLHIKTNWITEINQYIPGIPIIL 115

Query: 440 CGNKVDIKD 466
            G K+D++D
Sbjct: 116 VGTKIDLRD 124


>UniRef50_A2GIP9 Cluster: Ras family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 205

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 37/125 (29%), Positives = 67/125 (53%), Gaps = 3/125 (2%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN-RGQFVLMCGTQPD 286
           +FK ++ G+ GTGKTT ++R +   F  +  AT+GVE        + +   + +  T   
Sbjct: 4   SFKVIVGGESGTGKTTIIQRLINNTFRSESQATVGVEFKSFNCEIDGKPTKLQIWDTAGQ 63

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI 460
           ++S  V +  + F++ V +++ +DVT R +Y+ V  W  D+  +      I+L GNK D+
Sbjct: 64  EKSKSVAK--SYFRNAVGALLVYDVTDRHSYEEVEIWLSDIQCLSHPNSVIILVGNKTDL 121

Query: 461 KDRKV 475
            D +V
Sbjct: 122 MDTRV 126


>UniRef50_A2GBJ0 Cluster: Ras family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 207

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 38/135 (28%), Positives = 61/135 (45%), Gaps = 4/135 (2%)
 Frame = +2

Query: 83  TTKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV 262
           + K      TFK +LVG+G  GKT+ V+R   G+F      T+GVE    +   +  Q  
Sbjct: 2   SNKQTQARHTFKFLLVGNGSVGKTSIVRRLCRGDFITNPETTIGVEFMTKMIDIDGNQIK 61

Query: 263 LMCGTQPDKRSLVVLETDTIFKDNVLSVM--FDVTSRVTYKNVPNWHRDLVRVCE-GIPI 433
           L       +           +  N + V+  F +T  V+++ +  W  D+ + C     +
Sbjct: 62  LQIWDTAGQEK--YRSVGKAYYRNAIGVLLVFSLTDHVSFEKLDEWITDVSQYCHPKANM 119

Query: 434 VLCGNKVDIKD-RKV 475
           +L GNK D+ D RKV
Sbjct: 120 ILVGNKSDLSDSRKV 134


>UniRef50_A2E5K7 Cluster: Ras family protein; n=5; Trichomonas
           vaginalis|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 206

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 35/124 (28%), Positives = 65/124 (52%), Gaps = 3/124 (2%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPD 286
           +FK V+VG  G GKT  V+R + G F ++  +T+GVE    +         L +  T   
Sbjct: 8   SFKIVVVGSSGVGKTAIVQRLIDGTFREEGQSTVGVEFKSFICPLEDQSVKLQIWDTAGQ 67

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI 460
           +R   V  +   F++ V +++ +D+T+  +++ +  W  DL  +C     I+L GNK D+
Sbjct: 68  ERFKSV--SKAYFRNAVGAILVYDITNETSFEELSTWLNDLQALCNPNAYILLVGNKGDL 125

Query: 461 KDRK 472
           + ++
Sbjct: 126 ESQR 129



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 38/143 (26%), Positives = 61/143 (42%), Gaps = 3/143 (2%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQC 336
           + Q+  D   RE+ +   G    S   P E ++++  +WDTAGQE+F  +   Y+     
Sbjct: 24  IVQRLIDGTFREEGQSTVGVEFKSFICPLEDQSVKLQIWDTAGQERFKSVSKAYFRNAVG 83

Query: 337 AI-SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLVRKQSGY*RQKS*GENYC--FPQEK 507
           AI  +   N +S+ +  T L      C       LV  +     Q+  G      F ++ 
Sbjct: 84  AILVYDITNETSFEELSTWLNDLQALCNPNAYILLVGNKGDLESQRQVGVQQAKDFAEQH 143

Query: 508 DLQYYDISAKSNYNFEKPFLWLA 576
            L+Y + SA S  N  + F  LA
Sbjct: 144 KLEYIETSALSGQNVSESFTRLA 166


>UniRef50_A2E5E2 Cluster: Ras family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 205

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 35/126 (27%), Positives = 63/126 (50%), Gaps = 4/126 (3%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           TFK +LVGD   GKT+ V R    +F++   +T+ VE    +   ++    L       +
Sbjct: 12  TFKFLLVGDSNVGKTSLVHRFCRDDFDECMTSTISVEFMTSILKIDQTPIKLQIWDTAGQ 71

Query: 290 RSLVVLETDTIFKDNVLSVM--FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVD- 457
                L     +  N + V+  F +TS+ ++ ++  W++D+ ++C     IVL G K D 
Sbjct: 72  EEYKSL--GKAYYRNAVGVLLCFSLTSQDSFSHIEEWYQDVRKLCNPNARIVLVGTKCDL 129

Query: 458 IKDRKV 475
           +K++KV
Sbjct: 130 VKEKKV 135


>UniRef50_UPI00006CAB29 Cluster: Ras family protein; n=1; Tetrahymena
            thermophila SB210|Rep: Ras family protein - Tetrahymena
            thermophila SB210
          Length = 1615

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 2/127 (1%)
 Frame = +2

Query: 101  DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
            ++  FK +++GDGG GK++ + R +   F+ KY AT+ ++         +    L     
Sbjct: 1449 EVKRFKVLVLGDGGVGKSSLLDRFINNTFDAKYRATIAIDYKNKTIDLPKESVQLNFWDF 1508

Query: 281  PDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKV 454
                    +  +  +KD N + ++ DVT R +   +  W R+   +  +GIP V+ GNK 
Sbjct: 1509 SGHPEFYEVRNE-FYKDANAILLVLDVTLRRSLDGLDMWLREAHEMGVQGIPTVVVGNKK 1567

Query: 455  DIKDRKV 475
            D+  R V
Sbjct: 1568 DMSVRAV 1574


>UniRef50_UPI00003C0A3C Cluster: PREDICTED: similar to ras homolog
           gene family, member Ua; n=2; Apocrita|Rep: PREDICTED:
           similar to ras homolog gene family, member Ua - Apis
           mellifera
          Length = 272

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 43/122 (35%), Positives = 58/122 (47%), Gaps = 6/122 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT--QPD- 286
           K VLVGDG  GKT+ V  + T  F  +YV T     + +V    +   V +C T  Q D 
Sbjct: 66  KVVLVGDGAVGKTSLVVSYSTNGFPGEYVPTAFDNYNVVVNVDGQPVNVQLCDTAGQDDF 125

Query: 287 --KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVD 457
              RSL   ETD      V  V F V    +Y NV + W  ++ + C   PI+L G K D
Sbjct: 126 DPLRSLCYPETD------VFLVCFSVVCPSSYHNVTSRWINEVRKYCPNAPIILVGTKSD 179

Query: 458 IK 463
           ++
Sbjct: 180 LR 181


>UniRef50_Q963D1 Cluster: Small GTP-binding protein Rab8; n=2;
           Entamoeba histolytica|Rep: Small GTP-binding protein
           Rab8 - Entamoeba histolytica
          Length = 199

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 28/129 (21%), Positives = 61/129 (47%), Gaps = 1/129 (0%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M++   T K +L+G+ G GK++ + R     F   Y+ T+G++        +  +  L  
Sbjct: 1   MSEKDSTIKLLLIGESGVGKSSLLLRFSEDAFNPMYITTVGIDFRVKNIELDNKKLKLQI 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGN 448
                +     + +        + +++D+TSR ++ N+  W R++     + +  +L GN
Sbjct: 61  WDTAGQERFRTIVSSYYRGVMGIVLVYDITSRESFNNIEYWMRNIEANADQNVNKILVGN 120

Query: 449 KVDIKDRKV 475
           K D +D++V
Sbjct: 121 KCDAEDKRV 129


>UniRef50_Q3SDN8 Cluster: Rab_C09 protein; n=3; Paramecium
           tetraurelia|Rep: Rab_C09 protein - Paramecium
           tetraurelia
          Length = 212

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 1/118 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           +K V++GD G GKT  + +   GEF ++   T+GVE  +  +   ++     +  T   +
Sbjct: 11  YKIVIIGDSGVGKTNIMTQFTRGEFSEETKTTVGVEFANKQLVIDDKIIKAQLWDTAGQE 70

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIK 463
           R   ++ +        L ++FD+T + T+ NV  W +        I I+L GNK D++
Sbjct: 71  RYRAIISSYYKGASGAL-IVFDITKQSTFDNVDRWMKVQESTSNEISIILVGNKSDLR 127


>UniRef50_A2EXX5 Cluster: Small GTP-binding protein, putative; n=2;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 191

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V +G+ G GKT+ + R++TG F +    T+G              + LM      +  
Sbjct: 6   KLVTLGESGVGKTSVINRYITGSFPESSKPTIGAAFITKEVKFGNETYNLMIWDTAGQEE 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-RVCEGIPIVLCGNKVDIKD 466
              L        ++  VMFD+ SR +++ V  W +DL       I ++LC NK+D+++
Sbjct: 66  YRGLAPMYYRNASIAIVMFDIVSRPSFEAVDYWLKDLKDNAGPDIGVLLCANKMDLQE 123


>UniRef50_A0N0H4 Cluster: Rbj-like protein; n=1; Blastocladiella
           emersonii|Rep: Rbj-like protein - Blastocladiella
           emersonii (Aquatic fungus)
          Length = 253

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 35/136 (25%), Positives = 66/136 (48%), Gaps = 7/136 (5%)
 Frame = +2

Query: 89  KMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRG-QFVL 265
           + AD  P +K V+VGD   GK+  ++R+    F   Y++T+G++    V     G Q  +
Sbjct: 60  RFADPTPRYKVVVVGDPAAGKSCLIRRYCERRFTASYISTIGIDYGLRVVDLAPGRQIKI 119

Query: 266 MCGTQPDKRSLVVLETDTIFKDNVLSVM--FDVTSRVTYKNVPNWHRDL---VRV-CEGI 427
                   R+  ++ ++  + D+   +M  FDV+ R ++  +  W ++L    R   + +
Sbjct: 120 NFWDMAGDRAYALIRSE-FYGDDTHGIMLAFDVSVRASFAGLDAWLKELRHHARARWDAL 178

Query: 428 PIVLCGNKVDIKDRKV 475
            +VL G K D+  R V
Sbjct: 179 HVVLVGTKTDLPSRAV 194


>UniRef50_A5WW21 Cluster: RAS and EF-hand domain-containing protein;
           n=2; Danio rerio|Rep: RAS and EF-hand domain-containing
           protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 663

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 36/140 (25%), Positives = 64/140 (45%), Gaps = 2/140 (1%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           D  P ++ VL GD G+GK++F+ R    EF      TLGV+        +  +  L    
Sbjct: 463 DLAPVYRLVLAGDAGSGKSSFLLRLSLNEFRGDIQTTLGVDFQIKKMLVDGEKTNLQIWD 522

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKV 454
              +     +      K + + +++DVTS  ++ NV  W   +     E IP+ + GNKV
Sbjct: 523 TAGQERFRSIARSYFRKAHGVLLLYDVTSESSFLNVREWVEQIRESTDEDIPMCIIGNKV 582

Query: 455 DIKDRKVKAKTI-VFHRKKI 511
           D++  + +   +   H +K+
Sbjct: 583 DLRAARPEGSCVSSIHGEKL 602


>UniRef50_Q9ULW5 Cluster: Ras-related protein Rab-26; n=13;
           Euteleostomi|Rep: Ras-related protein Rab-26 - Homo
           sapiens (Human)
          Length = 256

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 36/125 (28%), Positives = 65/125 (52%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEF-EKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPD 286
           FK +LVGD G GKT  + R   G F    +++T+G++    V   +  +  L M  T   
Sbjct: 64  FKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQ 123

Query: 287 KRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI 460
           +R   V  T   ++D + L +++DVT++ ++ N+  W  ++    +  + ++L GNKVD 
Sbjct: 124 ERFRSV--THAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDS 181

Query: 461 KDRKV 475
              +V
Sbjct: 182 AHERV 186


>UniRef50_Q9NP72 Cluster: Ras-related protein Rab-18; n=53;
           Eukaryota|Rep: Ras-related protein Rab-18 - Homo sapiens
           (Human)
          Length = 206

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 36/139 (25%), Positives = 65/139 (46%), Gaps = 3/139 (2%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           D + T K +++G+ G GK++ + R     F+ +  AT+GV+        +  +  L    
Sbjct: 4   DVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWD 63

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIV--LCGNK 451
              +     L          + +++DVT R T+  + NW  +L   C    IV  L GNK
Sbjct: 64  TAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNK 123

Query: 452 VDIKDRKV-KAKTIVFHRK 505
           +D ++R+V + + + F RK
Sbjct: 124 IDKENREVDRNEGLKFARK 142


>UniRef50_P51153 Cluster: Ras-related protein Rab-13; n=89;
           Eukaryota|Rep: Ras-related protein Rab-13 - Homo sapiens
           (Human)
          Length = 203

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 30/124 (24%), Positives = 57/124 (45%), Gaps = 2/124 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GKT  + R     F   Y++T+G++           +  L       + 
Sbjct: 9   FKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK-D 466
               + T        + +++D+T   +++N+ NW + +      G+  +L GNK D++  
Sbjct: 69  RFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAK 128

Query: 467 RKVK 478
           RKV+
Sbjct: 129 RKVQ 132


>UniRef50_P60953 Cluster: Cell division control protein 42 homolog
           precursor; n=56; Eukaryota|Rep: Cell division control
           protein 42 homolog precursor - Homo sapiens (Human)
          Length = 191

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 34/136 (25%), Positives = 63/136 (46%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C   P +L G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDDPSTIEKLAKNKQK 135


>UniRef50_UPI0000660B08 Cluster: Homolog of Homo sapiens
           "Ras-related protein Rab-39B; n=2; Euteleostomi|Rep:
           Homolog of Homo sapiens "Ras-related protein Rab-39B -
           Takifugu rubripes
          Length = 214

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 32/121 (26%), Positives = 63/121 (52%), Gaps = 6/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           F+ +++GD   GK++ VKR+  G F+     T+GV+ +       +G  V +       +
Sbjct: 9   FRIIMLGDSTVGKSSLVKRYAEGLFQDSINQTVGVDFYVHFLEVEQGVHVKLQFWDTAGQ 68

Query: 293 SLVVLETDTIFKDNVLS-VMFDVTSRVTYKNVPNWHRDLVRVCEGIP-----IVLCGNKV 454
                 T + ++++    +MFD+T+RV+++++  WHR+   VC+ +       +L GNK 
Sbjct: 69  ERFRSVTRSYYRNSAGGLLMFDMTNRVSFEHIKEWHRE---VCDHVHPYKVLFILVGNKS 125

Query: 455 D 457
           D
Sbjct: 126 D 126


>UniRef50_Q9BLF1 Cluster: Small GTPase RabD1; n=3; Entamoeba
           histolytica|Rep: Small GTPase RabD1 - Entamoeba
           histolytica
          Length = 196

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 30/120 (25%), Positives = 58/120 (48%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++G+   GKT  + R ++ +F +   +T+GV +       N  +  L       +  
Sbjct: 4   KLIMIGESSVGKTCCMNRFVSDQFSEVTKSTVGVGMVSKEMEVNGIKVKLQIWDTAGQER 63

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRKV 475
              L ++         +MFDV++R +++NV NW     ++ E   +VL GNK D+ +R +
Sbjct: 64  FATLSSNYFRNAMGGVIMFDVSNRQSFENVSNWIDGCNKIEEKRVLVLAGNKTDLDERVI 123


>UniRef50_Q5BVW6 Cluster: SJCHGC06044 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC06044 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 368

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 33/121 (27%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +LVGD G GK++F+ R   G F  +   TLGV+        N   + +       + 
Sbjct: 153 FKVILVGDSGVGKSSFLYRFCDGIFYPQLRTTLGVDFRTRNILMNNSVYTIQLWDTAGQE 212

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC---EGIPIVLCGNKVDIK 463
           +   +      K + + +M+ V    T+ N+  W  +++R       +PI+L GNKVD++
Sbjct: 213 TYRCVVRSYFRKIDGVVLMYAVNQPDTFANIKYW-MEMIRESTSEANVPILLVGNKVDLR 271

Query: 464 D 466
           +
Sbjct: 272 N 272


>UniRef50_A2G1N8 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 191

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 2/124 (1%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRSLV 301
           V+ G G  GK+    R+  G F + Y  T+  +    +   N      +  T  ++   +
Sbjct: 10  VVFGSGAVGKSAMTLRYTCGNFIEDYDPTIEDQYSKDITIDNVTYKCEILDTAGEEE-FI 68

Query: 302 VLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV--RVCEGIPIVLCGNKVDIKDRKV 475
            +    I K N   +++ +T R ++  + + HRD++  +    +PIV+CGNK D++D ++
Sbjct: 69  QMRLPYIRKGNAFLLVYSITFRQSFDEIEHLHRDILHNKGTTDVPIVICGNKCDLEDNRI 128

Query: 476 KAKT 487
            +K+
Sbjct: 129 VSKS 132


>UniRef50_A2F446 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 187

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 30/122 (24%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +  GD   GKTT +  ++ GE + +   T+           N  ++ L+      +  
Sbjct: 6   KIIFAGDSNCGKTTLLLYYIMGEVKGEAKPTVAASFFTRTIDLNNKKYNLVLWDTAGQEL 65

Query: 296 LVVLETDTIFKDNVLS-VMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKDR 469
              L T   ++D+ ++ ++FDVTS+ ++ N+ +W  D+     +G+ + + GNK+D+ DR
Sbjct: 66  YRNL-TPMYYRDSKIAFILFDVTSKTSFDNLESWVSDIRNEAGDGVLLSIVGNKIDLDDR 124

Query: 470 KV 475
            +
Sbjct: 125 VI 126


>UniRef50_A2E7L0 Cluster: GTP-binding protein YPTM1, putative; n=2;
           Trichomonas vaginalis|Rep: GTP-binding protein YPTM1,
           putative - Trichomonas vaginalis G3
          Length = 201

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 25/121 (20%), Positives = 61/121 (50%), Gaps = 1/121 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++GD   GK++ + +     F   YV+T+GV+        +  Q  L       + 
Sbjct: 10  YKILIIGDSAVGKSSILLQFSDQTFSDNYVSTIGVDFKIRTLDVDGKQVKLQIWDTAGQE 69

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKDR 469
               + ++     + +++++D+T R +++N+  W  D+ R+  + +  ++ GNK D+ D+
Sbjct: 70  RFQSIVSNYYHGSHAIALVYDITDRKSFENLRKWVSDVDRLANKQVCRIIVGNKTDLSDK 129

Query: 470 K 472
           +
Sbjct: 130 R 130



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +1

Query: 232 SIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAISHV 351
           ++  + + ++  +WDTAGQE+F  +   YY  G  AI+ V
Sbjct: 50  TLDVDGKQVKLQIWDTAGQERFQSIVSNYY-HGSHAIALV 88


>UniRef50_A2DYG4 Cluster: Ras family protein; n=3; Trichomonas
           vaginalis|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 296

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 28/129 (21%), Positives = 61/129 (47%), Gaps = 1/129 (0%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           +A +    K V++GD   GKT  + R +   F      T+G+       H  +G+ +L  
Sbjct: 130 IASEKRILKLVVMGDTEVGKTCLLNRLIKNVFTVNTPKTIGLCFSYYYIHNQKGRILLHI 189

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGN 448
                +     + ++     +   + FD+T++ ++K++ +W+ ++++    GI  V+ GN
Sbjct: 190 WDVAGEEKYRTITSNFYKSTDFALICFDLTNKASFKDLESWYTEIIKNATPGIKFVIVGN 249

Query: 449 KVDIKDRKV 475
           K D  + +V
Sbjct: 250 KKDCDENRV 258


>UniRef50_A2DFV6 Cluster: Ras family protein; n=3; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 203

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 1/124 (0%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           TF+ V +GD   GKT  V R L  +F+     T+G        H +     +       +
Sbjct: 9   TFRSVTIGDSSVGKTCIVNRFLQDKFDPAEPNTIGTLYESFTDHRDGHDLEIQIWDTAGQ 68

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKD 466
                L            V+FD+T+R ++++V  W  +   V  E   +VL GNK+D+ +
Sbjct: 69  EQYRSLGPIYYRSSLAAIVVFDITNRKSFEDVNEWVSEFRNVAGENTIVVLVGNKIDLPE 128

Query: 467 RKVK 478
           R V+
Sbjct: 129 RAVE 132


>UniRef50_P15153 Cluster: Ras-related C3 botulinum toxin substrate 2
           precursor; n=198; Eukaryota|Rep: Ras-related C3
           botulinum toxin substrate 2 precursor - Homo sapiens
           (Human)
          Length = 192

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 37/126 (29%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V   ++   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + S  +Y+NV   W  ++   C   PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123


>UniRef50_P34143 Cluster: Ras-related protein RabC; n=3;
           Dictyostelium discoideum|Rep: Ras-related protein RabC -
           Dictyostelium discoideum (Slime mold)
          Length = 196

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 35/125 (28%), Positives = 65/125 (52%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH-PLVFHTNRGQFVLMCGTQPDK 289
           +K +LVG+ G GK++ + R     F + +  TLGV+ +   + +   GQ V +       
Sbjct: 7   YKIILVGESGVGKSSILVRFTDNTFSQHFAPTLGVDFNVKTIRNKETGQTVKLQLWDTAG 66

Query: 290 RSLVVLETDTIFK-DNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD-I 460
           +      T T ++  + + V++DVT   +++ + NW  D+ +   +G+ I+L GNK D +
Sbjct: 67  QERFKSITQTFYRGSHGVIVVYDVTDPKSFERLKNWVEDINQYTQDGMIIILVGNKSDMV 126

Query: 461 KDRKV 475
             RKV
Sbjct: 127 AQRKV 131


>UniRef50_UPI00015ADE7B Cluster: hypothetical protein
           NEMVEDRAFT_v1g69635; n=1; Nematostella vectensis|Rep:
           hypothetical protein NEMVEDRAFT_v1g69635 - Nematostella
           vectensis
          Length = 163

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 33/132 (25%), Positives = 62/132 (46%), Gaps = 1/132 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           F+ V++G GG GKT+ VKR ++G F ++Y  T+G      V  +      L         
Sbjct: 1   FRVVVLGSGGVGKTSLVKRFISGTFSEQYTPTVGDLYEKSVTLSKDFNAFLEIMDTAGSY 60

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKDR 469
               ++  TI   +   +++ V  + + +      R++V +  + +P+VL GNK D+   
Sbjct: 61  PFPAMKKLTIQNADAFVLVYSVDEKASLQEALELQREIVYIKGKTVPMVLVGNKTDLVSE 120

Query: 470 KVKAKTIVFHRK 505
           +++  T    RK
Sbjct: 121 ELRQSTRAQMRK 132


>UniRef50_UPI000069EE97 Cluster: UPI000069EE97 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI000069EE97 UniRef100 entry -
           Xenopus tropicalis
          Length = 202

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 36/125 (28%), Positives = 63/125 (50%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM--CGTQPD 286
           F+ +L+GD G GKT+ + R+  G+F      T+GV+          G  V +    T   
Sbjct: 5   FRVLLLGDSGVGKTSLLHRYTDGQFTDTTTETVGVDFCCREEEPEPGVKVRLQFWDTAGQ 64

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIV--LCGNKVDI 460
           +R   V  +       VL ++FD+T+R ++ NV  WH ++    +  P+V  L G K D+
Sbjct: 65  ERYRAVTRSYYRNAAGVL-LLFDLTTRQSFDNVTEWHMEVTERTQAKPMVFMLLGAKNDL 123

Query: 461 KDRKV 475
           K++++
Sbjct: 124 KEKRM 128


>UniRef50_Q8IR98 Cluster: CG32670-PA; n=22; melanogaster
           subgroup|Rep: CG32670-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 214

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>UniRef50_Q552K3 Cluster: Rab GTPase; n=1; Dictyostelium discoideum
           AX4|Rep: Rab GTPase - Dictyostelium discoideum AX4
          Length = 216

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 31/133 (23%), Positives = 68/133 (51%), Gaps = 3/133 (2%)
 Frame = +2

Query: 86  TKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH-PLVFHTNRGQFV 262
           T+++D    FK +++GD G GK++ + R     F   +++T+GV+     ++   +    
Sbjct: 6   TQISDYDFLFKILVIGDRGVGKSSLIVRFADDNFTDSFISTIGVDFKIKTIYLEGKAIKT 65

Query: 263 LMCGTQPDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIV 436
            +  T    R  +       ++  + + V++DVT + T+KNV  W  ++ R   E +  +
Sbjct: 66  QIWDTMGQDRFRMGNNNSIFYRGAHGIIVVYDVTDQGTFKNVAQWLGEVDRYAREDVSKL 125

Query: 437 LCGNKVDIKDRKV 475
           +  NK+D+ +++V
Sbjct: 126 IVANKIDLVEKRV 138


>UniRef50_Q4FZ19 Cluster: Small GTP binding protein rab6-like
           protein; n=2; Leishmania|Rep: Small GTP binding protein
           rab6-like protein - Leishmania major
          Length = 274

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 38/121 (31%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV-LMCGTQ 280
           MP  K VL+GD   GKT+ + R +   F+++Y  T+G++      H +  + V L     
Sbjct: 22  MPKHKLVLLGDQSVGKTSIITRFMYDTFDQQYQPTIGIDFFSKTVHLDDDRDVRLHLWDT 81

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKV 454
             +     L    I       V++D+TSR T+ +   W  D VR   G  + I+L GNKV
Sbjct: 82  AGQERFHSLIPSYIRNSAATVVVYDITSRPTFFSAFKW-IDEVRSESGADVVIMLVGNKV 140

Query: 455 D 457
           D
Sbjct: 141 D 141


>UniRef50_Q22YA7 Cluster: Small GTP-binding protein domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Small GTP-binding protein domain containing
           protein - Tetrahymena thermophila SB210
          Length = 234

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 32/123 (26%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++G+ G GK+  ++R+   +F + YV T+G E        N GQ V +       +
Sbjct: 9   FKIIMLGETGVGKSQMLQRYTKNKFTEDYVTTIGAEFATTSVKLNNGQVVQVQIWDTAGQ 68

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIK 463
                 T   ++  V +V+ +D++ + T+K    W  ++ +  +   I I+L GNK D+ 
Sbjct: 69  EKFRSITRAFYRGAVGAVLVYDISDQQTFKKCDKWLDEIKQYNQDNQIAILLVGNKKDLI 128

Query: 464 DRK 472
           D++
Sbjct: 129 DKQ 131


>UniRef50_A7AMF5 Cluster: Rab7; n=2; Babesia bovis|Rep: Rab7 -
           Babesia bovis
          Length = 233

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 6/136 (4%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           MA   P  K +++GD G GKT+ + + +   F  +Y AT+G +        +     L  
Sbjct: 19  MARKRPILKIIILGDSGVGKTSLMNQFINKRFTNQYRATIGADFSTQEVTVDDKVVTLQI 78

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRD-LVRV----CEGIPIV 436
                +     L        +   +++D T++ T++++ +W  + L++V     E  P  
Sbjct: 79  WDTAGQERFQSLGKAFYRGADCCMLVYDTTNQKTFESIESWKSEFLIQVEPKDPESFPFA 138

Query: 437 LCGNKV-DIKDRKVKA 481
           L GNKV D+ +RKV A
Sbjct: 139 LIGNKVDDVANRKVSA 154


>UniRef50_Q4RWQ6 Cluster: Chromosome 15 SCAF14981, whole genome
           shotgun sequence; n=13; Bilateria|Rep: Chromosome 15
           SCAF14981, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 251

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GKT  + R     F   +++T+G++        +  +  L       + 
Sbjct: 9   FKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDR 469
               + T        + +++D+T+  ++ N+ NW R++       +  ++ GNK DI D+
Sbjct: 69  RFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMVLGNKCDINDK 128

Query: 470 KVKAK 484
           +  +K
Sbjct: 129 RQVSK 133


>UniRef50_Q9XWR6 Cluster: Putative uncharacterized protein rab-28;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein rab-28 - Caenorhabditis elegans
          Length = 248

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 35/130 (26%), Positives = 64/130 (49%), Gaps = 5/130 (3%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D    K V+VGDG +GKT+  +R     F+K Y  TLG++             VL+    
Sbjct: 32  DDKVIKIVVVGDGASGKTSICQRFAKESFDKSYHQTLGLDFFSRRITLPHEMQVLVQVWD 91

Query: 281 PDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG----IPIVLCG 445
              +S+     D      N++ +++DVT+  +++N  +W   + +  +     + +VL G
Sbjct: 92  IGGQSIAGEMIDKYLTGANIVFLVYDVTNSKSFENAVDWLSVVKKNTKSSETPVKLVLMG 151

Query: 446 NKVDIKDRKV 475
           NK D+++R+V
Sbjct: 152 NKTDLEERRV 161


>UniRef50_Q9VM50 Cluster: CG9100-PA, isoform A; n=56; Eukaryota|Rep:
           CG9100-PA, isoform A - Drosophila melanogaster (Fruit
           fly)
          Length = 223

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 1/129 (0%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M D    FK VLVG+ G GKT  V+R   G F     AT+GV+           +  L  
Sbjct: 1   MEDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQI 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGN 448
                +     +        + L +++D++ + T+  +P+W R++       +  +L GN
Sbjct: 61  WDTAGQERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGN 120

Query: 449 KVDIKDRKV 475
           K D  DR++
Sbjct: 121 KTDRDDREI 129


>UniRef50_Q5NT04 Cluster: Small GTPase EhRabX12; n=1; Entamoeba
           histolytica|Rep: Small GTPase EhRabX12 - Entamoeba
           histolytica
          Length = 233

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 31/137 (22%), Positives = 58/137 (42%), Gaps = 1/137 (0%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D+   K +L+GD   GKT+ + R+    F   Y+ T+GV+        N     +     
Sbjct: 41  DVILLKVLLIGDISVGKTSLLLRYCDSTFSTTYITTIGVDFKVATMKRNGRTIKMQIWDT 100

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
                   +        N   +++D+T   ++ NV  W+  L   C    ++L G+K D+
Sbjct: 101 AGSERFRSIVNSYYKASNGCFLVYDITDATSFNNVMMWYTALKEECPECEVMLIGSKSDL 160

Query: 461 KDRK-VKAKTIVFHRKK 508
             R+ V+ +T +   K+
Sbjct: 161 SYRRCVQTQTAMEFAKQ 177


>UniRef50_Q5NSY4 Cluster: Small GTPase EhRabX32; n=1; Entamoeba
           histolytica|Rep: Small GTPase EhRabX32 - Entamoeba
           histolytica
          Length = 202

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 32/125 (25%), Positives = 62/125 (49%), Gaps = 6/125 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN---RGQFVLM-CGTQP 283
           K   +GD   GKT+ + R +  EF   Y  T+G + H  +   N   R +  L+  G+  
Sbjct: 8   KVAFIGDATVGKTSLISRFMYDEFYDNYNVTVGTDFHSKIITINQKLRLRLQLLDIGSSM 67

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNKVD 457
              S+V   +  +   NV  +++D+T++ ++ +V  W ++L  + +   I   L GNK+D
Sbjct: 68  KHHSIV---SSYVSNVNVCVLVYDITNQESFVSVQQWFKELQDITLTRTIQFYLVGNKID 124

Query: 458 IKDRK 472
           +  ++
Sbjct: 125 LSSQE 129


>UniRef50_Q3SDR8 Cluster: Rab_C88 protein; n=5; Paramecium
           tetraurelia|Rep: Rab_C88 protein - Paramecium
           tetraurelia
          Length = 334

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 32/135 (23%), Positives = 64/135 (47%), Gaps = 2/135 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK V +G    GK++ +KR L  EF  K ++T+GV     V   +  Q  +       + 
Sbjct: 23  FKIVFLGSSSVGKSSIIKRFLKNEFAMKSMSTVGVACESKVITIHNQQVKVQLWDTAGQE 82

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPI-VLCGNKVDI-KD 466
               L  +     + + +++D+ +  ++  V  W  D    CE   I +L GNK+D+ ++
Sbjct: 83  RYRSLTKNYYRNCDAVVIVYDIANMKSFYQVKGWIADFEDKCERPAIKMLLGNKIDLNRE 142

Query: 467 RKVKAKTIVFHRKKI 511
             ++  T++  ++K+
Sbjct: 143 VGIELGTLLAQKQKL 157


>UniRef50_A2FJF4 Cluster: Guanine nucleotide regulatory protein,
           putative; n=10; Trichomonas vaginalis|Rep: Guanine
           nucleotide regulatory protein, putative - Trichomonas
           vaginalis G3
          Length = 199

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 29/122 (23%), Positives = 59/122 (48%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++G  G GKT  + R + G F  +  +T+GVE    V   +     L       + 
Sbjct: 10  FKFIVIGSSGVGKTALLSRLIDGTFSPENQSTIGVEYLSTVIEVDGNPIKLQIWDTAGQE 69

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
               +   + F++ V + +++D+T R ++ ++  W  D+  +C+    + L GNK+D+  
Sbjct: 70  KFRAI-AKSYFRNAVGVILVYDITDRKSFDDLALWLNDVHTLCDPNAAVTLIGNKLDLSS 128

Query: 467 RK 472
            +
Sbjct: 129 SR 130


>UniRef50_A2EEB3 Cluster: Small GTP-binding protein, putative; n=3;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 196

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 32/131 (24%), Positives = 66/131 (50%), Gaps = 3/131 (2%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLM 268
           M +++  FK +++G  G GKT  +KR    EF +  ++T GVE        +  +  + +
Sbjct: 1   MVENVDFFKFIVIGSTGVGKTCIMKRMTENEFRENTLSTTGVEFDSTKVDVDGKEIPIQI 60

Query: 269 CGTQPDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLC 442
             T   +R   +  +   F++ + + ++F +T + +++ +  W  D     C+   I+L 
Sbjct: 61  WDTAGQERFRSI--SRAYFRNAIGVLLVFSLTDKESFEEIGGWLNDARTLCCQDAEIMLI 118

Query: 443 GNKVDIKDRKV 475
           GNK DI D+++
Sbjct: 119 GNKCDIPDQRL 129


>UniRef50_A2DT20 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 202

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 29/122 (23%), Positives = 59/122 (48%), Gaps = 5/122 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V++G  G GKT+ + R+  G F+   + T+G          ++    L+      +  
Sbjct: 13  KIVVLGSAGVGKTSIIYRYCNGTFQPGTMPTIGAGFFTHNIEIDKKDVNLLLWDTAGEER 72

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-----EGIPIVLCGNKVDI 460
              +    +   N + +++DVTS+V++K + +++   +  C     E +PI+  GNK+D 
Sbjct: 73  FKSVTPSLLHGANGMILVYDVTSKVSFKELSDYYEMFLETCEFKNGEDLPILAFGNKIDK 132

Query: 461 KD 466
           +D
Sbjct: 133 ED 134


>UniRef50_P40392 Cluster: Ras-related protein RIC1; n=36;
           Eukaryota|Rep: Ras-related protein RIC1 - Oryza sativa
           subsp. japonica (Rice)
          Length = 202

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     + + Y++T+GV+        +     L       + 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDSYLESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + V++DVT + ++ NV  W  ++ R   E +  +L GNK D+ + 
Sbjct: 69  RFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLAEN 128

Query: 470 KV 475
           +V
Sbjct: 129 RV 130


>UniRef50_Q6Z808 Cluster: Rac-like GTP-binding protein 3; n=7;
           Eukaryota|Rep: Rac-like GTP-binding protein 3 - Oryza
           sativa subsp. japonica (Rice)
          Length = 214

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 4/131 (3%)
 Frame = +2

Query: 92  MADDMPTF-KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFV 262
           MA     F KCV VGDG  GKT  +  + + +F   Y+ T+      + +V  T     +
Sbjct: 1   MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDSTTVNLGL 60

Query: 263 LMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVL 439
                Q D   L  L   +    +V  + F + SR +Y+N+   W  +L     G+PIVL
Sbjct: 61  WDTAGQEDYNRLRPL---SYRGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPIVL 117

Query: 440 CGNKVDIKDRK 472
            G K+D+++ K
Sbjct: 118 VGTKLDLREDK 128


>UniRef50_UPI0000E4688C Cluster: PREDICTED: similar to RAB13, member
           RAS oncogene family, partial; n=2; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to RAB13, member RAS
           oncogene family, partial - Strongylocentrotus purpuratus
          Length = 560

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 4/126 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K V VGD G GKT+ + R  T  F   + AT+GV+              +       + 
Sbjct: 373 YKVVFVGDSGVGKTSIIHRFCTDTFTDSFSATIGVDFQVKSLSVCGSIVAMQLWDTAGQE 432

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHR--DLVRVCEG-IPIVLCGNKVD-I 460
               +      K + + +++DVTS  ++ N+ NW    ++    +G +  +L GNK D  
Sbjct: 433 RFRSITRHYFRKADGIVILYDVTSETSFLNIRNWMNSIEVNETTDGHVVKMLLGNKCDCT 492

Query: 461 KDRKVK 478
           +DR++K
Sbjct: 493 EDRQIK 498


>UniRef50_UPI0000D57496 Cluster: PREDICTED: similar to Ras-like
           GTP-binding protein Rho1; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to Ras-like GTP-binding protein Rho1
           - Tribolium castaneum
          Length = 199

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 1/124 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M + K V++GDG  GKT+        EF + +V T+  + +      +     L      
Sbjct: 1   MSSKKIVVIGDGACGKTSLSVAFSQNEFPETHVPTI-YDTYTKTITVDEQNVELTIWDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  K +V+ V F + + V+ KNV   W  ++   C  +PI+L GNK+D+
Sbjct: 60  GEEDYDRLRPLSYTKASVIIVCFTIDNPVSLKNVKTRWAPEVKHFCRKVPILLVGNKLDL 119

Query: 461 KDRK 472
           ++ K
Sbjct: 120 RNNK 123


>UniRef50_A2U1B9 Cluster: Small GTP-binding protein domain protein;
           n=1; Polaribacter dokdonensis MED152|Rep: Small
           GTP-binding protein domain protein - Polaribacter
           dokdonensis MED152
          Length = 161

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 34/126 (26%), Positives = 62/126 (49%), Gaps = 5/126 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM----CGTQP 283
           K +LVG+ G GKT+ ++R +  EF + Y++T+GV V   + +    +  L+     GT  
Sbjct: 5   KVLLVGNFGVGKTSLIRRFVLNEFSEDYISTIGVRVSTKILNVEEEEMKLLIWDVAGTSD 64

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVD-I 460
           D++    +        +    +FD+    TY NV    ++L  +     I+L GNK D +
Sbjct: 65  DEK----IPKAYFLGASAAMYVFDLNREETYINVDAKIQELKEISGLDTILLVGNKKDLL 120

Query: 461 KDRKVK 478
            D +++
Sbjct: 121 SDERIE 126


>UniRef50_Q9N2P5 Cluster: LmRab7 GTP-binding protein; n=6;
           Trypanosomatidae|Rep: LmRab7 GTP-binding protein -
           Leishmania major
          Length = 223

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 32/126 (25%), Positives = 60/126 (47%), Gaps = 1/126 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G GKT+ + +++   F+ +Y AT+G +        N     L       +  
Sbjct: 9   KIIILGDSGVGKTSLMHQYVNRIFDNRYKATIGADFLSKDVEVNGCVVTLQIWDTAGQER 68

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRK- 472
              L +      +   ++FDVT + ++ +V +W  +          VL GNK D++DR+ 
Sbjct: 69  FQSLGSAFYRGADACILVFDVTQQESFAHVGSWLEEFSIQAGRRDSVLVGNKTDLEDRRQ 128

Query: 473 VKAKTI 490
           V +KT+
Sbjct: 129 VASKTV 134


>UniRef50_Q4DJA9 Cluster: Small GTP-binding protein RAB6, putative;
           n=3; Trypanosoma|Rep: Small GTP-binding protein RAB6,
           putative - Trypanosoma cruzi
          Length = 268

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 35/122 (28%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K VL+GD   GKT+ V R +   F+++Y AT+G++        +     L       +  
Sbjct: 36  KIVLLGDQSVGKTSLVTRFMYDTFDQQYQATIGIDFFSKTIPVDNRTVRLHVWDTAGQER 95

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIKDR 469
              L    I   +   V++D+TSR ++     W  D VR   G  + I L GNK+D +++
Sbjct: 96  FRSLIPSYIRNSSGTIVVYDITSRASFLGTFKW-IDEVRAERGDSVVIFLVGNKLDAQEK 154

Query: 470 KV 475
           +V
Sbjct: 155 RV 156



 Score = 39.5 bits (88), Expect = 0.090
 Identities = 16/31 (51%), Positives = 21/31 (67%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGY 318
           S +IP + R +R +VWDTAGQE+F  L   Y
Sbjct: 73  SKTIPVDNRTVRLHVWDTAGQERFRSLIPSY 103


>UniRef50_Q247S3 Cluster: Ras family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Ras family protein - Tetrahymena
           thermophila SB210
          Length = 212

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 33/127 (25%), Positives = 65/127 (51%), Gaps = 3/127 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VLVGD   GK+  + +++  +F+ +   T+GVE     + T  GQ  ++        
Sbjct: 12  FKIVLVGDPKVGKSYILSQYIREDFDLENKDTIGVEFDQKFYPTMPGQDKILVQLWDSAG 71

Query: 293 SLVVLE-TDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
               L+   + F+ +  +++ FDVT + ++ N   W+  +  + +  I IVL GNK D+ 
Sbjct: 72  KYGFLQKLPSYFRASTGALLIFDVTKKDSFLNCEKWYNTITSLADPHIQIVLVGNKTDLS 131

Query: 464 DRKVKAK 484
           + ++ ++
Sbjct: 132 NLRIVSR 138


>UniRef50_O15971 Cluster: CG17060-PA; n=3; Coelomata|Rep: CG17060-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 204

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GKT  + R     F   +++T+G++           +  L       + 
Sbjct: 10  FKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQE 69

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDR 469
               + T        + +++D+T+  +++N+  W R++     E +  ++ GNK D+ D+
Sbjct: 70  RFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDK 129

Query: 470 KVKAK 484
           +V  K
Sbjct: 130 RVVNK 134


>UniRef50_A7S7Y6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 211

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 35/118 (29%), Positives = 51/118 (43%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV+VGDGG GKT+ +  ++   F   YV T     H  V    +   +  C T   +  
Sbjct: 20  KCVIVGDGGVGKTSLLVSYMMDGFPNSYVPTAFDTYHVTVEVNKKLCMIEFCDT-AGQED 78

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L        +V  V F V S  ++ NV + W  ++       PI+L G   D+KD
Sbjct: 79  FDALRPLCYSSADVFIVCFSVVSPTSFANVASKWIPEIREFQPKAPIILVGTHSDLKD 136


>UniRef50_P34150 Cluster: RAS-related protein racD; n=2;
           Dictyostelium discoideum|Rep: RAS-related protein racD -
           Dictyostelium discoideum (Slime mold)
          Length = 254

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 36/124 (29%), Positives = 62/124 (50%), Gaps = 3/124 (2%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT--QP 283
           T K V+VGDG  GKT+ +  + T  F K YV T+    + L  + N+   +++  T  Q 
Sbjct: 8   TVKVVVVGDGAVGKTSLLILYTTKAFPKDYVPTVFDNFNCLEMYDNKPVNLVLWDTAGQE 67

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVP-NWHRDLVRVCEGIPIVLCGNKVDI 460
           D  +L  L      + +V  + + V  R +  N+   W  ++ +  +G PI+L G K D+
Sbjct: 68  DYDNLRPLSYP---QTDVFIICYSVVKRDSLDNIKYKWLPEINQTNQGTPIILVGTKTDL 124

Query: 461 KDRK 472
           ++ K
Sbjct: 125 REDK 128


>UniRef50_P34141 Cluster: Ras-related protein RabA; n=6;
           Dictyostelium discoideum|Rep: Ras-related protein RabA -
           Dictyostelium discoideum (Slime mold)
          Length = 199

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK + VGD G GK++ + R     F + Y++T+GV+      +       L       + 
Sbjct: 7   FKFIFVGDSGVGKSSILLRFTEDTFTESYISTIGVDFKIKTVYIEGKAIKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKDR 469
              V         + + V++DVT + +++NV  W +++ R     +  ++ GNK D+  +
Sbjct: 67  RFRVHNNSQYRGCHAVMVVYDVTDQRSFENVAKWIQEIERYARHNVIKMIIGNKSDMISQ 126

Query: 470 KV 475
           KV
Sbjct: 127 KV 128


>UniRef50_A3U5M9 Cluster: Putative uncharacterized protein; n=1;
           Croceibacter atlanticus HTCC2559|Rep: Putative
           uncharacterized protein - Croceibacter atlanticus
           HTCC2559
          Length = 161

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 37/133 (27%), Positives = 58/133 (43%), Gaps = 1/133 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRG-QFVLMCGTQPDKR 292
           K V++G  G GKT+  +R +   F + Y+ TLGV++         G +  L+       R
Sbjct: 6   KIVILGQFGVGKTSLTRRFVDQAFSEDYLVTLGVQIKKKTLTLKNGDELSLIIWDIEGTR 65

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRK 472
           S+       +     +  +FDVT   TY+N+      L +    IPI +  NK D+ D K
Sbjct: 66  SVKDTRASYLLGSQAIIYVFDVTRIETYENLAEEIEILKQ--HNIPIKVLANKSDLADIK 123

Query: 473 VKAKTIVFHRKKI 511
              K +  H   I
Sbjct: 124 SVLKYVKEHNLDI 136


>UniRef50_Q4Q0D5 Cluster: Small G-protein, putative; n=6;
           Trypanosomatidae|Rep: Small G-protein, putative -
           Leishmania major
          Length = 297

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 2/128 (1%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCG 274
           D+    K ++VGDG  GKT  ++R + G+F ++Y  T+G E +   VF  +    V +  
Sbjct: 4   DEEECIKVIVVGDGNVGKTCMLRRFVRGDFVEQYRKTIGAEFMEKDVFLRSSKTMVKLML 63

Query: 275 TQPDKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNK 451
                + +    T   ++    +++ F    R +  ++  W + +  VC  I +VLC  K
Sbjct: 64  WDTAGQEVFNALTQAYYRGAGAAILTFSTVDRDSLMSIAGWKQRVESVCGCITMVLCQTK 123

Query: 452 VDIKDRKV 475
            D+    V
Sbjct: 124 FDLSHEAV 131


>UniRef50_Q24CD0 Cluster: Ras family protein; n=2; Tetrahymena
           thermophila SB210|Rep: Ras family protein - Tetrahymena
           thermophila SB210
          Length = 246

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K V +GD   GKT+ + R +   F+     T+G++      H +     L       + 
Sbjct: 34  YKLVFIGDQSVGKTSIINRFINDSFQGTQQPTVGIDFVAKTLHLDNKTIRLQLWDTAGQE 93

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKD 466
               L    I   +   +++D+T++ ++ +V  W  D VR    +G+ IVL  NK+D+ D
Sbjct: 94  RFRSLIPSYIRDSDAAIIVYDITNQASFASVNKW-LDYVREERGDGVLIVLLANKLDLPD 152

Query: 467 RK 472
           ++
Sbjct: 153 QR 154



 Score = 33.5 bits (73), Expect = 5.9
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    + ++  + + IR  +WDTAGQE+F  L   Y      AI
Sbjct: 67  GIDFVAKTLHLDNKTIRLQLWDTAGQERFRSLIPSYIRDSDAAI 110


>UniRef50_Q22BR3 Cluster: Ras family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Ras family protein - Tetrahymena
           thermophila SB210
          Length = 339

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 42/145 (28%), Positives = 76/145 (52%), Gaps = 13/145 (8%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL------MCG 274
           +K ++VGD   GKT+F+ R++ G   K  + T+GVE        + G+ ++      M G
Sbjct: 135 YKIIMVGDPRVGKTSFLIRYIKGVLPKSPMPTIGVEYLSKQVLLSGGEGIVKAQIWDMSG 194

Query: 275 TQPDKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLV-RVCEGIPIVLCGN 448
           ++  K S+ V      ++ +V +++ FD+T   ++KN   W +++     EGI I+L GN
Sbjct: 195 SEKYK-SISVAH----YRKSVGALLFFDLTELESFKNTKKWLQEIENHTEEGIKIMLIGN 249

Query: 449 KVDI-----KDRKVKAKTIVFHRKK 508
           K+D+       RKV  + ++   KK
Sbjct: 250 KLDLIEEDPSQRKVDKQEVIEFAKK 274


>UniRef50_A2EL65 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 192

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 38/138 (27%), Positives = 68/138 (49%), Gaps = 7/138 (5%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM---CG 274
           +P FK + VGD   GKT+ + R+    F  ++ +T+GV        T+ G   L      
Sbjct: 7   IPEFKIIFVGDASVGKTSVIMRYQHNLFTSEFQSTVGVAFVTKQVTTSFGAATLNIWDTA 66

Query: 275 TQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIP----IVLC 442
            Q   +SLV + + +        ++FDV    ++K++P W   L ++ +G+P    + L 
Sbjct: 67  GQERYKSLVPMYSRSA---TAAVIVFDVNDDQSFKSLPQW---LEQLKQGLPANCTLFLV 120

Query: 443 GNKVDIKDRKVKAKTIVF 496
           GNK+D++    +A+ I F
Sbjct: 121 GNKIDLQPDYERAEAIEF 138


>UniRef50_A2DXX7 Cluster: Small GTP-binding protein, putative; n=2;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 185

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 2/122 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K VLVGD   GKT  VKR  +G +     AT+G      +  T  G   L       +  
Sbjct: 2   KIVLVGDTQVGKTCLVKRLTSGTYTDNNPATIGAAFQNCIIQTEHGNVSLQIWDTAGQEK 61

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-RVCEGIPIVLCGNKVD-IKDR 469
              L        +V  + FD+T+  ++  +  W  +L  +    + +V+ GNK D I +R
Sbjct: 62  FRALAPMYYRSASVAILCFDLTNPTSFNGLEQWAMELTEKASYTLKLVVVGNKKDLIDER 121

Query: 470 KV 475
           KV
Sbjct: 122 KV 123


>UniRef50_Q96WY0 Cluster: GTP-binding protein rhoC precursor; n=19;
           Fungi/Metazoa group|Rep: GTP-binding protein rhoC
           precursor - Emericella nidulans (Aspergillus nidulans)
          Length = 230

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 34/121 (28%), Positives = 58/121 (47%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV-LMCGTQPDKR 292
           K V+VGDGG GKT  +  +  G F +KYV T+         H   G+ V L       + 
Sbjct: 21  KFVVVGDGGCGKTCLLISYSQGYFPEKYVPTVFENYITQTLHRRSGKTVELALWDTAGQE 80

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDIKDR 469
               L   +  + ++L V F +    + +NV   W+ +++  C   PI+L G K D++++
Sbjct: 81  EYDRLRPLSYPETDLLFVCFAIDCPASLENVMDKWYPEVLHFCPTTPIILVGLKSDLRNK 140

Query: 470 K 472
           +
Sbjct: 141 R 141


>UniRef50_P59190 Cluster: Ras-related protein Rab-15; n=40;
           Coelomata|Rep: Ras-related protein Rab-15 - Homo sapiens
           (Human)
          Length = 212

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 26/121 (21%), Positives = 57/121 (47%), Gaps = 1/121 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           F+ +L+GD G GKT  + R    EF   +++T+GV+        +  +  +       + 
Sbjct: 9   FRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKDR 469
               +      +   + +++D++S  +Y+++  W  D+     EG+  +L GNK D + +
Sbjct: 69  RYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQK 128

Query: 470 K 472
           +
Sbjct: 129 R 129


>UniRef50_UPI0000498A2D Cluster: Rab family GTPase; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: Rab family GTPase - Entamoeba
           histolytica HM-1:IMSS
          Length = 192

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 36/131 (27%), Positives = 65/131 (49%), Gaps = 4/131 (3%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLG-VEVHPLVFHTNRGQFVLM 268
           + ++    K ++VGD G GKT  + + L  +  K   AT+G V V  ++   N    V +
Sbjct: 4   LLEEKKPVKIIVVGDSGVGKTAIISKFLYKDVNKNESATIGNVHVKTILEKGNNKLDVAI 63

Query: 269 CGTQ-PDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVL 439
             T   +K S +V   D  F+      +++D+TS  ++ +  +W+  +  +    IPIVL
Sbjct: 64  WDTAGQEKYSSMV---DIFFRGAKGCVIVYDITSFQSFVDTTSWYTSIFDITHTSIPIVL 120

Query: 440 CGNKVDIKDRK 472
            GNK D+  ++
Sbjct: 121 VGNKKDLSSQR 131


>UniRef50_Q5NSZ3 Cluster: Small GTPase EhRabX23; n=1; Entamoeba
           histolytica|Rep: Small GTPase EhRabX23 - Entamoeba
           histolytica
          Length = 186

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 30/120 (25%), Positives = 56/120 (46%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           +D+   K V +GD   GKT  + R  +  F+  Y AT+G +    +   +  +  L    
Sbjct: 2   EDICRHKVVFIGDCSVGKTCIIGRFTSKNFDMSYDATIGTDFVTQIMDVDNKKIELQIWD 61

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVD 457
              +     L  + I   +V+ +++D++ + T+ N+ +W  D V   E   + + GNKVD
Sbjct: 62  TAGQERYRSLIPNYIRGASVVVIVYDISDKQTFNNIDHWF-DEVPDRESTLVYIVGNKVD 120


>UniRef50_Q551X0 Cluster: Rab GTPase; n=2; Dictyostelium
           discoideum|Rep: Rab GTPase - Dictyostelium discoideum
           AX4
          Length = 218

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 34/133 (25%), Positives = 62/133 (46%), Gaps = 1/133 (0%)
 Frame = +2

Query: 80  KTTKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF 259
           KT K   D   FK +LVGDG  GK++ ++R +   +   Y+ T          + N    
Sbjct: 2   KTAKT--DHYLFKILLVGDGNVGKSSMIERFIDDTWNDTYIVTRDQTFKEKYIYLNENTI 59

Query: 260 VLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIV 436
            L      ++  +V      I       ++FD T++ ++ N+  W  ++ R   E + ++
Sbjct: 60  KLQIWDM-ERLKMVYRSAHGII------IVFDFTNQDSFNNIRRWLSEIERYAHEEVNLL 112

Query: 437 LCGNKVDIKDRKV 475
           L GNK+D+ D++V
Sbjct: 113 LVGNKIDLYDQRV 125


>UniRef50_Q54E92 Cluster: Rab GTPase; n=1; Dictyostelium discoideum
           AX4|Rep: Rab GTPase - Dictyostelium discoideum AX4
          Length = 196

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 2/128 (1%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLT-GEFEKKYVATLGVEVHPLVFHTNRGQFVLMCG 274
           +D   FK +L+GD   GKT+ + R      F++  V    V+        +   F L   
Sbjct: 2   NDSDVFKILLIGDSAVGKTSLLLRFTDPNNFQETSVNMTSVDYKNKNITIDGRTFNLQIW 61

Query: 275 TQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNK 451
               +     + +      + + V +DVT ++TY NV  W +++ R    G+  VL GNK
Sbjct: 62  DTAGQERFRTITSSFYRGAHGVLVCYDVTDQLTYNNVGLWMQEIQRYGVLGVSRVLVGNK 121

Query: 452 VDIKDRKV 475
            D++DRK+
Sbjct: 122 CDLEDRKL 129


>UniRef50_Q4Q5N4 Cluster: Ras-related rab-4, putative; n=10;
           Trypanosomatidae|Rep: Ras-related rab-4, putative -
           Leishmania major
          Length = 203

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 35/134 (26%), Positives = 66/134 (49%), Gaps = 4/134 (2%)
 Frame = +2

Query: 92  MADD-MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL- 265
           MAD      K +++GD G GK+  + R +   F ++   T+G+E    +      +  L 
Sbjct: 1   MADKYQQLMKLIVIGDSGVGKSCLLHRFIEDTFSEEQTQTIGIEYGAKIIDVGGAKVKLQ 60

Query: 266 MCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLC 442
           +  T   +R   V  +        L +++DV +R +Y++VP W  D+ ++    + ++L 
Sbjct: 61  IWDTAGQERYKSVTRSYYRGATGCL-IVYDVNNRSSYESVPQWLSDVRQLAGSDVVVMLI 119

Query: 443 GNKVDI-KDRKVKA 481
           GNK+D+ K   V+A
Sbjct: 120 GNKMDLTKGNSVRA 133


>UniRef50_Q3SDN1 Cluster: Rab_B60 protein; n=2; Paramecium
           tetraurelia|Rep: Rab_B60 protein - Paramecium
           tetraurelia
          Length = 204

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 1/118 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD   GK+  + + L  +F  K+  T+GVE    V   +  Q  L       + 
Sbjct: 7   FKFIIIGDTAVGKSCILYQFLEQKFRVKHEMTVGVEFGAKVLDLDGKQIKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           +   +            +++DVT R +++NV  W ++  V   + + IVL GNKVD++
Sbjct: 67  TFKSITRQYYRSAAGAILVYDVTRRESFENVREWIKECQVHGTQDMVIVLVGNKVDLE 124


>UniRef50_Q22BI9 Cluster: Ras family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Ras family protein - Tetrahymena
           thermophila SB210
          Length = 214

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 31/132 (23%), Positives = 65/132 (49%), Gaps = 4/132 (3%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVL 265
           M +  P++K +LVGD   GKT    +++  ++ K    TLG E    P+     +     
Sbjct: 1   MEEPTPSYKIILVGDSSVGKTCIFSKYIKNQYPKNVEPTLGQEFKTKPITLPDGKLVKAN 60

Query: 266 MCGTQPDKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVL 439
           +  T   ++   ++ T+  ++  V +++ +D+T   ++ N+  W +D+    E  + I L
Sbjct: 61  LWDTAGQEKYRSLMATN--YRKAVGAILVYDITQTPSFTNLQQWLQDIKLQAEPDVVITL 118

Query: 440 CGNKVDIKDRKV 475
            GNK D++  ++
Sbjct: 119 IGNKTDLESSRM 130


>UniRef50_A2EDV7 Cluster: Small GTP-binding protein, putative; n=2;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 182

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 2/120 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGE-FEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           +P  K V +G+   GK+  +KR   G  F  +Y+ T+G++     F  +   F +     
Sbjct: 12  IPKVKIVSLGETRVGKSCLIKRFCEGNRFVTQYIPTIGIDYGARQFTVDNTSFYVHFWDM 71

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIP-IVLCGNKVD 457
               S   +  +     +   ++FD+T+R T+  +P W  +  +    +  IVLCGNK D
Sbjct: 72  SGDDSYFEVRNEFYGDTDGFLLVFDMTARETFTQLPRWLEEAKKYGADLSCIVLCGNKCD 131


>UniRef50_Q96E17 Cluster: Ras-related protein Rab-3C; n=133;
           Metazoa|Rep: Ras-related protein Rab-3C - Homo sapiens
           (Human)
          Length = 227

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 27/122 (22%), Positives = 56/122 (45%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++G+   GKT+F+ R+    F   +V+T+G++        N  +  L       + 
Sbjct: 31  FKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQE 90

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKDR 469
               + T          +M+D+T+  ++  V +W   +     +   ++L GNK D++D 
Sbjct: 91  RYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDE 150

Query: 470 KV 475
           +V
Sbjct: 151 RV 152


>UniRef50_P28186 Cluster: Ras-related protein ARA-3; n=42;
           Eukaryota|Rep: Ras-related protein ARA-3 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 216

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 27/120 (22%), Positives = 55/120 (45%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD G GK+  + R   G F   ++ T+G++        +  +  L       +  
Sbjct: 17  KLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQER 76

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDRK 472
              + T        + +++DVT   ++ N+ NW R++ +   + +  +L GNK D+ + K
Sbjct: 77  FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESK 136


>UniRef50_UPI0000D55E4E Cluster: PREDICTED: similar to Ras-related
           protein Rab-32; n=2; Endopterygota|Rep: PREDICTED:
           similar to Ras-related protein Rab-32 - Tribolium
           castaneum
          Length = 236

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 39/139 (28%), Positives = 68/139 (48%), Gaps = 8/139 (5%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLMCGTQPD 286
           FK +++GD G GKT+ ++R+  G F   Y  T+G +  +  L +  N    V +      
Sbjct: 34  FKILVIGDFGVGKTSIIRRYADGTFSSSYKITIGADFALKSLTWDKNTQVNVQLWDIAGH 93

Query: 287 KRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGN 448
           +R   +  T   ++  V  +++FD+T   T+K+V  W  DL   V +  G  +P+V+  N
Sbjct: 94  ERFGYL--TGVYYRYAVAAAIVFDLTRPETFKSVEKWLLDLRKKVHLPGGVPVPVVILAN 151

Query: 449 KVDIKDRKVKAKTIVFHRK 505
           K DI    +  + + F  K
Sbjct: 152 KGDITIATLPQEIVHFCEK 170


>UniRef50_Q4QDS9 Cluster: Ras-related protein rab-5, putative; n=7;
           Trypanosomatidae|Rep: Ras-related protein rab-5,
           putative - Leishmania major
          Length = 236

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 42/134 (31%), Positives = 65/134 (48%), Gaps = 5/134 (3%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCA--ISHVRRNLSSYVQKC 384
           G  +++ ++  + RA+++ +WDTAGQE+F  L   YY +G C   + +   N  S  +  
Sbjct: 68  GSATSAHALQQQMRALKYEIWDTAGQERFRSLAPIYY-RGACGALVVYDITNSESLKKAQ 126

Query: 385 T*LA*RFGPCM*RYPYCLV--RKQSGY*RQKS*GENYCFPQEKDL-QYYDISAKSNYNFE 555
           T +              LV  +K  G  RQ S  +      E+ L  +Y+ SAK N N E
Sbjct: 127 TWIKELRANADPSLIIVLVGNKKDLGSLRQVSFEDGQRLAAEEQLAAFYEASAKDNNNVE 186

Query: 556 KPFLWLARKLIGDG 597
           + FL LA KL+  G
Sbjct: 187 QVFLDLAAKLLDQG 200


>UniRef50_Q22045 Cluster: Putative uncharacterized protein rab-21;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein rab-21 - Caenorhabditis elegans
          Length = 207

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 31/122 (25%), Positives = 60/122 (49%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL+G+G  GK++ V R +  +F  K+++T+         +    Q  L       + 
Sbjct: 13  FKIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQASFQNKTVNVEDCQADLHIWDTAGQE 72

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIKD 466
               L        N + ++FD+T R +++ V NW  + ++ C G    I++ GNK+D+++
Sbjct: 73  KYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLE-IKTCLGNTAEILIVGNKIDLEE 131

Query: 467 RK 472
            +
Sbjct: 132 ER 133


>UniRef50_A7RGU7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 234

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFHTNRGQFVLMCGTQPDK 289
           FK VL+GD G GK+  + R+   EF     AT+GVE+ H  V    +     +  T   +
Sbjct: 19  FKIVLIGDSGVGKSNLLSRYTKNEFHLGSKATIGVELAHRNVEIEGKTVRAQIWDTAGQE 78

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  + +V+ +D+    ++ N+  W  +L     + + I+L GNK D+K
Sbjct: 79  RYRAI--TSAYYRGAMGAVLVYDIAKGTSFMNLNKWVEELRQHASDDLSIILIGNKSDLK 136


>UniRef50_A2G3Z0 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 199

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/117 (21%), Positives = 54/117 (46%), Gaps = 1/117 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K + +GD   GK+  + +++ G+F ++   T+G               VL       + +
Sbjct: 12  KMIFIGDSSVGKSCIINKYIKGQFSEEVEPTVGASFFSREMEIRGEHIVLNIWDTAGQEA 71

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGNKVDIK 463
              L        ++  V+FD+T   ++++V +W  D+ + C   + + +CGNK D++
Sbjct: 72  YRYLVPMYYRNADIAIVVFDLTKFESFQSVEHWVEDVRKSCNNEVSVFICGNKCDLE 128


>UniRef50_A2E8M0 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 197

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 34/125 (27%), Positives = 62/125 (49%), Gaps = 3/125 (2%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           TFK +LVGD   GKT+ V R     +      T+GVE  P   + ++ Q  L       +
Sbjct: 5   TFKFLLVGDQAVGKTSLVHRLCRNTYSDNSEETVGVEFMPYNLNIDKTQIKLQIWDTAGQ 64

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD-I 460
                L     F++ V + + F +   ++++++  W  D+  +C +   I+L G+K+D I
Sbjct: 65  EQYRSL-AKAYFRNAVGVVLFFAINDHLSFQHLETWLNDIRSLCHKNCRILLVGSKIDLI 123

Query: 461 KDRKV 475
           ++RK+
Sbjct: 124 EERKI 128


>UniRef50_A2E6D1 Cluster: Small GTP-binding protein, putative; n=6;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 192

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 1/125 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M + K VLVGD   GK+  + R + G F++   AT+G      V  T+ G   L      
Sbjct: 1   MRSLKVVLVGDTKVGKSCVLSRFVQGTFDRNMPATIGAAFLTKVITTSSGPVRLQLWDTA 60

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-RVCEGIPIVLCGNKVDI 460
            +     L        +V  +++DVT + +  ++ +W  ++  +    I  V+ GNK D+
Sbjct: 61  GQEKFRSLAPMYYRSSSVALMVYDVTQKESLDSLDDWASEIADKAPHNIKFVVIGNKCDM 120

Query: 461 KDRKV 475
            + +V
Sbjct: 121 TEERV 125


>UniRef50_A0EHT3 Cluster: Chromosome undetermined scaffold_98, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_98,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 208

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 32/123 (26%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++G+G  GKT+ +  +L G+  K    T+GVE    +         L +  T   +
Sbjct: 12  FKIIIIGNGSCGKTSILYHYLNGKQPKNVAQTVGVEFSSKMISIKGKSIKLQLWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSV-MFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           R   +    T ++  + ++ +FDVT+  +++N+  W +D        I I+ CGNK+D+ 
Sbjct: 72  RYRSIAR--TYYRGALGAICVFDVTNAESFQNMQQWIKDARDFARPDICIMACGNKIDLI 129

Query: 464 DRK 472
           +++
Sbjct: 130 EQR 132


>UniRef50_A0BIK0 Cluster: Chromosome undetermined scaffold_11, whole
           genome shotgun sequence; n=7; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_11,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 223

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 31/125 (24%), Positives = 64/125 (51%), Gaps = 5/125 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM---CGTQP 283
           FK +++GD G GK+  V + +  +  +++ AT+GVE    +   N     L       Q 
Sbjct: 8   FKYIIIGDTGVGKSCIVLQLIENQIRQEHDATIGVEFGAKIIKVNSMNIKLQIWDTAGQE 67

Query: 284 DKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVD 457
           + RS++     + ++  + +++ +D+T R ++ N+  W  ++       + I LCGNKVD
Sbjct: 68  NFRSII----RSYYRSAIGALLVYDITKRDSFHNLQRWMEEIKNNGNANMVITLCGNKVD 123

Query: 458 IKDRK 472
           ++  +
Sbjct: 124 LESER 128


>UniRef50_Q9H4E5 Cluster: Rho-related GTP-binding protein RhoJ
           precursor; n=43; Eukaryota|Rep: Rho-related GTP-binding
           protein RhoJ precursor - Homo sapiens (Human)
          Length = 214

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 33/138 (23%), Positives = 61/138 (44%), Gaps = 1/138 (0%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           D+    KCV+VGDG  GKT  +  +    F ++YV T+  + + +       Q +L    
Sbjct: 17  DEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTV-FDHYAVTVTVGGKQHLLGLYD 75

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
              +     L   +    +V  + F V +  +Y NV   W  +L      +P VL G ++
Sbjct: 76  TAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQI 135

Query: 455 DIKDRKVKAKTIVFHRKK 508
           D++D       +++ ++K
Sbjct: 136 DLRDDPKTLARLLYMKEK 153


>UniRef50_Q9HBH0 Cluster: Rho-related GTP-binding protein RhoF
           precursor; n=23; Euteleostomi|Rep: Rho-related
           GTP-binding protein RhoF precursor - Homo sapiens
           (Human)
          Length = 211

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 1/126 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDGG GKT+ +  +  G F + Y  ++  E +         +  L       +  
Sbjct: 21  KIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSV-FEKYTASVTVGSKEVTLNLYDTAGQED 79

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDIKDRK 472
              L   +    +++ + +DV +  +Y NV   W  ++   C GIP+VL G K D++  K
Sbjct: 80  YDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDK 139

Query: 473 VKAKTI 490
            + + +
Sbjct: 140 EQLRKL 145


>UniRef50_Q15907 Cluster: Ras-related protein Rab-11B; n=180;
           Eukaryota|Rep: Ras-related protein Rab-11B - Homo
           sapiens (Human)
          Length = 218

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE        +       +  T   +
Sbjct: 12  FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +D+   +TY+NV  W ++L       I I+L GNK D++
Sbjct: 72  RYRAI--TSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129


>UniRef50_P60763 Cluster: Ras-related C3 botulinum toxin substrate 3
           precursor; n=144; Eukaryota|Rep: Ras-related C3
           botulinum toxin substrate 3 precursor - Homo sapiens
           (Human)
          Length = 192

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 36/126 (28%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + S  +++NV   W+ ++   C   PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123


>UniRef50_Q5U518 Cluster: LOC495396 protein; n=4; Tetrapoda|Rep:
           LOC495396 protein - Xenopus laevis (African clawed frog)
          Length = 201

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 1/124 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+ GD   GKT  + R         Y++T+G++      H       L       +  
Sbjct: 14  KLVMTGDSDVGKTCILTRFAENTLPS-YISTVGIDFKTKTIHVAETALKLQIWDTAGQER 72

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDRK 472
              L            +++D+T+  +++N   W RD+ ++  E + +VL GNK D +D +
Sbjct: 73  FHTLSVSYFRGAQGFVLVYDITNPASFENTAVWMRDIKMKAGEEVEVVLLGNKCDREDER 132

Query: 473 VKAK 484
             AK
Sbjct: 133 EVAK 136


>UniRef50_Q6BGB2 Cluster: Ras-related RAB, putative; n=1; Paramecium
           tetraurelia|Rep: Ras-related RAB, putative - Paramecium
           tetraurelia
          Length = 210

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/121 (22%), Positives = 54/121 (44%), Gaps = 1/121 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G GKT  + R +   F     +T+GV+    V         L       +  
Sbjct: 10  KVIVIGDSGVGKTNLLLRFVNHTFSNDLKSTIGVQFFTKVISIKNEHIKLQLWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKDRK 472
              +        + + + FD+T + +  NV  W+ ++ +  +  + I+L GNK+D+  ++
Sbjct: 70  YRSISNSYYKGSHGVIICFDLTHQESLDNVVKWYEEVKQQADFNVKIILIGNKLDLSQQR 129

Query: 473 V 475
           V
Sbjct: 130 V 130


>UniRef50_Q5NT02 Cluster: Small GTPase EhRabX14; n=1; Entamoeba
           histolytica|Rep: Small GTPase EhRabX14 - Entamoeba
           histolytica
          Length = 353

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV-LMCGTQPDKR 292
           K +++G+ G GKT+ + +++   F   +V+T+GV+     F  +    V  +  T   +R
Sbjct: 158 KFIVLGESGVGKTSLITQYVDNLFTPVFVSTVGVDFKKKEFIVDGTHIVSQIWDTAGQER 217

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGNKVDIKDR 469
              ++         V+ V+ DVT R +++ +  W  DL    +     +LCGNK+D +DR
Sbjct: 218 FRTIIPQHYRGVCGVIFVV-DVTLRTSFEQISFWINDLKTKSDSKYSAILCGNKIDSEDR 276

Query: 470 KV 475
            V
Sbjct: 277 IV 278


>UniRef50_Q5NSZ7 Cluster: Small GTPase EhRabX19; n=3; Entamoeba
           histolytica|Rep: Small GTPase EhRabX19 - Entamoeba
           histolytica
          Length = 206

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 31/122 (25%), Positives = 62/122 (50%), Gaps = 1/122 (0%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           T K +L+G+ G GKT  ++R   G F+  Y A++GV++   +   N G+ V+M       
Sbjct: 5   TAKILLIGESGVGKTAMLQRLTQGTFDGIYTASVGVDLKTKIVEIN-GEEVIMEIWDAAG 63

Query: 290 RSLVVLETDTIFK-DNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKD 466
           +      T + ++  +   ++FD+T + +++ V  W  ++ +      I L GNK D+ +
Sbjct: 64  QERFRSVTQSYYRGTHAAVIVFDLTDKTSFEMVGYWLSEMEKDNNRPIIALVGNKSDLSN 123

Query: 467 RK 472
            +
Sbjct: 124 AR 125


>UniRef50_Q3SD64 Cluster: Rab_C34 protein; n=6; Paramecium
           tetraurelia|Rep: Rab_C34 protein - Paramecium
           tetraurelia
          Length = 210

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 3/124 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDKR 292
           K +++GD G GKT  + +    +F + Y AT+GV+    + +    +  L +  T   +R
Sbjct: 11  KVIVLGDSGVGKTNILTQFCDQKFSQNYTATIGVDFKIKILNVQDKKIKLQIWDTAGQER 70

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKD 466
              +  T T +K    +  ++ +  R ++ NV  W + ++    + +  +L GNK+D +D
Sbjct: 71  FRNI--TQTYYKGAFGIIFVYSLIDRNSFNNVEGWIKSILESTTDEVCSILVGNKLDSQD 128

Query: 467 RKVK 478
           R+V+
Sbjct: 129 RRVQ 132


>UniRef50_A7S7D9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 206

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 41/130 (31%), Positives = 63/130 (48%), Gaps = 5/130 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGE-FEKKYVATLGVEV-HPLVFHTNRGQFVLMCGTQPDK 289
           K  +VGD G GK+T +   LTGE F   YV T    +   LV   N  Q  L     P  
Sbjct: 11  KIAIVGDSGVGKST-IFALLTGERFSSYYVKTKERAIATKLVSLPNGTQEKLQLWDTPGA 69

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC--EGIPIVLCGNKVD-I 460
                  + +I     + ++FDV++  TY NV NW   +      + +PI++  NK+D +
Sbjct: 70  DETRTYTSHSIRDVKGVILVFDVSNEDTYLNVNNWIEVINTYSNEDSVPIIVIANKIDKV 129

Query: 461 KDRKVKAKTI 490
           ++RKVK + +
Sbjct: 130 RNRKVKEEQV 139


>UniRef50_A2E9I9 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 195

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +2

Query: 107 PTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPD 286
           P FK +++GD   GK++ V +     F+ +   T+G         T RG  +L       
Sbjct: 9   PEFKVIVLGDSAVGKSSIVLQISQETFDYQMDTTIGASHVQKRMETPRGPIILNIWDTAG 68

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIK 463
           +     L    +       + +DVT+R ++ ++ +W  D+ ++C   I I + GNK D++
Sbjct: 69  QERYRSLIPIYLRAAQAALICYDVTNRQSFLSLEHWIEDVQKICPSDIHIYIVGNKCDLE 128

Query: 464 D 466
           D
Sbjct: 129 D 129


>UniRef50_A0JBW4 Cluster: Small G Protein RAB; n=4; Oxymonadida|Rep:
           Small G Protein RAB - Symbiotic protist of
           Reticulitermes speratus
          Length = 206

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/115 (23%), Positives = 56/115 (48%), Gaps = 1/115 (0%)
 Frame = +2

Query: 131 GDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRSLVVLE 310
           GD G GKT+ + R +    E  Y  T+G++      + +     L       +     L 
Sbjct: 1   GDQGVGKTSILSRFMFDSLESNYPPTIGIDFLTKSMYLDHQTVRLQLWDTAGQEKFRSLL 60

Query: 311 TDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDRK 472
            + I       ++FDVT+R++++++  W  D+   V + + +++ GNK D++D++
Sbjct: 61  PNYIRDCAAAVIVFDVTNRLSFEHLEGWINDVRNGVNDNVVLMIVGNKTDLEDKR 115


>UniRef50_Q00246 Cluster: GTP-binding protein RHO4 precursor; n=4;
           Saccharomycetales|Rep: GTP-binding protein RHO4
           precursor - Saccharomyces cerevisiae (Baker's yeast)
          Length = 291

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 37/133 (27%), Positives = 61/133 (45%), Gaps = 4/133 (3%)
 Frame = +2

Query: 74  SHKTTKMADDMPTF--KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN 247
           S++  K  + +P +  K V+VGDG  GKT  +  ++ G F   Y+ T+  E +       
Sbjct: 58  SYEQMKRTNKLPDYHLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTI-FENYVTNIEGP 116

Query: 248 RGQFV-LMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCE 421
            GQ + L       +     L   +    +VL V + V S+ + KNV + W  ++   C 
Sbjct: 117 NGQIIELALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCP 176

Query: 422 GIPIVLCGNKVDI 460
             PI+L G K D+
Sbjct: 177 STPIMLVGLKSDL 189


>UniRef50_Q9UNT1 Cluster: Rab-like protein 2B; n=34; Eukaryota|Rep:
           Rab-like protein 2B - Homo sapiens (Human)
          Length = 228

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 32/137 (23%), Positives = 62/137 (45%)
 Frame = +2

Query: 95  ADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCG 274
           ADD    K + +GD   GK+  ++R L   F+ + ++T  + ++      +    ++   
Sbjct: 18  ADD--NVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFW 75

Query: 275 TQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKV 454
               +     +      K +   ++FDV  +VTY+N+  W+ +L      IP ++  NK+
Sbjct: 76  DTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKI 135

Query: 455 DIKDRKVKAKTIVFHRK 505
           D  D  V  K+  F +K
Sbjct: 136 D--DINVTQKSFNFAKK 150


>UniRef50_O14807 Cluster: Ras-related protein M-Ras precursor; n=18;
           Euteleostomi|Rep: Ras-related protein M-Ras precursor -
           Homo sapiens (Human)
          Length = 208

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 33/124 (26%), Positives = 61/124 (49%), Gaps = 2/124 (1%)
 Frame = +2

Query: 95  ADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCG 274
           +D++PT+K V+VGDGG GK+    +     F   Y  T+           N+   + +  
Sbjct: 8   SDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLD 67

Query: 275 TQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGN 448
           T   +    + E      D  L +++ VT + ++++V  +H+ ++RV   E  P++L  N
Sbjct: 68  TAGQEEFSAMREQYMRTGDGFL-IVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVAN 126

Query: 449 KVDI 460
           KVD+
Sbjct: 127 KVDL 130


>UniRef50_Q38912 Cluster: Rac-like GTP-binding protein ARAC3
           precursor; n=23; Eukaryota|Rep: Rac-like GTP-binding
           protein ARAC3 precursor - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 198

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 36/122 (29%), Positives = 55/122 (45%), Gaps = 3/122 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFVLMCGTQPDK 289
           KCV VGDG  GKT  +  + +  F   YV T+      + +V        +     Q D 
Sbjct: 8   KCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWDTAGQEDY 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
             L  L        +V  + F + S+ +Y+NV   W  +L     G+PI+L G K+D++D
Sbjct: 68  NRLRPLSYRGA---DVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKLDLRD 124

Query: 467 RK 472
            K
Sbjct: 125 DK 126


>UniRef50_P48554 Cluster: Ras-related protein Rac2 precursor; n=73;
           Fungi/Metazoa group|Rep: Ras-related protein Rac2
           precursor - Drosophila melanogaster (Fruit fly)
          Length = 192

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + +  +++NV   W  ++   C  +PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123


>UniRef50_Q96AH8 Cluster: Ras-related protein Rab-7b; n=21;
           Tetrapoda|Rep: Ras-related protein Rab-7b - Homo sapiens
           (Human)
          Length = 199

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 38/128 (29%), Positives = 65/128 (50%), Gaps = 8/128 (6%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVF---HTNRGQFVLMCGTQPD 286
           K ++VG  G GKT+ + +++   F ++Y  TLG  +   +     T     +   G Q  
Sbjct: 10  KLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQER 69

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRD----LVRVCEGIPIVLCGNK 451
            RS+V     T +K +   ++ FDVT   +++ +  W  D    +V + +  P+VL GNK
Sbjct: 70  FRSMV----STFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNK 125

Query: 452 VDIKDRKV 475
           +D+ DRKV
Sbjct: 126 IDLADRKV 133



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 34/141 (24%), Positives = 64/141 (45%), Gaps = 8/141 (5%)
 Frame = +1

Query: 190 EKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQ-CAISHVRRNLS 366
           E+ +   G    S  I      ++  +WDT GQE+F  +   +Y     C ++    +L 
Sbjct: 35  EEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLE 94

Query: 367 SY----VQKCT*LA*RFGPCM*RYPYCLVRKQSGY*RQK---S*GENYCFPQEKDLQYYD 525
           S+    + +   LA +  P    YP  L+  +     +K      + +C  +EKD+ Y++
Sbjct: 95  SFEALDIWRGDVLA-KIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWC--REKDIPYFE 151

Query: 526 ISAKSNYNFEKPFLWLARKLI 588
           +SAK++ N  + F  LA + +
Sbjct: 152 VSAKNDINVVQAFEMLASRAL 172


>UniRef50_Q9NRW1 Cluster: Ras-related protein Rab-6B; n=171;
           Eukaryota|Rep: Ras-related protein Rab-6B - Homo sapiens
           (Human)
          Length = 208

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 33/123 (26%), Positives = 64/123 (52%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           FK V +G+   GKT+ + R +   F+  Y AT+G++ +   ++  +R   + +  T   +
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIK 463
           R   ++ +  I    V  V++D+T+  +++    W  D VR   G  + I+L GNK D+ 
Sbjct: 74  RFRSLIPS-YIRDSTVAVVVYDITNLNSFQQTSKWIDD-VRTERGSDVIIMLVGNKTDLA 131

Query: 464 DRK 472
           D++
Sbjct: 132 DKR 134


>UniRef50_Q9UL25 Cluster: Ras-related protein Rab-21; n=35;
           Eukaryota|Rep: Ras-related protein Rab-21 - Homo sapiens
           (Human)
          Length = 225

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 36/125 (28%), Positives = 59/125 (47%), Gaps = 3/125 (2%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           +FK VL+G+G  GKT+ V R+   +F  K++ TL         +    +  L       +
Sbjct: 19  SFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQ 78

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLC--GNKVDI- 460
                L        N   +++D+T   +++ V NW ++L R   G  I LC  GNK+D+ 
Sbjct: 79  ERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKEL-RKMLGNEICLCIVGNKIDLE 137

Query: 461 KDRKV 475
           K+R V
Sbjct: 138 KERHV 142


>UniRef50_UPI0000F2E154 Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 294

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 36/126 (28%), Positives = 55/126 (43%), Gaps = 6/126 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVK--RHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLMCGTQP 283
           +C+L+GD   GK+T  +  R     F+K Y  T GV+  V  L          L      
Sbjct: 115 RCLLLGDATVGKSTLAQMFRSDGAHFQKNYTLTTGVDLLVKSLAVPDTNDSVELFIFDSA 174

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVD 457
            K     +        N+L ++FDVT+  ++ N   W   +    +G  +P VL GNK D
Sbjct: 175 GKELFSEMLEKLWEHPNLLCLVFDVTNEQSFSNCAKWLERIRSQLQGTCLPGVLVGNKTD 234

Query: 458 IKDRKV 475
           +  R+V
Sbjct: 235 LAGRRV 240


>UniRef50_Q7QWP4 Cluster: GLP_26_45744_45106; n=3; Giardia
           intestinalis|Rep: GLP_26_45744_45106 - Giardia lamblia
           ATCC 50803
          Length = 212

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 32/122 (26%), Positives = 61/122 (50%), Gaps = 4/122 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLMCGTQPD 286
           FK +++GD G GK+  + R     F   Y+ T+GV+  V  L    N  +  +      +
Sbjct: 10  FKLLVIGDSGVGKSALLLRLCDKIFNASYITTIGVDFKVKSLNIKDNTVKLQIWDTAGQE 69

Query: 287 KRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLV-RVCEGIPIVLCGNKVDI 460
           K   +   T T ++  + + V++DVTSR ++ NV  W +++     + +   + G+K D+
Sbjct: 70  KFRTI---TSTYYRGAHGIMVVYDVTSRESFDNVKTWLKEIANNASDNVVKYIIGSKKDL 126

Query: 461 KD 466
           +D
Sbjct: 127 RD 128


>UniRef50_Q5NT37 Cluster: Small GTPase EhRabC7; n=3; Entamoeba
           histolytica|Rep: Small GTPase EhRabC7 - Entamoeba
           histolytica
          Length = 195

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 29/128 (22%), Positives = 57/128 (44%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M   + TFK +++G+   GKT  ++R    +F+  Y++T+G++ +      N     L  
Sbjct: 1   MKGSIYTFKVLVIGESSVGKTAIMERFCENQFKGDYMSTIGMDFNTKTISVNGQTIKLKI 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNK 451
                +     + T          V++DV ++ +++ +  W  +  R      IV+ GNK
Sbjct: 61  WDTAGQERFRNVTTSYYRGTQGCLVVYDVCNKGSFEMLDYWIEEYKREQPNSEIVIVGNK 120

Query: 452 VDIKDRKV 475
           +D   R V
Sbjct: 121 IDSTQRDV 128


>UniRef50_Q22ZG1 Cluster: Ras family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Ras family protein - Tetrahymena
           thermophila SB210
          Length = 212

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFHTNRGQFVLMCGTQPDK 289
           +K +++G+  TGKT  +   L G+F+K    T+GVE    +V   N+   + +  T   +
Sbjct: 11  YKFIIIGNTSTGKTCTLHNFLEGKFKKNSSYTIGVEFGSKVVTAKNKNIKLQIWDTAGQE 70

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGNKVDIK 463
           R   V    T ++  +   +++D+T   ++ +V  W  D   +    I I +CGNK D+K
Sbjct: 71  RFKSVAR--TYYRGGLGAIIVYDITDVESFHSVKQWIADARELARSDICIAVCGNKCDLK 128

Query: 464 DRK 472
           + +
Sbjct: 129 EER 131


>UniRef50_A2EVM8 Cluster: Ras family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 216

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 39/129 (30%), Positives = 63/129 (48%), Gaps = 4/129 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-QPDK 289
           FK V++G  G+GKT  V + +  +F +K   T+GV+  P  +     +FVL         
Sbjct: 9   FKVVVIGAPGSGKTAIVDQLIEKKFNEKPKTTVGVDYRP--YRVEVEEFVLQLELWDTAG 66

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI- 460
           +        T F+D V  V+ FDVTS+ ++  +  W      + +    I+L GNKVD+ 
Sbjct: 67  QEAYKAVAKTYFRDAVGCVLVFDVTSQNSFDELSFWLTQYRELADPKSVIILVGNKVDLA 126

Query: 461 KDRKVKAKT 487
            DR +  +T
Sbjct: 127 NDRVISQET 135


>UniRef50_A2EMB9 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 186

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 27/116 (23%), Positives = 53/116 (45%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK V++GD G GKT+ ++  +   F+ + + T+  +V   V + +  Q  L       + 
Sbjct: 3   FKVVILGDSGVGKTSLIEMRMQNSFDSEKMPTIKPDVSTCVENVDGKQIELNIWDTAGQE 62

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
               L T  +   NV  ++ D+T+ ++  N+  W   L        +++  NK D+
Sbjct: 63  QYFSLATMFVRDANVAILVGDITNEISIDNIGKWEHLLKETQPNAEVIVAINKSDL 118


>UniRef50_A2EKW5 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 198

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 35/123 (28%), Positives = 59/123 (47%), Gaps = 3/123 (2%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPD 286
           + K VL+GD   GKT+ +K  +  +   K +AT+G          +  Q+ + +  T  D
Sbjct: 6   SIKVVLLGDSSCGKTSLIKAWMLEDNPTKTLATVGASFRRQFVDIDDIQYCIDIWDTAGD 65

Query: 287 KR--SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
           ++  S + L   + F      ++FDVT   T+ +V  W   L +    +P +L GNK D+
Sbjct: 66  EKYSSTIPLYCRSAFG---AFIVFDVTRPETFNSVSKWIEILKQSAGDVPYILIGNKADL 122

Query: 461 KDR 469
            DR
Sbjct: 123 VDR 125


>UniRef50_P25766 Cluster: Ras-related protein RGP1; n=23;
           Magnoliophyta|Rep: Ras-related protein RGP1 - Oryza
           sativa subsp. japonica (Rice)
          Length = 226

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 3/124 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN-RGQFVLMCGTQPDK 289
           FK VL+GD   GK+  + R    EF     AT+GVE      H + R     +  T   +
Sbjct: 19  FKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTLHIDARTVKAQIWDTAGQE 78

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   V  T   ++  V   +++D+T R ++ +V  W  +L     + I I+L GNK D+ 
Sbjct: 79  RYRAV--TSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDLG 136

Query: 464 DRKV 475
             +V
Sbjct: 137 TLRV 140


>UniRef50_Q4UB16 Cluster: Ras-related protein Rab-1; n=19;
           Eukaryota|Rep: Ras-related protein Rab-1 - Theileria
           annulata
          Length = 220

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 30/124 (24%), Positives = 64/124 (51%), Gaps = 3/124 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++GD GTGK++ + R     + + Y++T+GV+        +     L +  T   +
Sbjct: 8   FKIIVIGDSGTGKSSLLLRFADNTYSESYMSTIGVDFKIKTVKIDNTTIKLQIWDTAGQE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVR-VCEGIPIVLCGNKVDIK 463
           R   +  T       ++ V +DVT+++++ ++   W +D+ +     +  +L GNK+D+ 
Sbjct: 68  RFRTITSTYYRGAHGIICV-YDVTNKLSFDHITETWLQDIDKYATSNVCKLLIGNKIDLV 126

Query: 464 DRKV 475
           D +V
Sbjct: 127 DSRV 130


>UniRef50_UPI00005848D3 Cluster: PREDICTED: similar to GTPase Rab8b;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to GTPase Rab8b - Strongylocentrotus purpuratus
          Length = 233

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 32/130 (24%), Positives = 63/130 (48%), Gaps = 2/130 (1%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           +FK +++GD   GKT+F+       F++    T+G+++   + + +  +  L+      +
Sbjct: 33  SFKILVIGDTCVGKTSFINMFCEHVFKENGTGTIGMDLKKNIINVDGKKIRLLVWDTAGQ 92

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDI-K 463
                L T        + +++DVT   ++ +V +W  D+ R V   I  VL GNK D  +
Sbjct: 93  ERFRTLTTAYYRGAMGIIILYDVTRETSFDHVTSWLDDIARNVSPDICKVLVGNKSDFTR 152

Query: 464 DRKVKAKTIV 493
            R+V +K  +
Sbjct: 153 ARRVPSKRAI 162



 Score = 34.3 bits (75), Expect = 3.4
 Identities = 22/67 (32%), Positives = 31/67 (46%)
 Frame = +1

Query: 121 CIGRRWWYWQNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFG 300
           C+G+  +   N  C+  F    +E      G     + I  + + IR  VWDTAGQE+F 
Sbjct: 43  CVGKTSFI--NMFCEHVF----KENGTGTIGMDLKKNIINVDGKKIRLLVWDTAGQERFR 96

Query: 301 GLRDGYY 321
            L   YY
Sbjct: 97  TLTTAYY 103


>UniRef50_Q4DUK2 Cluster: Guanin nucleotide-binding protein,
           putative; n=2; Trypanosoma cruzi|Rep: Guanin
           nucleotide-binding protein, putative - Trypanosoma cruzi
          Length = 340

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 37/147 (25%), Positives = 68/147 (46%), Gaps = 9/147 (6%)
 Frame = +2

Query: 71  NSHKTTKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEF--EKK---YVATLGVEVHPLV 235
           N+  T+     +P +K ++VGD G GK++ + R     F  EKK   ++ +  VE+    
Sbjct: 49  NATVTSSQHCAIPKYKVIIVGDSGVGKSSLLSRFANSSFNLEKKATVFLESASVELEVPA 108

Query: 236 FHTNRGQFVL--MCGTQPDKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL 406
                 + V+  +C T   +R   +    T F+  V +++ +DVT   T   +  W+  +
Sbjct: 109 ARVGEKERVIAQLCDTAGQERCAAI--RSTFFRGAVGALLVYDVTQEETLLRLSMWYAHV 166

Query: 407 VR-VCEGIPIVLCGNKVDIKDRKVKAK 484
            R  CE    ++ GNK D+   +  +K
Sbjct: 167 RRYACEDCVCIVLGNKTDLHSSQFLSK 193


>UniRef50_A7SHS5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 241

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 29/127 (22%), Positives = 61/127 (48%), Gaps = 6/127 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++G+ G GKT+ ++R+  G F   Y  T+GV+    + H +    + +        
Sbjct: 17  YKVLVIGEYGVGKTSIIRRYTEGYFSPNYKLTIGVDFALKIIHWDEKTKINLQLWDVAGH 76

Query: 293 SLVVLETDTIFKDNVLS-VMFDVTSRVTYKNVPNWHRDLVRVC-----EGIPIVLCGNKV 454
                 T   +K  + + ++FD++   T+  +  W+RD+ +         IP+++  NK 
Sbjct: 77  ERFGHMTRVYYKYAIAAIIVFDLSRSATFDAILKWYRDVNQKVMLTNENPIPVIILANKC 136

Query: 455 DIKDRKV 475
           D++D  V
Sbjct: 137 DLEDYPV 143


>UniRef50_A2FBG0 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 160

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 30/127 (23%), Positives = 61/127 (48%), Gaps = 2/127 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           + + VGD G GKT+ +    TG++E   V T+G     + + +N G+ +         + 
Sbjct: 11  RIIFVGDSGVGKTSIINYAKTGKYEANSVPTIGAGTTTMSYRSN-GKLIEYQLWDTAGQE 69

Query: 296 LVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKDR 469
           +        F+  V +++ F +T   +++N+  W   LV   +  +  +L GNK+D+ + 
Sbjct: 70  IYRNIVPIYFRGAVGAIITFSMTDPTSFQNIQEWIDSLVAHADPDVKYLLVGNKIDVHEL 129

Query: 470 KVKAKTI 490
           KV  + +
Sbjct: 130 KVSEEDV 136


>UniRef50_A2DLU9 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 195

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 30/126 (23%), Positives = 58/126 (46%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +LVG  G GKT+ VK   +G FE++Y  T+G E +  V      +  +       +  
Sbjct: 3   KVILVGSCGVGKTSIVKVITSGLFEEEYNPTVGAEYNLKVLGPPGEEVKIQFWDTAGEEK 62

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRKV 475
              +         +  V+F +  + ++  + +W   +    EG+ +++ GNK D +D+ V
Sbjct: 63  FQAMAPIYYHDAKIGLVVFAMDDQYSFDRLISWINSINDNTEGVRLIVVGNKSDKEDKAV 122

Query: 476 KAKTIV 493
           K +  +
Sbjct: 123 KTEQAI 128


>UniRef50_Q8SS52 Cluster: RAS-RELATED GTP-BINDING PROTEIN RAB11;
           n=1; Encephalitozoon cuniculi|Rep: RAS-RELATED
           GTP-BINDING PROTEIN RAB11 - Encephalitozoon cuniculi
          Length = 238

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 3/124 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL+GD   GKT  + +    EF K   AT+GVE   + F                + 
Sbjct: 39  FKIVLIGDSAVGKTNLLSKLTRNEFHKDSKATIGVEFGTITFKIGEDVVKAQIWDTAGQE 98

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEG-IPIVLCGNKVDIK- 463
               +        +  ++++D+T++ + K     W + L       IPIVL GNK D++ 
Sbjct: 99  RYQAIVQAYYRGTSGAAIVYDITNKDSLKKATGLWLKQLRDFSPNEIPIVLIGNKKDLES 158

Query: 464 DRKV 475
           DR+V
Sbjct: 159 DREV 162


>UniRef50_P17610 Cluster: GTP-binding protein ypt3; n=100;
           Eukaryota|Rep: GTP-binding protein ypt3 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 214

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 3/119 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE     +   N+     +  T   +
Sbjct: 11  FKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGVEFATRNIVLDNKKIKAQIWDTAGQE 70

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI 460
           R   +  T   ++  V   +++D+T + ++ NV  W ++L    +  I I+L GNK D+
Sbjct: 71  RYRAI--TSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADSNIVIMLVGNKTDL 127


>UniRef50_P33153 Cluster: GTP-binding RHO-like protein precursor;
           n=6; Saccharomycetales|Rep: GTP-binding RHO-like protein
           precursor - Candida albicans (Yeast)
          Length = 346

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 35/116 (30%), Positives = 52/116 (44%), Gaps = 1/116 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDGG GKT  +  +   +F   YV T+       V   N     L       +  
Sbjct: 77  KIVVVGDGGCGKTCLLLAYTQNKFPSIYVPTVFENYVTAVQSPNGKTVELALWDTAGQEE 136

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDI 460
              L   +    ++L V F V + V+ +NV + W  ++   C GIPI+L G K D+
Sbjct: 137 YDRLRPLSYPDVDILLVCFAVDNEVSLENVKDMWFPEVNHYCPGIPIILVGTKSDL 192


>UniRef50_P28188 Cluster: Ras-related protein ARA-5; n=106;
           Eukaryota|Rep: Ras-related protein ARA-5 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 258

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 29/136 (21%), Positives = 62/136 (45%), Gaps = 2/136 (1%)
 Frame = +2

Query: 71  NSHKTTKMADDMP-TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN 247
           +SH++  M  +    FK +L+GD G GK+  + R     + + Y++T+GV+        +
Sbjct: 49  SSHRSKTMNPEYDYLFKLLLIGDSGVGKSCLLLRFSDDSYVESYISTIGVDFKIRTVEQD 108

Query: 248 RGQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEG 424
                L       +     + +      + + +++DVT   ++ NV  W  ++ R   + 
Sbjct: 109 GKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDN 168

Query: 425 IPIVLCGNKVDIKDRK 472
           +  +L GNK D+ + +
Sbjct: 169 VNKLLVGNKSDLTENR 184


>UniRef50_Q7YWU5 Cluster: Putative uncharacterized protein glo-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein glo-1 - Caenorhabditis elegans
          Length = 212

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 32/130 (24%), Positives = 60/130 (46%), Gaps = 6/130 (4%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           +D  ++K +++GD G GKT+ ++R +   F   Y  T+GV+    +   +    V +   
Sbjct: 7   NDKISYKVLVIGDPGVGKTSIIRRFVHNVFSSNYKTTIGVDFALKILPVDENTVVHLQIW 66

Query: 278 QPDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVL 439
               +    + T   +KD +   ++ D T   T +    W  DL   V + +G  +P +L
Sbjct: 67  DISGQDRYGVMTRVYYKDAHAAIIVLDSTRERTIEGALRWKTDLDQKVTLADGSPVPAIL 126

Query: 440 CGNKVDIKDR 469
             NK DI ++
Sbjct: 127 LANKCDIDNK 136


>UniRef50_Q583N0 Cluster: Small GTP-binding protein Rab28, putative;
           n=3; Trypanosoma|Rep: Small GTP-binding protein Rab28,
           putative - Trypanosoma brucei
          Length = 240

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 42/156 (26%), Positives = 74/156 (47%), Gaps = 22/156 (14%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM----CGTQ 280
           +K ++VGDG  GKT+ ++R+   ++   Y  T+G++ +         Q V M     G Q
Sbjct: 15  YKVIVVGDGAVGKTSLIRRYCVADYGSNYKQTIGLDFYSKEVLLPGKQDVKMEIWDIGGQ 74

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWH---RDLV------RVCEGIP- 430
               +++    + I   + +  ++DVT++ ++KN+ +WH   RD +         EG   
Sbjct: 75  QIGGTMI---DNYIMGAHAIFFVYDVTNKDSFKNIEDWHSCVRDSLAKHARETAEEGAAA 131

Query: 431 ----IVLCGNKVDIKDRKVK----AKTIVFHRKKIC 514
               IVL GNK D+ +R+V      K    HR + C
Sbjct: 132 VEPLIVLVGNKADLPNRQVSDADHMKMAEMHRMESC 167


>UniRef50_Q4Q595 Cluster: Rab11B GTPase, putative; n=4;
           Trypanosomatidae|Rep: Rab11B GTPase, putative -
           Leishmania major
          Length = 224

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 33/131 (25%), Positives = 58/131 (44%), Gaps = 1/131 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV-LMCGTQPDKR 292
           K +L+GD   GK+  V+R L   +    ++T  + ++   F T  G+ V +       + 
Sbjct: 34  KLILLGDSAVGKSKLVERFLMQRYIPVQMSTYALTLYRYDFVTEDGEEVDVDIWDTAGQE 93

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRK 472
               +        +   ++FD T + TYKN+  W  ++    E IP ++  NK+D  D  
Sbjct: 94  RFATVHPSYYHDAHACILVFDSTRKATYKNLEKWLSEMRVYREHIPCLVACNKID-TDPS 152

Query: 473 VKAKTIVFHRK 505
           V  K+  F  K
Sbjct: 153 VTTKSFAFAEK 163


>UniRef50_A2G1T1 Cluster: Small GTP-binding protein, putative; n=2;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 191

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 31/126 (24%), Positives = 54/126 (42%), Gaps = 1/126 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V +G  G GKT+ + R +T EF  +Y  T+GV+              L       +  
Sbjct: 6   KVVFLGSAGVGKTSLLNRLMTDEFSNQYNTTIGVDFFTKPVQVQGRTVTLQIWDTAGQER 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKDRK 472
              L    I   +V  +++DV+   ++     W+  ++         VL GNK+D+ +R+
Sbjct: 66  FKSLMPSYIRDSSVAVIVYDVSDEKSFDEAQEWYETVMHERGNEAKCVLVGNKIDL-ERR 124

Query: 473 VKAKTI 490
           V  K +
Sbjct: 125 VDLKHV 130


>UniRef50_A2DZJ4 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 193

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 37/133 (27%), Positives = 65/133 (48%), Gaps = 5/133 (3%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLM 268
           M +     K V+VGD   GK++ V R+  G+       TLG   +   VF++ +   + M
Sbjct: 1   MEEQKTIVKVVIVGDADVGKSSIVIRYAEGQHNPNISPTLGAACLEKEVFYSGQTYVLSM 60

Query: 269 CGT--QPDKRSLVVLETDTIFKDNVLS-VMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIV 436
             T  Q   R+LV +     F+++ ++ ++ DVT+     +   W+  +   C E IPI+
Sbjct: 61  WDTAGQEAYRNLVPM----YFRNSQIAIIVIDVTTSKLVSSFEYWYSLIQENCEENIPIL 116

Query: 437 LCGNKVDIKDRKV 475
           L  NK+D  D ++
Sbjct: 117 LAANKIDKTDERI 129


>UniRef50_A2DSZ8 Cluster: Small GTP-binding protein, putative; n=3;
           Trichomonas vaginalis|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 202

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 7/128 (5%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQ--FVLMCGTQP 283
           TFK V++GD G GKTT + + + GEF   + AT+G +    +  T  GQ  ++ +  T  
Sbjct: 9   TFKVVVLGDTGVGKTTLIHQFVNGEFIADFKATIGADFSSKIM-TVDGQRIYIQIWDTAG 67

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-----GIPIVLCGN 448
            +R   V  T     D  + +++D T   ++  +  W  DL    +       PI++  N
Sbjct: 68  QERFHAVGATFYRGTDACI-LVYDCTQVESFHRLSFWREDLFTKSQMEPDPKFPIIIFSN 126

Query: 449 KVDIKDRK 472
           K D++ +K
Sbjct: 127 KSDLESQK 134


>UniRef50_Q9BW83 Cluster: Putative GTP-binding protein RAY-like;
           n=7; Eutheria|Rep: Putative GTP-binding protein RAY-like
           - Homo sapiens (Human)
          Length = 186

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 38/125 (30%), Positives = 57/125 (45%), Gaps = 6/125 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVK--RHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPD 286
           KC+L GD   GKT   +  R     F+K Y  T G++ V   V   + G  V +      
Sbjct: 7   KCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSA 66

Query: 287 KRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGI--PIVLCGNKVD 457
            + L     D +++  NVL +++DVT+  ++ N   W         GI  P VL GNK D
Sbjct: 67  GKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTD 126

Query: 458 IKDRK 472
           +  R+
Sbjct: 127 LAGRR 131


>UniRef50_UPI00006CB8C7 Cluster: Ras family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Ras family protein -
           Tetrahymena thermophila SB210
          Length = 250

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 30/122 (24%), Positives = 55/122 (45%), Gaps = 1/122 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +LVGD   GKT  + R+    ++  ++ T+GV+        ++ Q  L+      +  
Sbjct: 18  KILLVGDSAVGKTNIMLRYCDHGYKTAHMVTVGVDFKMKTIKVDQKQLKLIIWDTAGQEK 77

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDRK 472
              +          + V++ +T R ++ NV NW + +   V + I I L GNK D  + +
Sbjct: 78  YQAMAQSIYNGAQAVIVVYSITDRNSFMNVRNWIKQISEHVPDQIIITLVGNKCDESENQ 137

Query: 473 VK 478
            K
Sbjct: 138 RK 139


>UniRef50_Q4SZ30 Cluster: Chromosome undetermined SCAF11859, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF11859,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 447

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 25/122 (20%), Positives = 56/122 (45%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++G+   GKT+F+ R+    F   +V+T+G++      + N  +  L       + 
Sbjct: 22  FKLLIIGNSSVGKTSFLFRYADDSFSNSFVSTVGIDFKVKTVYRNDKRIKLQIWDTAGQE 81

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKDR 469
               + T          +M+D+T+  ++  V +W   +     +   +++ GNK D+ + 
Sbjct: 82  RYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVIMVGNKCDMAEE 141

Query: 470 KV 475
           +V
Sbjct: 142 RV 143


>UniRef50_Q6AW59 Cluster: EhRabC2 protein; n=2; Entamoeba
           histolytica|Rep: EhRabC2 protein - Entamoeba histolytica
          Length = 206

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 26/125 (20%), Positives = 58/125 (46%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           TFK +++G+   GKT  ++R+   EF  + ++T+GV+    + +       L       +
Sbjct: 14  TFKILIIGESAVGKTAILERYCENEFHDELISTIGVDFKSRIINYQGKTVKLQLWDTAGQ 73

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDR 469
                + +      +   +++DVT   +++ +  W  +L        I++ GNK+D +D 
Sbjct: 74  ERFRNITSSYYRGTHGCLIVYDVTDITSFEKITYWINELNDCSIKPEILVVGNKIDSEDA 133

Query: 470 KVKAK 484
            V ++
Sbjct: 134 VVTSE 138


>UniRef50_Q3SDT9 Cluster: Rab_C89 protein; n=1; Paramecium
           tetraurelia|Rep: Rab_C89 protein - Paramecium
           tetraurelia
          Length = 315

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 5/117 (4%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRSLV 301
           V++GD G GKTT  K+  TG+F  +Y +T+GV+V          Q+ L       +    
Sbjct: 12  VIIGDQGAGKTTLFKQVTTGQFTPEYYSTIGVDVGIKEISIEGFQYHLQFWDTSGQERFQ 71

Query: 302 VLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-----EGIPIVLCGNKVD 457
            +      +     +++D+     YKNV +W +     C     +  P V+ G  +D
Sbjct: 72  AIIQSYYRRAECCVIVYDLIDPEDYKNVKHWMKQFSFRCDLDPEQKFPFVIVGTHLD 128


>UniRef50_Q3SDP9 Cluster: Rab_C29 protein; n=2;
           Oligohymenophorea|Rep: Rab_C29 protein - Paramecium
           tetraurelia
          Length = 216

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 38/128 (29%), Positives = 61/128 (47%), Gaps = 7/128 (5%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN----RGQFVLMCGTQ 280
           FK VL+GD   GK+  + R    +F      T+GVE        N    + Q    CG Q
Sbjct: 13  FKIVLIGDSSVGKSNILSRFTKRQFNFDSQPTIGVEFATRSLTENGKIIQAQIWDTCG-Q 71

Query: 281 PDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKV 454
              +S+    T   ++  V   +++D+T + T++N+  W ++L    E  +  +L GNK 
Sbjct: 72  ERYKSI----TSAYYRGAVGAMLIYDITKQKTFENIEKWIQELKEYAETNVVAMLIGNKA 127

Query: 455 DIK-DRKV 475
           D+K  RKV
Sbjct: 128 DLKAQRKV 135


>UniRef50_A2E8Q4 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 195

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 40/125 (32%), Positives = 62/125 (49%), Gaps = 5/125 (4%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGT 277
           D  T+K  L+GD   GKT+ V R  +  F      T+GV    + + + +R   + +  T
Sbjct: 8   DGETYKVPLIGDANVGKTSIVGRFTSERFTGNTTPTVGVSTAQVTIKNKDRDVKLTIWDT 67

Query: 278 --QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGI--PIVLCG 445
             Q   RSLV L T      ++L ++FD+T+  ++    +W    VR   GI  PI LC 
Sbjct: 68  AGQEKFRSLVPLYTR---HASLLILVFDITNEESFNGCEDWVTK-VRGDMGIKCPIFLCA 123

Query: 446 NKVDI 460
           NK+D+
Sbjct: 124 NKIDL 128


>UniRef50_A0BG93 Cluster: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 191

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 31/136 (22%), Positives = 59/136 (43%), Gaps = 2/136 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K VL GD   GKT+F  R       ++  +T+GVE              L         
Sbjct: 7   YKVVLAGDSKVGKTSFFLRATKNITPQQPKSTIGVEYASKQIVYKEQLVTLKIWDTAGSE 66

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKDR 469
               + ++   +     + FD+T   TY+N+ NW +D+     + + I++ GNK+D+ + 
Sbjct: 67  KYKSVTSNHFRQSQGALIFFDLTDLYTYENIQNWLKDIQNYADDSVTIIIVGNKLDLVNE 126

Query: 470 KVKAKTIVFHR-KKIC 514
               + I   + +++C
Sbjct: 127 AQNLRCIPLEKAQQMC 142



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    S  I Y+ + +   +WDTAG EK+  +   ++ Q Q A+
Sbjct: 40  GVEYASKQIVYKEQLVTLKIWDTAGSEKYKSVTSNHFRQSQGAL 83


>UniRef50_O00212 Cluster: Rho-related GTP-binding protein RhoD
           precursor; n=14; Eutheria|Rep: Rho-related GTP-binding
           protein RhoD precursor - Homo sapiens (Human)
          Length = 210

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 35/120 (29%), Positives = 56/120 (46%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K VLVGDGG GKT+ +     G F + Y  T+  E + +          L       +  
Sbjct: 19  KVVLVGDGGCGKTSLLMVFADGAFPESYTPTV-FERYMVNLQVKGKPVHLHIWDTAGQDD 77

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKDRK 472
              L        +VL + FDVTS  ++ N+ N W+ ++   C+ +PI++ G K D++  K
Sbjct: 78  YDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDK 137


>UniRef50_Q9GPS0 Cluster: RAS-related protein racG precursor; n=2;
           Dictyostelium discoideum|Rep: RAS-related protein racG
           precursor - Dictyostelium discoideum (Slime mold)
          Length = 201

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 30/125 (24%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M + K  +VG+GG GKT+ +  + +     +Y  T+      L+ H N+  + L      
Sbjct: 1   MKSIKVCVVGEGGIGKTSMLLSYTSNSISNEYQPTVFDNYSTLLMH-NKKPYNLSLWDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  + F + +  ++ N+  +W ++L   C   PIVL G ++D+
Sbjct: 60  GQEEFSKLRRLSYPQTDVFLLCFSLINPSSFSNILDSWVQELNENCPNTPIVLVGTQMDL 119

Query: 461 KDRKV 475
           K   V
Sbjct: 120 KSNSV 124


>UniRef50_Q8MXS1 Cluster: Ras-related protein Rab-18; n=8;
           Fungi/Metazoa group|Rep: Ras-related protein Rab-18 -
           Caenorhabditis elegans
          Length = 203

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 35/136 (25%), Positives = 71/136 (52%), Gaps = 8/136 (5%)
 Frame = +2

Query: 92  MADD----MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRG 253
           M+DD    + T K +++G+ G GK++ + R +   F+ +  AT+GV+  V  +    NR 
Sbjct: 1   MSDDSSSPLTTLKILIIGESGVGKSSLMLRFVDDVFDPEQAATIGVDFRVTSMAIDGNRV 60

Query: 254 QFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC--EGI 427
           +  +   T   +R   +  +       V+ V +DVTSR +++ + +W +++   C  + I
Sbjct: 61  KLAIW-DTAGQERFRTLTPSYYRGAQGVICV-YDVTSRSSFEKLNHWMQEVDTYCTNDNI 118

Query: 428 PIVLCGNKVDIKDRKV 475
             ++  NK+D+ +R V
Sbjct: 119 IKMMVANKIDMPNRVV 134


>UniRef50_UPI000069F5CB Cluster: RAB44, member RAS oncogene family;
           n=3; Xenopus tropicalis|Rep: RAB44, member RAS oncogene
           family - Xenopus tropicalis
          Length = 179

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 32/112 (28%), Positives = 56/112 (50%), Gaps = 2/112 (1%)
 Frame = +2

Query: 146 GKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRSLVVLETDTIF 325
           GKT+F+ R   G F + Y AT+G++      + +  +F L       +     +      
Sbjct: 1   GKTSFLHRVHDGSFHQGYSATVGIDCRIKTINVDDKRFALQLWDTAGQERFHSITEHFFR 60

Query: 326 KDNVLSVMFDVTSRVTYKNVPNWHRDLV-RVCEGIPIVLCGNKVDIK-DRKV 475
           K + L +M+DVTS+ T+  V  W   +  +  + I I+L GNK+D + +R+V
Sbjct: 61  KADGLVIMYDVTSKDTFDAVQYWLSCITNKTQDDIIILLMGNKIDCEAEREV 112


>UniRef50_Q7T015 Cluster: Novel Ras family member; n=2; Danio
           rerio|Rep: Novel Ras family member - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 166

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 31/123 (25%), Positives = 60/123 (48%), Gaps = 1/123 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           F  V+VG+   GKT+F++R   G+F + Y +T+GV+              L       + 
Sbjct: 13  FNVVMVGNSCVGKTSFIRRFHEGQFTEDYRSTIGVDTFVQTVELPDRTVKLQIWDTAGQE 72

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNW-HRDLVRVCEGIPIVLCGNKVDIKDR 469
           S+    T    K   L +M+++T   ++ ++ +W  +   R  + + ++L GNK D  +R
Sbjct: 73  SIT---TQVFHKAEGLLLMYEITCSKSFISIRDWISQARERAQDDVVMMLLGNKNDSVNR 129

Query: 470 KVK 478
           +V+
Sbjct: 130 EVQ 132


>UniRef50_Q9BLE7 Cluster: Small GTPase RabF1; n=2; Entamoeba
           histolytica|Rep: Small GTPase RabF1 - Entamoeba
           histolytica
          Length = 202

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 34/128 (26%), Positives = 61/128 (47%), Gaps = 4/128 (3%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP--LVFHTNRGQFVL 265
           M       K V++GD   GKT    R + G F+    +T+G       L    N  + V+
Sbjct: 1   MQSSQDAVKIVVIGDQSVGKTCVSGRLVDGSFKPDEKSTIGASFVTTYLPIDGNNVKIVI 60

Query: 266 MCGTQPDK-RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVL 439
                 +K RS+V +         V  + +D+TSR +++++  W+ DL++V    I + +
Sbjct: 61  WDTAGQEKYRSMVGMYYRGA---TVALICYDITSRSSFESLEGWYTDLMKVASSDISVAI 117

Query: 440 CGNKVDIK 463
            GNK+D++
Sbjct: 118 VGNKIDLE 125


>UniRef50_Q4F7H0 Cluster: Rab protein; n=1; Euplotes
           octocarinatus|Rep: Rab protein - Euplotes octocarinatus
          Length = 220

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 40/139 (28%), Positives = 69/139 (49%), Gaps = 7/139 (5%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNR-GQF---VLMCGTQ 280
           FK VL+GD   GK+  + R    +F   YV T+GV+     F T R G++   + +  T 
Sbjct: 12  FKMVLIGDSSVGKSCLLIRFSDDDFNDNYVTTIGVDFR---FRTLRIGEYSVKLQIWDTA 68

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC--EGIPIVLCGNKV 454
             +R   +        D ++ V+FD++++ T+  V +W  + V+ C  E   I++  NK 
Sbjct: 69  GQERYRTITNAYYRGADGII-VVFDLSNKETFLTVSDWLEE-VKKCAPEDTLIIVFANKC 126

Query: 455 DIKD-RKVKAKTIVFHRKK 508
           D+ D R+V  + I    +K
Sbjct: 127 DLYDERQVSEEDIKSFEEK 145


>UniRef50_Q3SDR7 Cluster: Rab_C69 protein; n=6; Paramecium
           tetraurelia|Rep: Rab_C69 protein - Paramecium
           tetraurelia
          Length = 221

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 2/129 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V +GD   GKT+ + R +   F      T+G++        +     L      
Sbjct: 10  MQKYKIVFLGDQAVGKTSIINRFIFDNFTGNEQPTVGIDFISKTLQVDNKSVRLQLWDTA 69

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDI 460
            +     L    I       + FD+T+  +++N+P W  D+     + + I + GNK+D+
Sbjct: 70  GQERFRSLIPSYIRDSQAAIICFDITNEKSFQNLPRWIEDVKEERGDEVLIYILGNKIDL 129

Query: 461 K-DRKVKAK 484
           + +R++  K
Sbjct: 130 ENERQIPTK 138



 Score = 36.7 bits (81), Expect = 0.63
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           S ++  + +++R  +WDTAGQE+F  L   Y    Q AI
Sbjct: 51  SKTLQVDNKSVRLQLWDTAGQERFRSLIPSYIRDSQAAI 89


>UniRef50_Q38CS2 Cluster: Small GTPase, putative; n=2; Trypanosoma
           brucei|Rep: Small GTPase, putative - Trypanosoma brucei
          Length = 276

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 41/125 (32%), Positives = 62/125 (49%), Gaps = 5/125 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGE--FEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQP 283
           FK +LVGD   GKT F+K +L G   F  + V TL V+ V+  V    +   VLM  T  
Sbjct: 65  FKIILVGDSYVGKTRFLK-NLVGAIGFGDQCVTTLSVDVVNHYVIVDGKTVQVLMYDTCG 123

Query: 284 DKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVD 457
            +R   +  T   ++D   ++M +D T   ++ N+  W   L    CE    +L GNK D
Sbjct: 124 QERFRAM--TAQFYRDAHGAIMVYDTTQIGSFDNIEVWFSQLNSFGCENTSKILVGNKCD 181

Query: 458 IKDRK 472
           + +R+
Sbjct: 182 LPERR 186


>UniRef50_Q23C10 Cluster: Ras family protein; n=3;
           Oligohymenophorea|Rep: Ras family protein - Tetrahymena
           thermophila SB210
          Length = 204

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 32/127 (25%), Positives = 64/127 (50%), Gaps = 4/127 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFHTNRGQFVLMCGTQPDKR 292
           K +++GD G GKT F+  +    F + ++ T+G++  H       +   + +  T   +R
Sbjct: 12  KLLILGDSGVGKTCFLVNYCKKSFTRIHLPTIGIDYEHKYEDVDGKHVKLQIWDTAGQER 71

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKD 466
              +  T   +K ++ + + + VT   T+KN+ +W + +  R    + IV+   K+D+KD
Sbjct: 72  FKTI--TQNYYKGSMGIILAYSVTDPNTFKNIADWMKQISERADPSVKIVIIATKIDMKD 129

Query: 467 -RKVKAK 484
            RKV  +
Sbjct: 130 QRKVSTQ 136


>UniRef50_A7SI96 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 191

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 32/126 (25%), Positives = 53/126 (42%), Gaps = 1/126 (0%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           +D  T K  +VGDG  GKT       T  F  +Y+ T         F+ +  ++  +   
Sbjct: 2   EDYVTLKLYIVGDGAVGKTALFITAATNTFPTEYIPTAYDASEQDFFNVDGIKYQAVLFD 61

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVP-NWHRDLVRVCEGIPIVLCGNKV 454
                    L        ++  V FD+  R +++NV   W  +L     G+P VL GNK 
Sbjct: 62  SAGGEDFDRLRPLGYPNTDIFLVCFDIAHRASFENVALRWLPELDHFSPGVPRVLVGNKK 121

Query: 455 DIKDRK 472
           D++ ++
Sbjct: 122 DLRPKQ 127


>UniRef50_A2DIT5 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 191

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 31/120 (25%), Positives = 62/120 (51%), Gaps = 3/120 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           + V++GD   GKT+ V +   G++E+    T+    + L     +GQ  +          
Sbjct: 7   RLVMIGDSSVGKTSLVYQMCKGKWEETR-PTVATAFYILNGDPAKGQQDIQIWDTAGAER 65

Query: 296 LVVLETDTIFKDNVLS--VMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
              L  ++++  N +   ++FD+T+R +++ +P+WH + V + + G  +VL GNK D+ D
Sbjct: 66  YRAL--NSVYYHNAMGGLLVFDLTNRKSFEALPSWHEEFVSLAQPGALLVLIGNKSDLAD 123


>UniRef50_A2DAL1 Cluster: Ras family protein; n=2; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 202

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 28/118 (23%), Positives = 52/118 (44%)
 Frame = +2

Query: 107 PTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPD 286
           P  K VL+GD   GKT  V+R L  ++     +T  + ++    + +     +       
Sbjct: 17  PDVKLVLLGDSAVGKTKLVERFLLKDYNPITNSTFALTLYEHTENLSGKDVQVTIWDTAG 76

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
           +     L     +  +   ++FD T + TY+++  WH  L+     IPI++  NK D+
Sbjct: 77  QGCFDALHPSFFYGADAAILVFDATRKETYQHLEEWHAQLISQRGQIPIIVVVNKQDL 134


>UniRef50_A6NNR4 Cluster: Uncharacterized protein RAP1A; n=7;
           Euteleostomi|Rep: Uncharacterized protein RAP1A - Homo
           sapiens (Human)
          Length = 167

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 30/129 (23%), Positives = 61/129 (47%), Gaps = 2/129 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V++G GG GK+    + + G F +KY  T+       V   +  Q +L      
Sbjct: 1   MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQV-EVDCQQCMLEILDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
                  +    +      ++++ +T++ T+ ++ +    ++RV   E +P++L GNK D
Sbjct: 60  GTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCD 119

Query: 458 IKDRKVKAK 484
           ++D +V  K
Sbjct: 120 LEDERVVGK 128


>UniRef50_Q8SW02 Cluster: Similarity to RAS-LIKE GTP-BINDING PROTEIN
           YPT1; n=1; Encephalitozoon cuniculi|Rep: Similarity to
           RAS-LIKE GTP-BINDING PROTEIN YPT1 - Encephalitozoon
           cuniculi
          Length = 201

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 28/122 (22%), Positives = 60/122 (49%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+G+ G GKT  +KR+    +     +T+GV+           +  L       + 
Sbjct: 9   FKMILIGNSGVGKTCLMKRYTDETYSFTQSSTIGVDFKIKSLEVAGEKVKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + ++     + + ++FD+ S+ ++ N+ +W  ++ +   E + I++ GNKVD K++
Sbjct: 69  RFRAIISNYYRGAHGIIIVFDMGSKESFDNLGDWLSEVRKNTSENVEIIILGNKVDDKEK 128

Query: 470 KV 475
            V
Sbjct: 129 IV 130


>UniRef50_Q5K854 Cluster: Rho GTPase, putative; n=6; Fungi/Metazoa
           group|Rep: Rho GTPase, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 199

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 38/127 (29%), Positives = 58/127 (45%), Gaps = 3/127 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M + KCV+VGDG  GKT  +  + T  F  +YV T+       V    R   + +  T  
Sbjct: 3   MQSIKCVVVGDGAVGKTCLLISYTTNSFPGEYVPTVFDNYSASVLVDGRPVSLGLWDTAG 62

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  V F + S  +++NV   W  ++       PI+L G K+
Sbjct: 63  QEDYDRLRPLSYP---QTDVFLVCFSIVSPPSFENVKTKWIPEIRHHAPTTPILLIGTKL 119

Query: 455 DIKDRKV 475
           D++D  V
Sbjct: 120 DLRDDPV 126


>UniRef50_Q96AX2 Cluster: Ras-related protein Rab-37; n=42;
           Eumetazoa|Rep: Ras-related protein Rab-37 - Homo sapiens
           (Human)
          Length = 223

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 4/126 (3%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEF-EKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQP 283
           T K +L+GD G GKT F+ +   G F    ++AT+G++    V   +  +  L +  T  
Sbjct: 29  TGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVDGVRVKLQIWDTAG 88

Query: 284 DKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVD 457
            +R   V  T   ++D   L +++D+T++ ++ N+  W  ++    +  + I+L GNK D
Sbjct: 89  QERFRSV--THAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKAD 146

Query: 458 IKDRKV 475
           +   +V
Sbjct: 147 MSSERV 152



 Score = 33.1 bits (72), Expect = 7.8
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           ++  +WDTAGQE+F  +   YY   Q  +
Sbjct: 79  VKLQIWDTAGQERFRSVTHAYYRDAQALL 107


>UniRef50_UPI0000E22FA3 Cluster: PREDICTED: similar to novel Ras
           family member protein; n=1; Pan troglodytes|Rep:
           PREDICTED: similar to novel Ras family member protein -
           Pan troglodytes
          Length = 645

 Score = 46.0 bits (104), Expect(2) = 1e-04
 Identities = 28/117 (23%), Positives = 51/117 (43%)
 Frame = +2

Query: 74  SHKTTKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRG 253
           S +++  A D   FK V VG+   GKT+F++R     F     AT+G++      + +  
Sbjct: 196 SEESSPSAPDR-LFKIVFVGNSAVGKTSFLRRLCEDRFSPGMAATVGIDYRVKTLNVDNS 254

Query: 254 QFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG 424
           Q  L       +     +      K + + VM+D+T + ++ +V  W   +  V  G
Sbjct: 255 QVALQLWDTAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVESVVPG 311



 Score = 22.6 bits (46), Expect(2) = 1e-04
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = +2

Query: 404 LVRVCEGIPIVLCGNKVD-IKDRKV 475
           L  V + +P++L GNK+D  K+R+V
Sbjct: 339 LEAVGDRVPVLLLGNKLDNEKEREV 363


>UniRef50_Q9VC31 Cluster: CG31118-PA; n=8; Eumetazoa|Rep: CG31118-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 213

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           D + T+K +++GD   GKT  V R+   ++   Y++T+G++    + + +     L    
Sbjct: 4   DFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWD 63

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKV 454
              +     L T        + +M+DVT+  +Y N+  W R++       +  VL GNK 
Sbjct: 64  TAGQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKC 123

Query: 455 D 457
           +
Sbjct: 124 E 124



 Score = 38.3 bits (85), Expect = 0.21
 Identities = 35/115 (30%), Positives = 50/115 (43%), Gaps = 5/115 (4%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAI--SHVRRNLSSYVQKCT*LA*---RFGPCM* 420
           I+  +WDTAGQE+F  L   YY +G   I   +   NL SY      L        P + 
Sbjct: 57  IKLQIWDTAGQERFRTLTTAYY-RGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVV 115

Query: 421 RYPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKL 585
           +       + S   R           +  D+ ++++S KSN N E  FL LARK+
Sbjct: 116 KVLAGNKCECSATQRMVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKI 170


>UniRef50_Q868I4 Cluster: Tem-1-like protein; n=3; Giardia
           intestinalis|Rep: Tem-1-like protein - Giardia lamblia
           (Giardia intestinalis)
          Length = 206

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 35/136 (25%), Positives = 66/136 (48%), Gaps = 5/136 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV--HPLVFHTNRGQFVLM-CGTQPD 286
           K  L+G+   GKT+ + R++ GEF   Y+ +LGV      +  H N     +   G + +
Sbjct: 18  KIALLGNAEAGKTSLMVRYVEGEFNHNYIQSLGVNFMERTITLHDNPVLLSIWDLGGESE 77

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVD-IK 463
            ++++ L  D      V   +FD+TS+ +  ++  W+R    +      VL G K D  +
Sbjct: 78  FKNMLPLVCD---GSMVFLYIFDLTSKTSLASIKEWYRQAKALNRSAFPVLVGAKYDRFR 134

Query: 464 D-RKVKAKTIVFHRKK 508
           + R+ K + I+ H ++
Sbjct: 135 ELREDKKREIIEHARR 150


>UniRef50_Q5NT34 Cluster: Small GTPase EhRabF4; n=1; Entamoeba
           histolytica|Rep: Small GTPase EhRabF4 - Entamoeba
           histolytica
          Length = 211

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 4/119 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC----GTQ 280
           +K  LVGD   GKT+ V R+  G F     AT+G       +   +GQ + +       Q
Sbjct: 27  YKICLVGDQSVGKTSLVNRYAKGGFSTNEKATIGANFIATSY-IKQGQEIKLALWDTAGQ 85

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVD 457
              RS+V +            +++DVT+R T++++  W+ ++ +    +  +L GNK D
Sbjct: 86  EKYRSMVSMYYRG---SRGAVIVYDVTNRTTFEDIRGWYDEIFKAEPDVVCMLVGNKAD 141


>UniRef50_Q5NSZ6 Cluster: Small GTPase EhRabX20; n=1; Entamoeba
           histolytica|Rep: Small GTPase EhRabX20 - Entamoeba
           histolytica
          Length = 189

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 4/133 (3%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CG 274
           M   K  L+GD G GKT+ + R +   F     +T+G    +H  +      Q  L    
Sbjct: 1   MKQVKVSLIGDSGVGKTSLLSRFINNTFSPTTESTVGANFYMHEFLIDGKMTQVALWDTA 60

Query: 275 TQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNK 451
           +Q   RSLV +        N   ++F + +R ++ N+  W+  LV  V   + I++ GNK
Sbjct: 61  SQERYRSLVSM---YYRNTNGCLIVFGLDNRDSFYNIKTWYNSLVNTVGMDVAIIIVGNK 117

Query: 452 VDIKDRKVKAKTI 490
            D+    V  + I
Sbjct: 118 NDLPQPSVTQQEI 130


>UniRef50_Q54GY8 Cluster: Rab GTPase; n=1; Dictyostelium discoideum
           AX4|Rep: Rab GTPase - Dictyostelium discoideum AX4
          Length = 202

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 34/135 (25%), Positives = 63/135 (46%), Gaps = 3/135 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +L+GD   GKT+ VKR     F++  + T+GVE        +  +  L       + 
Sbjct: 7   YKVLLIGDSDVGKTSIVKRFSDDTFDEDLLCTIGVEFKMKEVKVDGKKVDLCIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIV--LCGNKVDIKD 466
               L +      + + + +DVT R ++ N+  W  ++        +V  L GNK+D ++
Sbjct: 67  KFRALISSYYRGAHGIILTYDVTKRESFDNLNYWLNEVENFANRSNLVKLLVGNKIDKEN 126

Query: 467 RKV-KAKTIVFHRKK 508
           R+V + +   F +KK
Sbjct: 127 REVTREEGAEFAKKK 141


>UniRef50_Q3SD55 Cluster: Rab_C21 protein; n=6; Paramecium
           tetraurelia|Rep: Rab_C21 protein - Paramecium
           tetraurelia
          Length = 234

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 31/126 (24%), Positives = 63/126 (50%), Gaps = 2/126 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GK+  + +     F  ++ AT+GVE        N     L       + +
Sbjct: 9   KFIIIGDTCVGKSCLLLQFTDSRFRNEHDATIGVEFGSRNTKINDKTIKLQVWDTAGQEA 68

Query: 296 LVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLV-RVCEGIPIVLCGNKVDIKDR 469
              + T + ++ ++  ++ FDVTSR +++ V  W++++    C+ I + L  NK+D+ D 
Sbjct: 69  FKSI-TRSYYRGSIGGILVFDVTSRQSFEGVAKWYQEIQGYACDKIEMALVANKIDL-DA 126

Query: 470 KVKAKT 487
           K + +T
Sbjct: 127 KREVQT 132



 Score = 34.7 bits (76), Expect = 2.6
 Identities = 17/49 (34%), Positives = 22/49 (44%)
 Frame = +1

Query: 175 DWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           D R R +     G    S +     + I+  VWDTAGQE F  +   YY
Sbjct: 29  DSRFRNEHDATIGVEFGSRNTKINDKTIKLQVWDTAGQEAFKSITRSYY 77


>UniRef50_Q3SD16 Cluster: Rab_B01 protein; n=4; Paramecium
           tetraurelia|Rep: Rab_B01 protein - Paramecium
           tetraurelia
          Length = 233

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 30/136 (22%), Positives = 72/136 (52%), Gaps = 4/136 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN-RGQFVLMCGTQPDK 289
           FK V++G+ G GK++ + R+   +F + Y++T+GV+     F  + +G  + +  T   +
Sbjct: 10  FKLVIIGNSGVGKSSLLIRYADDKFSENYISTIGVDFKFKTFQLDGKGLKLQIWDTAGQE 69

Query: 290 RSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNV-PNWHRDLVR-VCEGIPIVLCGNKVDI 460
           R   +  T++ +K  + + +++D T   +++ +  +W  ++ +       I+L GNK D+
Sbjct: 70  RFRTI--TNSYYKGADAIVLVYDTTCLQSFEEIEKSWLDEIYKHAGRNTTILLIGNKSDL 127

Query: 461 KDRKVKAKTIVFHRKK 508
            ++ V  +    + K+
Sbjct: 128 PNKTVSTERAQVYAKE 143


>UniRef50_Q23R92 Cluster: Ras family protein; n=2; Tetrahymena
           thermophila SB210|Rep: Ras family protein - Tetrahymena
           thermophila SB210
          Length = 363

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 29/118 (24%), Positives = 57/118 (48%), Gaps = 2/118 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K VLVGD G GKT  + R++ G+     + T+G+E          G  +         +
Sbjct: 151 YKIVLVGDAGVGKTHIINRYVKGQLPHAIIPTIGIEFATKTVTLRDGGTIKTQIWDTAGQ 210

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
                 T   ++  V +++ +DVT   +++++  W  ++ +   + I ++L GNKVD+
Sbjct: 211 EKYRSITSAHYRKAVGALLVYDVTKEKSFESIQRWLEEIRLHADKDIVLMLVGNKVDL 268


>UniRef50_O76901 Cluster: CG14791-PB, isoform B; n=2; Drosophila
           melanogaster|Rep: CG14791-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 236

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 32/129 (24%), Positives = 66/129 (51%), Gaps = 8/129 (6%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFHTNRGQ----FVLMCGTQPD 286
           +++GD G GKT  + ++  G F  ++++T+G++     + + +RG+     + +  T   
Sbjct: 21  LVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQ 80

Query: 287 KRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNKVD 457
           +R   +  T   ++D +   ++FD+TS  ++    NW   L      E   +VLCGNK D
Sbjct: 81  ERFRSL--TTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCD 138

Query: 458 IKDRKVKAK 484
           +   +V ++
Sbjct: 139 LLQLRVVSR 147


>UniRef50_A2FAP9 Cluster: Ras family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ras family protein - Trichomonas
           vaginalis G3
          Length = 202

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 4/123 (3%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQ---FVLMC 271
           D P+ K VL+GD G GKTT + R +TG+F +    T+G      +     G+   F+   
Sbjct: 8   DAPSIKIVLLGDSGVGKTTCLTRWMTGKFYQNLKQTVGTNHQRKIVELREGKVDLFIWDT 67

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNW-HRDLVRVCEGIPIVLCGN 448
             Q   RSL+ +         V++ + D  S   + ++ +W +  L  +    P +L  N
Sbjct: 68  AGQEQFRSLMPMYARNSCAVIVVAAIDDPAS---FTHIKDWINTALASIESETPFILAVN 124

Query: 449 KVD 457
           K+D
Sbjct: 125 KID 127


>UniRef50_A2DZN5 Cluster: Small GTP-binding protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Small GTP-binding protein,
           putative - Trichomonas vaginalis G3
          Length = 195

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 4/130 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGT--QPD 286
           K V++GD G GKT+   R + G ++     T+G          +R    V M  T  Q  
Sbjct: 12  KIVVLGDSGVGKTSLANRWINGVWQDSVKPTIGANHQRKRVQIDRNNLDVFMWDTAGQEQ 71

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGI-PIVLCGNKVDIK 463
            RSL  + T +    + + ++  +  R +++++ NW   +    E + P+VL  NK+D+ 
Sbjct: 72  FRSLAPVYTRS---SSAVIIVASIIERASFESIENWIEIVKSTSEKMPPLVLAVNKIDLP 128

Query: 464 DRKVKAKTIV 493
           D  +  + I+
Sbjct: 129 DAVINQEEII 138


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 829,757,907
Number of Sequences: 1657284
Number of extensions: 17624478
Number of successful extensions: 58659
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 54639
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 57844
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 64204279620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -