SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20002
         (732 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5TUX2 Cluster: ENSANGP00000025612; n=1; Anopheles gamb...    62   1e-08
UniRef50_A7TZ21 Cluster: BCS-1-like protein; n=1; Lepeophtheirus...    49   1e-04
UniRef50_A7TZC7 Cluster: BCS-1-like protein; n=4; Lepeophtheirus...    47   5e-04
UniRef50_A7L487 Cluster: Putative cuticle protein; n=1; Artemia ...    46   0.001
UniRef50_A3F591 Cluster: Putative cuticle protein; n=1; Artemia ...    44   0.003
UniRef50_Q9NDT7 Cluster: BCS-1; n=2; Balanus amphitrite|Rep: BCS...    43   0.007
UniRef50_A3F590 Cluster: Putative cuticle protein; n=1; Artemia ...    43   0.009
UniRef50_UPI000051AB43 Cluster: PREDICTED: similar to CG15920-PA...    41   0.036
UniRef50_A7L493 Cluster: Putative cuticle protein; n=1; Artemia ...    40   0.063
UniRef50_UPI00015B5FE9 Cluster: PREDICTED: hypothetical protein;...    38   0.25 
UniRef50_UPI00015B5FE6 Cluster: PREDICTED: similar to CG15920-PA...    38   0.25 
UniRef50_UPI00015B5FE8 Cluster: PREDICTED: similar to RE26879p; ...    38   0.33 
UniRef50_Q16XU9 Cluster: Putative uncharacterized protein; n=1; ...    38   0.33 
UniRef50_Q2GZ99 Cluster: Putative uncharacterized protein; n=1; ...    38   0.33 
UniRef50_Q7K2P1 Cluster: GH20904p; n=3; Diptera|Rep: GH20904p - ...    37   0.44 
UniRef50_Q7JZJ3 Cluster: RE26879p; n=5; Endopterygota|Rep: RE268...    37   0.59 
UniRef50_Q7S380 Cluster: Putative uncharacterized protein NCU048...    37   0.59 
UniRef50_Q9V7U0 Cluster: Pro-resilin precursor; n=2; Drosophila ...    37   0.59 
UniRef50_UPI0000DB728C Cluster: PREDICTED: similar to CG6305-PA;...    36   1.0  
UniRef50_UPI0000D5780C Cluster: PREDICTED: similar to CG6305-PA;...    36   1.0  
UniRef50_A1YLE4 Cluster: Cuticle protein CB6; n=1; Portunus pela...    36   1.0  
UniRef50_UPI00015B5FE4 Cluster: PREDICTED: similar to CG6305-PA;...    36   1.4  
UniRef50_Q7JZ94 Cluster: RE53044p; n=2; Sophophora|Rep: RE53044p...    36   1.4  
UniRef50_Q6RKG1 Cluster: Polyketide synthase; n=1; Cochliobolus ...    36   1.4  
UniRef50_UPI0000DB7EC4 Cluster: PREDICTED: similar to CG15920-PA...    35   1.8  
UniRef50_UPI0000DB7324 Cluster: PREDICTED: similar to CG6305-PA;...    35   1.8  
UniRef50_Q16X58 Cluster: Putative uncharacterized protein; n=2; ...    35   1.8  
UniRef50_Q7PSL5 Cluster: ENSANGP00000017262; n=2; Culicidae|Rep:...    34   3.1  
UniRef50_Q6ZUP0 Cluster: CDNA FLJ43499 fis, clone PEBLM2002749; ...    34   3.1  
UniRef50_UPI00015B5FE7 Cluster: PREDICTED: hypothetical protein;...    34   4.1  
UniRef50_Q16XY8 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_UPI0000D5771F Cluster: PREDICTED: similar to CG7076-PA;...    33   5.5  
UniRef50_UPI0000499B21 Cluster: conserved hypothetical protein; ...    33   5.5  
UniRef50_UPI000065D714 Cluster: Protein FAM21D; n=1; Takifugu ru...    33   5.5  
UniRef50_Q3V6T1 Cluster: Cuticular protein; n=1; Tachypleus trid...    33   5.5  
UniRef50_Q175B1 Cluster: Adult cuticle protein, putative; n=2; A...    33   5.5  
UniRef50_UPI0000D55C1A Cluster: PREDICTED: similar to CG6305-PA;...    33   7.2  
UniRef50_Q6CEI5 Cluster: Yarrowia lipolytica chromosome B of str...    33   7.2  
UniRef50_UPI0000D5600F Cluster: PREDICTED: similar to CG1919-PA;...    33   9.5  
UniRef50_Q0EWV6 Cluster: Putative uncharacterized protein; n=1; ...    33   9.5  
UniRef50_Q8I3P9 Cluster: Putative uncharacterized protein PFE107...    33   9.5  
UniRef50_Q4V6L8 Cluster: IP11372p; n=3; Sophophora|Rep: IP11372p...    33   9.5  
UniRef50_Q170Z6 Cluster: Pupal cuticle protein, putative; n=2; C...    33   9.5  

>UniRef50_Q5TUX2 Cluster: ENSANGP00000025612; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000025612 - Anopheles gambiae
           str. PEST
          Length = 100

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 26/45 (57%), Positives = 31/45 (68%)
 Frame = +3

Query: 261 GDAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANP 395
           GD  GKV G Y V LPDGRLMT++Y V  + GF P++ F  NANP
Sbjct: 53  GDTAGKVTGRYSVWLPDGRLMTIKYIVDKEGGFQPEVDFQDNANP 97



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 18/30 (60%), Positives = 22/30 (73%)
 Frame = +2

Query: 158 AAPALQEEQYPPMPYEYKYDVEDPEKTLYF 247
           AAP  Q E+Y    YEYKY+V+DPEK L+F
Sbjct: 22  AAP--QAEKYEA--YEYKYEVKDPEKQLFF 47


>UniRef50_A7TZ21 Cluster: BCS-1-like protein; n=1; Lepeophtheirus
           salmonis|Rep: BCS-1-like protein - Lepeophtheirus
           salmonis (salmon louse)
          Length = 149

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/36 (63%), Positives = 28/36 (77%), Gaps = 1/36 (2%)
 Frame = +3

Query: 267 AEGKVVGG-YRVLLPDGRLMTVEYTVQGDSGFVPKI 371
           AEG +V G Y+V L DG++MTV YTV+GDSGFV  I
Sbjct: 82  AEGGIVSGEYKVKLADGKIMTVSYTVEGDSGFVADI 117


>UniRef50_A7TZC7 Cluster: BCS-1-like protein; n=4; Lepeophtheirus
           salmonis|Rep: BCS-1-like protein - Lepeophtheirus
           salmonis (salmon louse)
          Length = 124

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 20/33 (60%), Positives = 25/33 (75%)
 Frame = +3

Query: 273 GKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKI 371
           G V G Y+VL  DG++MTV YTV+GDSGFV  +
Sbjct: 69  GAVSGQYKVLRADGKIMTVSYTVEGDSGFVADV 101


>UniRef50_A7L487 Cluster: Putative cuticle protein; n=1; Artemia
           franciscana|Rep: Putative cuticle protein - Artemia
           sanfranciscana (Brine shrimp) (Artemia franciscana)
          Length = 171

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           D  G V G Y+ LLPDGR+ TV YT    +G+V  + +   AN
Sbjct: 86  DGNGYVKGSYQTLLPDGRVQTVTYTADDYTGYVADVQYSGQAN 128


>UniRef50_A3F591 Cluster: Putative cuticle protein; n=1; Artemia
           franciscana|Rep: Putative cuticle protein - Artemia
           sanfranciscana (Brine shrimp) (Artemia franciscana)
          Length = 118

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +3

Query: 285 GGYRVLLPDGRLMTVEYTVQGDSGFVPKISF 377
           G Y+VLLPDGRL  V +TV GD G+V  + +
Sbjct: 86  GSYKVLLPDGRLQVVTFTVNGDDGYVANVQY 116


>UniRef50_Q9NDT7 Cluster: BCS-1; n=2; Balanus amphitrite|Rep: BCS-1
           - Balanus amphitrite (Barnacle)
          Length = 156

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +3

Query: 255 RIGDAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           R GDA     G Y V + DGR+  V Y+V+GDSG+V  I ++  AN
Sbjct: 93  RDGDATS---GSYYVQMADGRMQIVNYSVEGDSGYVVDIQYEGEAN 135


>UniRef50_A3F590 Cluster: Putative cuticle protein; n=1; Artemia
           franciscana|Rep: Putative cuticle protein - Artemia
           sanfranciscana (Brine shrimp) (Artemia franciscana)
          Length = 131

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNA 389
           D +G V G Y+ LLPDGR+ TV YT    +G+V  + +   A
Sbjct: 8   DDKGYVKGSYQTLLPDGRVQTVTYTADDYTGYVADVQYSGEA 49


>UniRef50_UPI000051AB43 Cluster: PREDICTED: similar to CG15920-PA,
           isoform A; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG15920-PA, isoform A - Apis mellifera
          Length = 492

 Score = 40.7 bits (91), Expect = 0.036
 Identities = 20/41 (48%), Positives = 24/41 (58%)
 Frame = +3

Query: 285 GGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQG 407
           G + VLLPDGR   VEY    D GF P+I ++  AN  G G
Sbjct: 373 GEFNVLLPDGRKQIVEYEADQD-GFKPQIRYEGEANSQGYG 412


>UniRef50_A7L493 Cluster: Putative cuticle protein; n=1; Artemia
           franciscana|Rep: Putative cuticle protein - Artemia
           sanfranciscana (Brine shrimp) (Artemia franciscana)
          Length = 200

 Score = 39.9 bits (89), Expect = 0.063
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +3

Query: 264 DAEGKVV-GGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPF 398
           +++G+ V G Y+V LPDGRL  V Y     +GF   + ++  A P+
Sbjct: 15  ESDGQTVRGSYQVKLPDGRLQIVNYVADPYTGFQADVKYEGEAQPY 60


>UniRef50_UPI00015B5FE9 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 196

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 17/33 (51%), Positives = 23/33 (69%)
 Frame = +3

Query: 285 GGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDS 383
           G Y VLLPDGR   VEY    ++G+ PKIS+++
Sbjct: 146 GSYSVLLPDGRRQIVEYEAD-EAGYRPKISYEA 177


>UniRef50_UPI00015B5FE6 Cluster: PREDICTED: similar to CG15920-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG15920-PA - Nasonia vitripennis
          Length = 752

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +3

Query: 285 GGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           G + VLLPDGR   VEY    D GF P+I ++  AN
Sbjct: 559 GEFNVLLPDGRKQIVEYEADQD-GFKPQIRYEGEAN 593


>UniRef50_UPI00015B5FE8 Cluster: PREDICTED: similar to RE26879p;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           RE26879p - Nasonia vitripennis
          Length = 421

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +3

Query: 285 GGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFG 401
           G Y VLLPDGR   V Y    ++GF P+IS++  A+  G
Sbjct: 356 GVYSVLLPDGRKQIVHYEAD-ENGFKPRISYEEAASVLG 393


>UniRef50_Q16XU9 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 887

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 17/41 (41%), Positives = 24/41 (58%)
 Frame = +3

Query: 273 GKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANP 395
           G   G Y +LLPDGR+  V YT   + GF  ++S++S   P
Sbjct: 827 GVTRGEYHILLPDGRVQNVRYTAD-EKGFHAEVSYESIPTP 866


>UniRef50_Q2GZ99 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 2470

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = +3

Query: 150 NRLQHPRYKKNSIPLCRTNTNTTLKILRRHCTSARRIGDAEGKVVGGYRVLL-PDGRLMT 326
           NRL H    +       T  +TTL  L + C S +  G++   +VGG  V+  PD  L  
Sbjct: 145 NRLSHFFDLRGPSMSVDTGCSTTLTALHQGCQSLKT-GESNMSIVGGANVMFNPDMFLAM 203

Query: 327 VEYTVQGDSGFVPKISFDSNANPFGQGK 410
              T+    G     +FDS AN +G+G+
Sbjct: 204 SSMTLISKDG--KSYAFDSRANGYGRGE 229


>UniRef50_Q7K2P1 Cluster: GH20904p; n=3; Diptera|Rep: GH20904p -
           Drosophila melanogaster (Fruit fly)
          Length = 178

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query: 267 AEGKVVGG-YRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQG 407
           ++G VV G YRV +PDGR   V YT    +G+   +S++  A  + QG
Sbjct: 111 SDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEGEAT-YPQG 157


>UniRef50_Q7JZJ3 Cluster: RE26879p; n=5; Endopterygota|Rep: RE26879p
           - Drosophila melanogaster (Fruit fly)
          Length = 217

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 19/42 (45%), Positives = 23/42 (54%)
 Frame = +3

Query: 282 VGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQG 407
           VG Y VLLPDGR   VEY     +G+ P I ++   N  G G
Sbjct: 155 VGRYYVLLPDGRKQIVEYEAD-QNGYRPTIRYEQVGNGNGNG 195



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 15/25 (60%), Positives = 17/25 (68%)
 Frame = +2

Query: 176 EEQYPPMPYEYKYDVEDPEKTLYFG 250
           EEQY P  YE+KYDV+D E    FG
Sbjct: 120 EEQYGPAKYEFKYDVQDYESGNDFG 144


>UniRef50_Q7S380 Cluster: Putative uncharacterized protein
           NCU04865.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU04865.1 - Neurospora crassa
          Length = 2574

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = +3

Query: 150 NRLQHPRYKKNSIPLCRTNTNTTLKILRRHCTSARRIGDAEGKVVGGYRVLL-PDGRLMT 326
           NRL H    +       T  +TTL  L + C S R  G++   +VGG  ++  PD  L  
Sbjct: 154 NRLSHFFDLRGPSMSVDTGCSTTLTALHQACQSLRS-GESTMSIVGGANIMFNPDMFLAM 212

Query: 327 VEYTVQGDSGFVPKISFDSNANPFGQGK 410
              T+    G     +FDS AN +G+G+
Sbjct: 213 SSMTLISKDG--RSWAFDSRANGYGRGE 238


>UniRef50_Q9V7U0 Cluster: Pro-resilin precursor; n=2; Drosophila
           melanogaster|Rep: Pro-resilin precursor - Drosophila
           melanogaster (Fruit fly)
          Length = 620

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = +3

Query: 285 GGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           G Y VLLPDGR   VEY      G+ P+I ++ +AN
Sbjct: 373 GQYNVLLPDGRKQIVEYEAD-QQGYRPQIRYEGDAN 407


>UniRef50_UPI0000DB728C Cluster: PREDICTED: similar to CG6305-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG6305-PA
           - Apis mellifera
          Length = 299

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +3

Query: 267 AEGKVVGG-YRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQG 407
           ++G +V G YRVLLPD R   V+Y     +G+   + ++  A  F +G
Sbjct: 203 SDGNIVQGEYRVLLPDSRTQIVKYMADDANGYTADVQYEGQAQ-FSRG 249


>UniRef50_UPI0000D5780C Cluster: PREDICTED: similar to CG6305-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG6305-PA - Tribolium castaneum
          Length = 232

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 18/44 (40%), Positives = 25/44 (56%)
 Frame = +3

Query: 246 SARRIGDAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISF 377
           S   I D + +  G YR+ LPDGR   V+YT    +GF  +IS+
Sbjct: 22  SHNAISDGD-QTKGEYRIQLPDGRTQVVKYTADWATGFHAQISY 64


>UniRef50_A1YLE4 Cluster: Cuticle protein CB6; n=1; Portunus
           pelagicus|Rep: Cuticle protein CB6 - Portunus pelagicus
           (Blue swimmer crab)
          Length = 220

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +3

Query: 285 GGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNA 389
           G Y V L DGR  TV Y V+G  G+V  + ++  A
Sbjct: 128 GVYSVQLSDGRKQTVNYVVEGKKGYVADVQYEGEA 162


>UniRef50_UPI00015B5FE4 Cluster: PREDICTED: similar to CG6305-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG6305-PA - Nasonia vitripennis
          Length = 250

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = +3

Query: 252 RRIGDAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNA 389
           R   D E  V G YRV LPDGR   V YT    +GF   + ++  A
Sbjct: 106 RETSDGE-TVRGEYRVQLPDGRTQIVTYTADWRTGFHADVRYEGEA 150


>UniRef50_Q7JZ94 Cluster: RE53044p; n=2; Sophophora|Rep: RE53044p -
           Drosophila melanogaster (Fruit fly)
          Length = 815

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFD 380
           D  G   G Y +LLPDGR+  V Y    D+GF   +SF+
Sbjct: 773 DLHGVTRGQYHILLPDGRIQNVIYHAD-DTGFHADVSFE 810


>UniRef50_Q6RKG1 Cluster: Polyketide synthase; n=1; Cochliobolus
           heterostrophus|Rep: Polyketide synthase - Cochliobolus
           heterostrophus (Drechslera maydis)
          Length = 2484

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 25/87 (28%), Positives = 42/87 (48%)
 Frame = +3

Query: 150 NRLQHPRYKKNSIPLCRTNTNTTLKILRRHCTSARRIGDAEGKVVGGYRVLLPDGRLMTV 329
           NRL H    + +     T  +TTL  L + C   R  G+++  VV G  ++L     +T+
Sbjct: 156 NRLSHYFDLRGASMSIDTGCSTTLTALHQACNDLRN-GESDMSVVSGANLMLNPDMFITM 214

Query: 330 EYTVQGDSGFVPKISFDSNANPFGQGK 410
             ++   S      +FDS AN +G+G+
Sbjct: 215 S-SIALISKDGRSFAFDSRANGYGRGE 240


>UniRef50_UPI0000DB7EC4 Cluster: PREDICTED: similar to CG15920-PA,
           isoform A, partial; n=1; Apis mellifera|Rep: PREDICTED:
           similar to CG15920-PA, isoform A, partial - Apis
           mellifera
          Length = 213

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = +3

Query: 270 EGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNA 389
           + +  G Y VLLPDGR   V+Y +  + G+ P + ++  A
Sbjct: 155 DNEATGAYHVLLPDGRTQIVDY-IADNGGYRPMVRYEGTA 193


>UniRef50_UPI0000DB7324 Cluster: PREDICTED: similar to CG6305-PA;
           n=2; Apocrita|Rep: PREDICTED: similar to CG6305-PA -
           Apis mellifera
          Length = 194

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = +3

Query: 267 AEGKVVGG-YRVLLPDGRLMTVEYTVQGDSGF 359
           ++G +V G YRV LPDGRL  V YT     GF
Sbjct: 146 SDGDIVRGEYRVQLPDGRLQIVRYTADWKHGF 177


>UniRef50_Q16X58 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 131

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +3

Query: 279 VVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           V GGY VL P G + TV Y V+G+SGF
Sbjct: 63  VHGGYGVLEPGGYVRTVHYEVEGNSGF 89


>UniRef50_Q7PSL5 Cluster: ENSANGP00000017262; n=2; Culicidae|Rep:
           ENSANGP00000017262 - Anopheles gambiae str. PEST
          Length = 193

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 285 GGYRVLLPDGRLMTVEYTVQGDSGFVPKISFD 380
           G Y VLLPDGR   VEY      G+ PKI+++
Sbjct: 72  GKYNVLLPDGRRQIVEYEAD-HKGYRPKITYE 102


>UniRef50_Q6ZUP0 Cluster: CDNA FLJ43499 fis, clone PEBLM2002749;
           n=2; Homo sapiens|Rep: CDNA FLJ43499 fis, clone
           PEBLM2002749 - Homo sapiens (Human)
          Length = 181

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 364 GTKPLSPCTVYSTVMSLPSGRSTRYPPT-TLPSASPIR 254
           GT+P  P   YSTV  +PS      PPT T PS+ P R
Sbjct: 19  GTRPKKPPCAYSTVHRVPSAPEGPCPPTSTAPSSGPPR 56


>UniRef50_UPI00015B5FE7 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 199

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 17/31 (54%), Positives = 20/31 (64%)
 Frame = +3

Query: 285 GGYRVLLPDGRLMTVEYTVQGDSGFVPKISF 377
           G Y VLLPDGR   VEY    D G+ PKI++
Sbjct: 117 GVYFVLLPDGRRQMVEYEADQD-GYRPKITY 146


>UniRef50_Q16XY8 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 462

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 13/39 (33%), Positives = 27/39 (69%)
 Frame = +3

Query: 270 EGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSN 386
           +G V G Y+V LPDGR+  V+Y +  ++G+   ++++++
Sbjct: 184 DGAVKGSYKVQLPDGRMQIVKY-IADNNGYRADVTYEND 221


>UniRef50_UPI0000D5771F Cluster: PREDICTED: similar to CG7076-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG7076-PA - Tribolium castaneum
          Length = 132

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +3

Query: 270 EGKVVGG-YRVLLPDGRLMTVEYTVQGDSGF 359
           +G VV G Y V+ PDG + TVEYT    SGF
Sbjct: 75  DGDVVKGQYSVVEPDGSVRTVEYTADKHSGF 105


>UniRef50_UPI0000499B21 Cluster: conserved hypothetical protein;
           n=2; Entamoeba histolytica HM-1:IMSS|Rep: conserved
           hypothetical protein - Entamoeba histolytica HM-1:IMSS
          Length = 2455

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -3

Query: 583 NKKNTITDIMPETKLSCKI--VS*VNDRKKKRLKIVIFCYFRYSETKHTNKPENILLKLY 410
           N KN   D      ++ K   ++ ++ + KK+ K VI CYFR ++ K    P NIL   Y
Sbjct: 475 NYKNFFMDFTNNVYVTTKELNITSISQKDKKKTKFVITCYFRCTD-KDLKDPSNILNAFY 533


>UniRef50_UPI000065D714 Cluster: Protein FAM21D; n=1; Takifugu
            rubripes|Rep: Protein FAM21D - Takifugu rubripes
          Length = 1265

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 22/66 (33%), Positives = 29/66 (43%)
 Frame = -3

Query: 430  NILLKLYFP*PKGLALLSKLILGTKPLSPCTVYSTVMSLPSGRSTRYPPTTLPSASPIRR 251
            N++L  +FP        S   +  KP  P +  S+V SLP    T  P   LP A+P R 
Sbjct: 845  NVILYFWFPRKWNFLSFSPQKVSDKPHKPDSSGSSVDSLPQASLTINPAALLPGAAPGRP 904

Query: 250  AEVQCL 233
              V  L
Sbjct: 905  GAVGLL 910


>UniRef50_Q3V6T1 Cluster: Cuticular protein; n=1; Tachypleus
           tridentatus|Rep: Cuticular protein - Tachypleus
           tridentatus (Japanese horseshoe crab)
          Length = 625

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 19/43 (44%), Positives = 23/43 (53%)
 Frame = +3

Query: 243 TSARRIGDAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKI 371
           +S    GD  GKV G Y +   DGR   V+YT  G  GF+ KI
Sbjct: 396 SSRSESGDTSGKVKGTYSLDDEDGRKRIVDYTA-GAEGFMAKI 437


>UniRef50_Q175B1 Cluster: Adult cuticle protein, putative; n=2;
           Aedes aegypti|Rep: Adult cuticle protein, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 181

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 16/35 (45%), Positives = 19/35 (54%)
 Frame = +3

Query: 270 EGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKIS 374
           EGKV G Y+V   DG L  VEY      GF  K++
Sbjct: 116 EGKVKGVYKVAESDGTLRIVEYEADDKKGFEAKVT 150


>UniRef50_UPI0000D55C1A Cluster: PREDICTED: similar to CG6305-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG6305-PA - Tribolium castaneum
          Length = 180

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           +V G YRV LPDGR   V Y     +GF   + ++  A+
Sbjct: 90  QVRGEYRVQLPDGRTQIVTYYADWQTGFHADVRYEGEAH 128


>UniRef50_Q6CEI5 Cluster: Yarrowia lipolytica chromosome B of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome B of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 453

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = -2

Query: 329 DRHESTVRKK-HSVPPNDFAFSVTDSSRRSTMSSQDLQRRICIRTA*GDTVLLV 171
           D  E TVR + HSVP ND A    D + +S +S     R   + T   D VL V
Sbjct: 69  DTGECTVRLEVHSVPDNDIAIEFADKTLQSALSGFLQDRDESLETTFADDVLFV 122


>UniRef50_UPI0000D5600F Cluster: PREDICTED: similar to CG1919-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1919-PA - Tribolium castaneum
          Length = 145

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 4/50 (8%)
 Frame = +3

Query: 270 EGKVV-GGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNA---NPFGQG 407
           +G VV G Y ++ PDG + TV YT    +GF   +S   +A    P G G
Sbjct: 91  DGDVVKGSYSLVEPDGTIRTVHYTADDHNGFNAVVSRSGHAVHPTPIGLG 140


>UniRef50_Q0EWV6 Cluster: Putative uncharacterized protein; n=1;
           Mariprofundus ferrooxydans PV-1|Rep: Putative
           uncharacterized protein - Mariprofundus ferrooxydans
           PV-1
          Length = 294

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = -2

Query: 407 SLTEGVS-VTIETDFGYKATVALYCVLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSS 231
           SL E V+ V +  D+      A   VL R  STVR++H   PN+      D  R S M  
Sbjct: 63  SLREAVAAVLVSDDWKLLFVEAEDQVLQRRFSTVRRRHPFAPNEDLMEAIDQERDSLMPV 122

Query: 230 QDLQRRI 210
           +++   I
Sbjct: 123 REMANLI 129


>UniRef50_Q8I3P9 Cluster: Putative uncharacterized protein PFE1070c;
           n=2; Plasmodium|Rep: Putative uncharacterized protein
           PFE1070c - Plasmodium falciparum (isolate 3D7)
          Length = 1345

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = -3

Query: 646 FYLFNKQRPQN*KRSRLIILIN-KKNTITDIMPETKLSCKIVS*VNDRKKKRLKIV-IFC 473
           F  F+    Q  KRSR +   N KK     +     ++   +S +N +KKK+  I+    
Sbjct: 530 FLTFHIYVKQIMKRSRTLTFFNMKKKKNVKLYLVKDITMNRISCINKKKKKKKFIINTDT 589

Query: 472 YFRYSETKHTNKPENILLKLY 410
           +F Y+E K  N+ E+  L  Y
Sbjct: 590 FFEYNEKKRNNRIEDSSLAYY 610


>UniRef50_Q4V6L8 Cluster: IP11372p; n=3; Sophophora|Rep: IP11372p -
           Drosophila melanogaster (Fruit fly)
          Length = 424

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           D +G V G Y VL PDG + TV YT     GF
Sbjct: 78  DGDG-VKGHYSVLEPDGSIRTVHYTADAKKGF 108


>UniRef50_Q170Z6 Cluster: Pupal cuticle protein, putative; n=2;
           Culicidae|Rep: Pupal cuticle protein, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 248

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +3

Query: 270 EGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFD 380
           E ++ G Y V  PDG+L  V+YT    SGF  ++  D
Sbjct: 152 EDELHGEYTVQQPDGKLRVVKYTANKHSGFHAEVLID 188


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 649,224,502
Number of Sequences: 1657284
Number of extensions: 12457693
Number of successful extensions: 34045
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 32878
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34029
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 59265488880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -