SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20001
         (745 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=23...   206   3e-52
UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931; roo...   203   4e-51
UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precur...   169   6e-41
UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock...   137   2e-31
UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome sho...   134   3e-30
UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep: ...   132   9e-30
UniRef50_A2Y3V8 Cluster: Putative uncharacterized protein; n=4; ...   130   3e-29
UniRef50_A0DHP4 Cluster: Chromosome undetermined scaffold_50, wh...   130   4e-29
UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2; ...   130   5e-29
UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular ...   128   1e-28
UniRef50_P02826 Cluster: Heat shock 70 kDa protein cognate 1; n=...   125   1e-27
UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia stip...   125   1e-27
UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 7...   123   5e-27
UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n...   123   5e-27
UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial precur...   122   9e-27
UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|R...   122   1e-26
UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular...   119   7e-26
UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular...   116   6e-25
UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3; ...   116   8e-25
UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock...   115   1e-24
UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock...   114   2e-24
UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular...   112   1e-23
UniRef50_UPI000058655A Cluster: PREDICTED: similar to heat shock...   110   3e-23
UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella nata...   109   7e-23
UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellula...   105   2e-21
UniRef50_Q4P628 Cluster: Putative uncharacterized protein; n=1; ...   103   4e-21
UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular ...   103   6e-21
UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas vaginali...   102   8e-21
UniRef50_Q2VA67 Cluster: Putative heat schock protein 70; n=1; T...   102   1e-20
UniRef50_Q9UQC1 Cluster: Heat shock protein 72; n=10; Fungi/Meta...   101   2e-20
UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n...    99   6e-20
UniRef50_A2Y4X8 Cluster: Putative uncharacterized protein; n=1; ...    99   6e-20
UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonosp...   100   8e-20
UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9; ...   100   8e-20
UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Re...    98   2e-19
UniRef50_Q3SD91 Cluster: Cytosol-type hsp70; n=1; Paramecium tet...    97   4e-19
UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella natan...    93   7e-18
UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago...    93   7e-18
UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2; Panspora...    93   9e-18
UniRef50_Q0VDF9 Cluster: Heat shock 70 kDa protein 14; n=25; Eut...    90   5e-17
UniRef50_A3CIL0 Cluster: Putative uncharacterized protein; n=2; ...    89   8e-17
UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial ...    89   8e-17
UniRef50_A2WTX8 Cluster: Putative uncharacterized protein; n=1; ...    89   1e-16
UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein...    88   2e-16
UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia stip...    88   2e-16
UniRef50_O88687 Cluster: Heat shock protein 70; n=2; Euteleostom...    86   1e-15
UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago...    86   1e-15
UniRef50_UPI00015B551B Cluster: PREDICTED: similar to ENSANGP000...    84   4e-15
UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter ...    82   2e-14
UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular ...    81   2e-14
UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29; Proteobac...    81   3e-14
UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3; Planctomyc...    81   3e-14
UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila aurari...    80   5e-14
UniRef50_UPI0000499AA8 Cluster: hsp70 family protein; n=1; Entam...    80   7e-14
UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole gen...    78   3e-13
UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2; Enta...    77   3e-13
UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock...    77   5e-13
UniRef50_Q9M7S4 Cluster: Heat shock protein 70; n=1; Triticum ae...    76   8e-13
UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38; Bacteria|...    76   1e-12
UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    75   1e-12
UniRef50_Q96269 Cluster: Heat-shock protein; n=14; Magnoliophyta...    75   2e-12
UniRef50_A7RF55 Cluster: Predicted protein; n=1; Nematostella ve...    74   3e-12
UniRef50_Q9VUC1 Cluster: CG6603-PA, isoform A; n=7; Endopterygot...    74   4e-12
UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:...    73   6e-12
UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;...    73   6e-12
UniRef50_Q4SW20 Cluster: Chromosome undetermined SCAF13693, whol...    72   2e-11
UniRef50_Q73CC4 Cluster: Dnak protein, truncation; n=1; Bacillus...    72   2e-11
UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodosp...    72   2e-11
UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27; P...    72   2e-11
UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2; Gammapro...    71   2e-11
UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum fer...    71   3e-11
UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1; ...    71   3e-11
UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1; Aca...    71   3e-11
UniRef50_Q7ZUM5 Cluster: Heat shock protein 4; n=20; Euteleostom...    70   5e-11
UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep...    70   7e-11
UniRef50_A5AUN6 Cluster: Putative uncharacterized protein; n=1; ...    70   7e-11
UniRef50_O59838 Cluster: Heat shock protein homolog pss1; n=21; ...    70   7e-11
UniRef50_O14992 Cluster: HS24/P52; n=8; Eutheria|Rep: HS24/P52 -...    69   9e-11
UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188; Bacteria...    69   1e-10
UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1; ...    69   2e-10
UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3; Psychrobacter...    68   2e-10
UniRef50_Q7M080 Cluster: DnaK-type molecular chaperone; n=1; Cri...    67   4e-10
UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone...    67   4e-10
UniRef50_Q1CWT5 Cluster: DnaK family protein; n=2; Cystobacterin...    67   4e-10
UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gamb...    67   4e-10
UniRef50_A6C7U8 Cluster: DnaK protein (Heat shock protein), C-te...    67   5e-10
UniRef50_A2ECF5 Cluster: DnaK protein; n=1; Trichomonas vaginali...    67   5e-10
UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus...    66   6e-10
UniRef50_Q00YD5 Cluster: Heat shock protein 91-Arabidopsis thali...    66   6e-10
UniRef50_Q92598 Cluster: Heat shock protein 105 kDa; n=92; Eumet...    66   6e-10
UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas s...    66   9e-10
UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lambl...    66   9e-10
UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    66   9e-10
UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular or...    66   1e-09
UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    66   1e-09
UniRef50_P48723 Cluster: Stress 70 protein chaperone microsome-a...    66   1e-09
UniRef50_Q06068 Cluster: 97 kDa heat shock protein; n=3; Strongy...    66   1e-09
UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera a...    65   2e-09
UniRef50_UPI0000D56BFD Cluster: PREDICTED: similar to CG8937-PA,...    65   2e-09
UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus ...    65   2e-09
UniRef50_Q5C1F3 Cluster: SJCHGC04997 protein; n=1; Schistosoma j...    65   2e-09
UniRef50_A6EQS3 Cluster: Heat shock protein Hsp70; n=1; unidenti...    64   3e-09
UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=...    64   3e-09
UniRef50_A2VD43 Cluster: Heat shock protein 14; n=3; Clupeocepha...    64   3e-09
UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26; Bacteria|...    64   5e-09
UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG070...    64   5e-09
UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168, w...    64   5e-09
UniRef50_UPI0000510557 Cluster: COG0443: Molecular chaperone; n=...    63   6e-09
UniRef50_Q9SAB1 Cluster: F25C20.19 protein; n=3; core eudicotyle...    63   6e-09
UniRef50_Q4XZF4 Cluster: Putative uncharacterized protein; n=1; ...    63   6e-09
UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4; Planctomyc...    63   8e-09
UniRef50_Q64YI6 Cluster: Chaperone protein DnaK; n=2; Bacteroide...    62   1e-08
UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1; N...    62   1e-08
UniRef50_A4J964 Cluster: Heat shock protein 70; n=2; Clostridial...    62   1e-08
UniRef50_Q05036 Cluster: Uncharacterized protein C30C11.4; n=2; ...    62   1e-08
UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein), C-te...    62   1e-08
UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: Dna...    62   1e-08
UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone...    62   1e-08
UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter ...    62   1e-08
UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1; Methanospir...    62   1e-08
UniRef50_Q6F9S6 Cluster: Chaperone protein; n=2; Acinetobacter|R...    62   2e-08
UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma marg...    62   2e-08
UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1; Planctom...    62   2e-08
UniRef50_UPI00006CA81B Cluster: dnaK protein; n=1; Tetrahymena t...    61   2e-08
UniRef50_Q4RM18 Cluster: Chromosome 10 SCAF15019, whole genome s...    61   2e-08
UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein), HSP7...    61   2e-08
UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13; Rickett...    61   2e-08
UniRef50_Q86JV8 Cluster: Similar to heat shock protein; n=2; Dic...    61   2e-08
UniRef50_Q9Y4L1 Cluster: Hypoxia up-regulated protein 1 precurso...    61   2e-08
UniRef50_A7HBX9 Cluster: 2-alkenal reductase precursor; n=7; Cys...    61   3e-08
UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera a...    61   3e-08
UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshime...    60   4e-08
UniRef50_A7QL81 Cluster: Chromosome chr3 scaffold_117, whole gen...    60   4e-08
UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14; R...    60   6e-08
UniRef50_A6NJU0 Cluster: Uncharacterized protein HSPA14; n=2; Eu...    60   7e-08
UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1; Syntroph...    59   1e-07
UniRef50_A5B0E9 Cluster: Putative uncharacterized protein; n=1; ...    59   1e-07
UniRef50_A2ECV1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    59   1e-07
UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena ...    59   1e-07
UniRef50_A2EPF1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    59   1e-07
UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia bu...    58   2e-07
UniRef50_A6C7U7 Cluster: DnaK protein (Heat shock protein), HSP7...    58   2e-07
UniRef50_A4QNX8 Cluster: Zgc:162281 protein; n=6; Eumetazoa|Rep:...    58   2e-07
UniRef50_P32590 Cluster: Heat shock protein homolog SSE2; n=20; ...    58   2e-07
UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA...    58   3e-07
UniRef50_Q1CY00 Cluster: DnaK family protein; n=2; Cystobacterin...    58   3e-07
UniRef50_Q010Y3 Cluster: DNAK_GLOVI Chaperone protein dnaK; n=1;...    58   3e-07
UniRef50_A2EAK8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    58   3e-07
UniRef50_A7BR82 Cluster: Heat shock protein Hsp70; n=1; Beggiato...    57   4e-07
UniRef50_A4AEG2 Cluster: Putative uncharacterized protein; n=1; ...    57   4e-07
UniRef50_A2E407 Cluster: DnaK protein; n=1; Trichomonas vaginali...    57   4e-07
UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4; Cystobacterin...    57   5e-07
UniRef50_P77319 Cluster: Chaperone protein hscC; n=19; Gammaprot...    57   5e-07
UniRef50_Q3W504 Cluster: Heat shock protein Hsp70; n=3; Actinomy...    56   7e-07
UniRef50_A5MZQ7 Cluster: DnaK9; n=1; Clostridium kluyveri DSM 55...    56   7e-07
UniRef50_Q22CW2 Cluster: Heat shock protein 70 homolog; n=1; Tet...    56   7e-07
UniRef50_Q20752 Cluster: Putative uncharacterized protein stc-1;...    56   7e-07
UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2; Anaeromyxob...    56   1e-06
UniRef50_A2G573 Cluster: DnaK protein; n=2; Trichomonas vaginali...    56   1e-06
UniRef50_A6CBP2 Cluster: Dnak protein, truncation; n=1; Planctom...    55   2e-06
UniRef50_A3BBU4 Cluster: Putative uncharacterized protein; n=2; ...    55   2e-06
UniRef50_A2DHP3 Cluster: Heat shock protein, putative; n=1; Tric...    55   2e-06
UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena t...    55   2e-06
UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera aphi...    55   2e-06
UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacif...    55   2e-06
UniRef50_Q54GD7 Cluster: Heat shock protein Hsp70 family protein...    55   2e-06
UniRef50_Q8YNT4 Cluster: DnaK-type molecular chaperone; n=2; Nos...    54   3e-06
UniRef50_A2F0R7 Cluster: DnaK protein; n=2; Trichomonas vaginali...    54   3e-06
UniRef50_UPI000038E267 Cluster: hypothetical protein Faci_030017...    54   4e-06
UniRef50_A5N5I5 Cluster: DnaK1; n=1; Clostridium kluyveri DSM 55...    53   6e-06
UniRef50_A3FQM0 Cluster: Heat shock 105kD; heat shock 105kD alph...    53   6e-06
UniRef50_A2F432 Cluster: DnaK protein; n=1; Trichomonas vaginali...    53   6e-06
UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n...    53   6e-06
UniRef50_Q7M2S5 Cluster: DnaK-type molecular chaperone; n=1; Sus...    53   9e-06
UniRef50_A7AN53 Cluster: DnaK family protein; n=1; Babesia bovis...    53   9e-06
UniRef50_A2DR00 Cluster: DnaK protein; n=7; Trichomonas vaginali...    53   9e-06
UniRef50_A0DJC4 Cluster: Chromosome undetermined scaffold_53, wh...    53   9e-06
UniRef50_A6UND5 Cluster: 2-alkenal reductase; n=1; Methanococcus...    53   9e-06
UniRef50_A4ZY06 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q4Q9A4 Cluster: Heat shock 70 protein-like protein; n=3...    52   1e-05
UniRef50_UPI0000E474BD Cluster: PREDICTED: hypothetical protein;...    52   1e-05
UniRef50_UPI0000499107 Cluster: 70 kDa heat shock protein; n=1; ...    52   1e-05
UniRef50_UPI0000499E28 Cluster: hsp70 family protein; n=1; Entam...    52   2e-05
UniRef50_Q4CS27 Cluster: Putative uncharacterized protein; n=3; ...    52   2e-05
UniRef50_O15797 Cluster: CG4; n=10; Plasmodium|Rep: CG4 - Plasmo...    52   2e-05
UniRef50_UPI0000499681 Cluster: heat shock protein 70; n=1; Enta...    51   3e-05
UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative g...    51   3e-05
UniRef50_UPI0000DC15CB Cluster: UPI0000DC15CB related cluster; n...    50   5e-05
UniRef50_Q4QDQ2 Cluster: Heat shock protein, putative; n=5; Tryp...    50   5e-05
UniRef50_A5MZQ6 Cluster: DnaK8; n=2; Clostridium kluyveri DSM 55...    50   6e-05
UniRef50_O46067 Cluster: CG2918-PA; n=3; Diptera|Rep: CG2918-PA ...    50   6e-05
UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia intest...    50   8e-05
UniRef50_UPI00005A2730 Cluster: PREDICTED: similar to heat shock...    49   1e-04
UniRef50_A6NYB9 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q0WM51 Cluster: HSP like protein; n=11; Magnoliophyta|R...    49   1e-04
UniRef50_O23508 Cluster: Growth regulator like protein; n=6; Mag...    49   1e-04
UniRef50_Q655N4 Cluster: Putative heat-shock protein; n=2; Oryza...    49   1e-04
UniRef50_Q9XZM1 Cluster: Heat shock protein HSP70-2; n=3; Entamo...    49   1e-04
UniRef50_A2DWC1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    49   1e-04
UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginali...    49   1e-04
UniRef50_Q2H062 Cluster: Putative uncharacterized protein; n=2; ...    49   1e-04
UniRef50_UPI0000660D8E Cluster: Homolog of Homo sapiens "heat sh...    48   2e-04
UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2; Actinomy...    48   2e-04
UniRef50_Q22758 Cluster: Putative uncharacterized protein; n=2; ...    48   2e-04
UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1; Saccharo...    48   2e-04
UniRef50_UPI0000498B17 Cluster: hsp70 family protein; n=1; Entam...    48   3e-04
UniRef50_UPI0000F1F58C Cluster: PREDICTED: similar to Heat shock...    47   4e-04
UniRef50_Q22515 Cluster: Putative uncharacterized protein; n=3; ...    47   6e-04
UniRef50_UPI0000498BE2 Cluster: chaperone protein dnaK; n=2; Ent...    46   7e-04
UniRef50_UPI0000498597 Cluster: chaperone protein dnaK; n=1; Ent...    46   7e-04
UniRef50_Q3UYY6 Cluster: 13 days embryo forelimb cDNA, RIKEN ful...    46   7e-04
UniRef50_Q2QXK2 Cluster: DnaK protein, expressed; n=2; Oryza sat...    46   7e-04
UniRef50_Q4RRT3 Cluster: Chromosome 16 SCAF15002, whole genome s...    46   0.001
UniRef50_Q7YUE0 Cluster: Hsp70 protein; n=1; Milnesium tardigrad...    46   0.001
UniRef50_A2FKE2 Cluster: DnaK protein; n=3; Trichomonas vaginali...    46   0.001
UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1; Enta...    46   0.001
UniRef50_A6GJQ9 Cluster: Heat shock protein Hsp70; n=1; Plesiocy...    46   0.001
UniRef50_A0NUH2 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q9GYV8 Cluster: 70-kDa heat shock protein; n=5; Entamoe...    46   0.001
UniRef50_A2F7Z8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    46   0.001
UniRef50_UPI0000D55C7E Cluster: PREDICTED: similar to CG2918-PA;...    45   0.002
UniRef50_A2G8T1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    45   0.002
UniRef50_A2EFJ4 Cluster: DnaK protein; n=1; Trichomonas vaginali...    45   0.002
UniRef50_A2DZ76 Cluster: DnaK protein; n=1; Trichomonas vaginali...    45   0.002
UniRef50_A2R006 Cluster: Contig An12c0210, complete genome; n=1;...    45   0.002
UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM 55...    44   0.003
UniRef50_Q57VU9 Cluster: Heat shock 70 kDa protein, putative; n=...    44   0.003
UniRef50_A0C553 Cluster: Chromosome undetermined scaffold_15, wh...    44   0.003
UniRef50_A5N5I8 Cluster: DnaK4; n=1; Clostridium kluyveri DSM 55...    44   0.004
UniRef50_A1FNI8 Cluster: Glutamate dehydrogenase; n=1; Pseudomon...    44   0.004
UniRef50_Q9S8V5 Cluster: ATP-binding HSP70 homolog; n=4; cellula...    44   0.004
UniRef50_A2XF45 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q8RH06 Cluster: Putative uncharacterized protein FN0115...    44   0.005
UniRef50_Q4ETY1 Cluster: Putative uncharacterized protein; n=2; ...    44   0.005
UniRef50_A6EMR6 Cluster: Heat shock protein Hsp70; n=1; unidenti...    44   0.005
UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM 55...    44   0.005
UniRef50_A4IC10 Cluster: Putative uncharacterized protein; n=3; ...    44   0.005
UniRef50_Q1D211 Cluster: DnaK family protein; n=1; Myxococcus xa...    43   0.007
UniRef50_Q1D082 Cluster: DnaK family protein; n=2; Cystobacterin...    43   0.007
UniRef50_Q1E6G2 Cluster: Heat shock protein 70 homolog; n=17; Pe...    43   0.007
UniRef50_A7SM46 Cluster: Predicted protein; n=1; Nematostella ve...    43   0.009
UniRef50_A4RY30 Cluster: Heat Shock Protein 70, ER lumen; n=2; O...    42   0.016
UniRef50_Q17291 Cluster: Heat shock protein 70A; n=1; Bursaphele...    42   0.016
UniRef50_Q1VU26 Cluster: Heat shock protein Hsp70; n=2; Bacteroi...    42   0.021
UniRef50_Q1NQZ1 Cluster: Glutamate dehydrogenase precursor; n=1;...    42   0.021
UniRef50_A2UL28 Cluster: Glutamate dehydrogenase; n=5; Enterobac...    42   0.021
UniRef50_A7QHP2 Cluster: Chromosome chr8 scaffold_99, whole geno...    42   0.021
UniRef50_A7PR73 Cluster: Chromosome chr14 scaffold_26, whole gen...    42   0.021
UniRef50_Q01M68 Cluster: OSIGBa0114M03.5 protein; n=4; Oryza sat...    41   0.028
UniRef50_A2FVJ6 Cluster: DnaK protein; n=1; Trichomonas vaginali...    41   0.028
UniRef50_A2DMZ9 Cluster: Putative uncharacterized protein; n=5; ...    41   0.037
UniRef50_UPI000049A5EA Cluster: hsp70 family protein; n=1; Entam...    40   0.049
UniRef50_A2FPJ8 Cluster: Heat shock protein SSB-related protein;...    40   0.049
UniRef50_A5AJL9 Cluster: Putative uncharacterized protein; n=1; ...    40   0.065
UniRef50_A7AWJ8 Cluster: Tetratricopeptide repeat domain contain...    40   0.065
UniRef50_A2FYV4 Cluster: DnaK protein; n=1; Trichomonas vaginali...    40   0.065
UniRef50_A2E4A6 Cluster: DnaK protein; n=2; Trichomonas vaginali...    40   0.065
UniRef50_A2DQ03 Cluster: DnaK protein; n=1; Trichomonas vaginali...    40   0.065
UniRef50_A3LSS8 Cluster: Stress-seventy subfamily A; n=1; Pichia...    40   0.065
UniRef50_Q9TX41 Cluster: 200 kDa wall antigen; n=1; Cryptosporid...    40   0.085
UniRef50_A2EMY0 Cluster: DnaK protein; n=4; Trichomonas vaginali...    40   0.085
UniRef50_Q8SWH2 Cluster: Similarity to HSP70-RELATED PROTEIN; n=...    40   0.085
UniRef50_Q4P3F6 Cluster: Putative uncharacterized protein; n=1; ...    40   0.085
UniRef50_P87142 Cluster: Heat shock protein 70 homolog C57A7.12;...    40   0.085
UniRef50_A0ZXN0 Cluster: Heat shock protein 70-like; n=1; Fig le...    39   0.11 
UniRef50_Q4Q5R6 Cluster: Putative uncharacterized protein; n=3; ...    39   0.11 
UniRef50_UPI0000DB7485 Cluster: PREDICTED: similar to CG2918-PA;...    39   0.15 
UniRef50_UPI000049A3E9 Cluster: 70 kDa heat shock protein; n=2; ...    39   0.15 
UniRef50_A7PZE7 Cluster: Chromosome chr15 scaffold_40, whole gen...    38   0.20 
UniRef50_Q9SRU2 Cluster: F14P3.9 protein; n=3; Brassicales|Rep: ...    38   0.26 
UniRef50_Q9SKY8 Cluster: 70kD heat shock protein; n=6; Magnoliop...    38   0.26 
UniRef50_A5ANY6 Cluster: Putative uncharacterized protein; n=1; ...    38   0.26 
UniRef50_A2DQX2 Cluster: DnaK protein; n=1; Trichomonas vaginali...    38   0.26 
UniRef50_A4EA23 Cluster: Putative uncharacterized protein; n=1; ...    38   0.34 
UniRef50_Q22E65 Cluster: DnaK protein; n=1; Tetrahymena thermoph...    38   0.34 
UniRef50_Q4P629 Cluster: Putative uncharacterized protein; n=1; ...    38   0.34 
UniRef50_Q3WFH0 Cluster: Heat shock protein Hsp70; n=1; Frankia ...    37   0.46 
UniRef50_Q08P77 Cluster: Chaperone protein DnaK, putative; n=1; ...    37   0.46 
UniRef50_A1G644 Cluster: Heat shock protein 70; n=2; Salinispora...    37   0.46 
UniRef50_Q3XWY0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.60 
UniRef50_A5VT75 Cluster: Putative NAD-specific glutamate dehydro...    37   0.60 
UniRef50_A0CZG2 Cluster: Chromosome undetermined scaffold_32, wh...    37   0.60 
UniRef50_Q55Y28 Cluster: Putative uncharacterized protein; n=2; ...    37   0.60 
UniRef50_Q7UQD6 Cluster: Probable thioredoxin related protein; n...    36   0.80 
UniRef50_Q5LSW4 Cluster: Putative uncharacterized protein; n=1; ...    36   0.80 
UniRef50_Q52V38 Cluster: Heat shock protein 70-like; n=4; Mint v...    36   1.1  
UniRef50_Q98BE0 Cluster: DnaK-type molecular chaperone; DnaK; n=...    36   1.1  
UniRef50_Q3VZ88 Cluster: Heat shock protein Hsp70; n=1; Frankia ...    36   1.1  
UniRef50_Q9VSI1 Cluster: CG7182-PA; n=2; Sophophora|Rep: CG7182-...    36   1.1  
UniRef50_A2FS75 Cluster: DnaK protein; n=1; Trichomonas vaginali...    36   1.1  
UniRef50_P38788 Cluster: Ribosome-associated complex subunit SSZ...    36   1.1  
UniRef50_UPI00005A5FFD Cluster: PREDICTED: similar to heat shock...    36   1.4  
UniRef50_A0W7A3 Cluster: Heat shock protein, HSP70 family; n=4; ...    36   1.4  
UniRef50_A0UQH1 Cluster: Glutamate dehydrogenase; n=14; Proteoba...    36   1.4  
UniRef50_A2F6W8 Cluster: DnaK protein; n=1; Trichomonas vaginali...    36   1.4  
UniRef50_A2EVQ1 Cluster: DnaK protein; n=1; Trichomonas vaginali...    36   1.4  
UniRef50_A1XM67 Cluster: Heat shock protein Hsp70-6; n=1; Blasto...    36   1.4  
UniRef50_Q01UV8 Cluster: Molecular chaperone; n=1; Solibacter us...    35   1.8  
UniRef50_Q5CTE6 Cluster: APG-1 like HSP70 domain containing prot...    35   1.8  
UniRef50_A2E5D4 Cluster: DnaK protein; n=3; Trichomonas vaginali...    35   1.8  
UniRef50_Q2INJ2 Cluster: Putative NAD-specific glutamate dehydro...    35   2.4  
UniRef50_Q6L4S6 Cluster: Putative uncharacterized protein P0663C...    35   2.4  
UniRef50_Q6CM78 Cluster: Similarities with sp|Q12355 Saccharomyc...    35   2.4  
UniRef50_Q1NCH4 Cluster: Putative NAD-specific glutamate dehydro...    34   3.2  
UniRef50_A7DID8 Cluster: Glutamate dehydrogenase; n=14; Alphapro...    34   3.2  
UniRef50_A0GV00 Cluster: Putative NAD-specific glutamate dehydro...    34   3.2  
UniRef50_A7PMW8 Cluster: Chromosome chr14 scaffold_21, whole gen...    34   3.2  
UniRef50_A7APN5 Cluster: Putative uncharacterized protein; n=1; ...    34   3.2  
UniRef50_Q9HHC0 Cluster: Putative glutamate dehydrogenase; n=1; ...    34   3.2  
UniRef50_Q4SWT1 Cluster: Chromosome undetermined SCAF13528, whol...    34   4.2  
UniRef50_Q66239 Cluster: 65-kDa protein; n=19; Citrus tristeza v...    34   4.2  
UniRef50_A0YV37 Cluster: Heat shock protein 70; n=2; Oscillatori...    34   4.2  
UniRef50_A0NRW0 Cluster: Heat shock protein Hsp70; n=1; Stappia ...    33   5.6  
UniRef50_Q6ZLB3 Cluster: Putative uncharacterized protein OJ1014...    33   5.6  
UniRef50_Q06YR5 Cluster: Possibile polyglycylated protein 1; n=2...    33   5.6  
UniRef50_Q1NR74 Cluster: Heat shock protein Hsp70; n=3; Proteoba...    33   7.4  
UniRef50_A2YAM2 Cluster: Putative uncharacterized protein; n=3; ...    33   7.4  
UniRef50_A2ET78 Cluster: Putative uncharacterized protein; n=1; ...    33   7.4  
UniRef50_UPI00015C5E7A Cluster: hypothetical protein CKO_02913; ...    33   9.8  
UniRef50_A0PTC6 Cluster: Chaperone protein DnaK1; n=3; Mycobacte...    33   9.8  
UniRef50_Q388G4 Cluster: Putative uncharacterized protein; n=1; ...    33   9.8  
UniRef50_Q5KGD4 Cluster: Putative uncharacterized protein; n=1; ...    33   9.8  

>UniRef50_P11142 Cluster: Heat shock cognate 71 kDa protein; n=239;
           Eukaryota|Rep: Heat shock cognate 71 kDa protein - Homo
           sapiens (Human)
          Length = 646

 Score =  206 bits (504), Expect = 3e-52
 Identities = 120/205 (58%), Positives = 132/205 (64%), Gaps = 6/205 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFS 416
           M PT T +    +        ++      + +     M  N   R  ++V    +TK F 
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVV-----QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY 115

Query: 417 PRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P +                L            AYFNDSQRQATKDAGTI+GLNVLRIINE
Sbjct: 116 PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE 175

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 176 PTAAAIAYGLDKKVGAERNVLIFDL 200



 Score =  134 bits (323), Expect = 3e-30
 Identities = 58/76 (76%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVSS
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEAYLGK
Sbjct: 122 MVLTKMKEIAEAYLGK 137



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILTIEDGIFEVKSTAGDT 226


>UniRef50_P08107 Cluster: Heat shock 70 kDa protein 1; n=931;
           root|Rep: Heat shock 70 kDa protein 1 - Homo sapiens
           (Human)
          Length = 641

 Score =  203 bits (495), Expect = 4e-51
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-29
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>UniRef50_P11021 Cluster: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78); n=736;
           root|Rep: 78 kDa glucose-regulated protein precursor
           (GRP 78) (Heat shock 70 kDa protein 5) (Immunoglobulin
           heavy chain-binding protein) (BiP) (Endoplasmic
           reticulum lumenal Ca(2+)-binding protein grp78) - Homo
           sapiens (Human)
          Length = 654

 Score =  169 bits (411), Expect = 6e-41
 Identities = 101/201 (50%), Positives = 126/201 (62%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P  
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPEN 90

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV-----KTKPFSPRKS 428
           T +    +     +      P+    +  L       +++ +I+V     +TK F+P + 
Sbjct: 91  TVFDAKRLIGRTWN-----DPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEI 145

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAA
Sbjct: 146 SAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAA 205

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK+  GE+N+L+FDL
Sbjct: 206 AIAYGLDKR-EGEKNILVFDL 225



 Score = 98.3 bits (234), Expect = 2e-19
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY-KGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V    G+ KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVLTKMKETAEAYLGK
Sbjct: 147 AMVLTKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>UniRef50_UPI0000E23955 Cluster: PREDICTED: similar to heat shock
           protein 2; n=1; Pan troglodytes|Rep: PREDICTED: similar
           to heat shock protein 2 - Pan troglodytes
          Length = 640

 Score =  137 bits (332), Expect = 2e-31
 Identities = 91/226 (40%), Positives = 106/226 (46%), Gaps = 3/226 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVP 434
            PT              +    +        R+       + +   R + +P S R+  P
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKCKXSTRGRPRPSSQRRYPP 122

Query: 435 WCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP--TAA 605
           W              A C   S            +  +      G         P    +
Sbjct: 123 WSSRRXRRSRKPTWGARCTARSXRSRPISTTRSARPPRTQAPSRGSMCCASSTSPRRRPS 182

Query: 606 AIAYGLDKKGTGERNVLIFDLAAVPSTCPSLPSRMVSSR*NPPPAT 743
             A+         R       A   STCPS PSRM SSR +P PAT
Sbjct: 183 PTAWTRRAARAARRTCSSLTWAVALSTCPSXPSRMASSRXSPRPAT 228



 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 38/51 (74%), Positives = 44/51 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDK 406
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK K + +G  +
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKCKXSTRGRPR 113


>UniRef50_Q4T4R0 Cluster: Chromosome 3 SCAF9564, whole genome
           shotgun sequence; n=3; Fungi/Metazoa group|Rep:
           Chromosome 3 SCAF9564, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 414

 Score =  134 bits (323), Expect = 3e-30
 Identities = 81/167 (48%), Positives = 97/167 (58%), Gaps = 3/167 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+
Sbjct: 4   AEGLAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAL 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P    ++ +    +  K+          L    V+    + +  +  K   K F P + 
Sbjct: 64  NPNN--TVFDAKRLIGRKLDDPTVQADVKLWPFKVIGDGGKPKIQVEYKGEEKSFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISG 566
                          L    ++      AYFNDSQRQATKDAG I+G
Sbjct: 122 SSMVLVKMKEIAEAYLGQKVSDAVVTVPAYFNDSQRQATKDAGVIAG 168



 Score =  132 bits (318), Expect = 1e-29
 Identities = 57/76 (75%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +PNNT+FDAKRLIGRK +D TVQAD+K WPF+V+ DGGKPKI+V YKGE+K+F+PEE+SS
Sbjct: 64  NPNNTVFDAKRLIGRKLDDPTVQADVKLWPFKVIGDGGKPKIQVEYKGEEKSFYPEEISS 123

Query: 434 MVLTKMKETAEAYLGK 481
           MVL KMKE AEAYLG+
Sbjct: 124 MVLVKMKEIAEAYLGQ 139


>UniRef50_Q7R2I7 Cluster: GLP_623_6850_8883; n=3; Eukaryota|Rep:
           GLP_623_6850_8883 - Giardia lamblia ATCC 50803
          Length = 677

 Score =  132 bits (319), Expect = 9e-30
 Identities = 89/209 (42%), Positives = 118/209 (56%), Gaps = 17/209 (8%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPTT 266
           +GIDLGTTYSCV V + G+VEII N+ G R TPSYVAFT D ERL+GDAAKN   ++P  
Sbjct: 31  IGIDLGTTYSCVAVSRAGQVEIIPNELGARVTPSYVAFTADGERLVGDAAKNYAPISPEN 90

Query: 267 -----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
                      ++  P V  D+  K+L  K     G   + +   NL       ++ K  
Sbjct: 91  TIFDVKRLIGRKFDDPEVQKDM--KLLPYKVINKDGRPFVQLSGTNLPK----ELQNKIM 144

Query: 414 SPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIIN 590
           SP +                L     +      AYF+DSQR ATKDAG I+GL+V+RIIN
Sbjct: 145 SPEEISAMVLTKMKTIAEDYLGEKITKAVVTVPAYFSDSQRSATKDAGRIAGLDVVRIIN 204

Query: 591 EPTAAAIAYGLDKK---GTGE-RNVLIFD 665
           EPT+++IAYGLDKK    +G+ +N+L+FD
Sbjct: 205 EPTSSSIAYGLDKKTQETSGKAKNILVFD 233



 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 65/173 (37%), Positives = 98/173 (56%), Gaps = 10/173 (5%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKG-----EDKTFFPE 421
           P NTIFD KRLIGRKF+D  VQ DMK  P++V++  G+P ++++        ++K   PE
Sbjct: 88  PENTIFDVKRLIGRKFDDPEVQKDMKLLPYKVINKDGRPFVQLSGTNLPKELQNKIMSPE 147

Query: 422 EVSSMVLTKMKETAEAYLG-KLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ* 592
           E+S+MVLTKMK  AE YLG K+ +  ++         +++ K       L+  R  N   
Sbjct: 148 EISAMVLTKMKTIAEDYLGEKITKAVVTVPAYFSDSQRSATKDAGRIAGLDVVRIINEPT 207

Query: 593 TDCCCDCL-RS*QKGYWRTKCTYL*P-RGGTFDVSILTIEDGIFEVKSTAGDT 745
           +      L +  Q+   + K   +    GGT DVSIL+++ G+FEV +TAG+T
Sbjct: 208 SSSIAYGLDKKTQETSGKAKNILVFDCGGGTHDVSILSVDSGVFEVLATAGNT 260


>UniRef50_A2Y3V8 Cluster: Putative uncharacterized protein; n=4;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 430

 Score =  130 bits (315), Expect = 3e-29
 Identities = 84/185 (45%), Positives = 106/185 (57%), Gaps = 8/185 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFT   ERLIG+AAKNQ A  P  
Sbjct: 42  IGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTGGGERLIGEAAKNQAAANPGR 101

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP-----FSPRKS 428
           T Y    +   +  +    +      L   +V++     + H+RV+ +       SP + 
Sbjct: 102 TVYDAKRL---IGLRFADAEVQRDMRLLPFAVVDKG--GKPHVRVEVRGGDVRLLSPEEV 156

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDA TI+GL V RI+NEPTAA
Sbjct: 157 SAMVLARMKETAEAYLGEEVTRAVVTVPAYFNDAQRQATKDAATIAGLAVERILNEPTAA 216

Query: 606 AIAYG 620
           A+AYG
Sbjct: 217 ALAYG 221



 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGED-KTFFPEEVS 430
           +P  T++DAKRLIG +F DA VQ DM+  PF VV  GGKP ++V  +G D +   PEEVS
Sbjct: 98  NPGRTVYDAKRLIGLRFADAEVQRDMRLLPFAVVDKGGKPHVRVEVRGGDVRLLSPEEVS 157

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVL +MKETAEAYLG+
Sbjct: 158 AMVLARMKETAEAYLGE 174


>UniRef50_A0DHP4 Cluster: Chromosome undetermined scaffold_50, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_50,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 598

 Score =  130 bits (314), Expect = 4e-29
 Identities = 83/202 (41%), Positives = 112/202 (55%), Gaps = 7/202 (3%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           P +GIDLGT  SCVG+F++G VEII N++G R TPS VAFTD   +IG  A NQ  + P+
Sbjct: 22  PIIGIDLGTKNSCVGIFRNGNVEIIPNEEGKRKTPSVVAFTDKGLIIGKEANNQAIINPS 81

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK------TKPFSPRK 425
              ++ N+   +  K     P+       +      L  +  I V+      +K F+P +
Sbjct: 82  R--TLYNIKRLMGRKF--ADPSVQNDRKFMPYEIVELDDKPQIMVQNIKGFSSKMFAPEE 137

Query: 426 SVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L    E +     AYFN++QRQATKDAG I+GLNV+RI+NEPTA
Sbjct: 138 ISAMVLMKMKEISETYLKREVENAVITVPAYFNNAQRQATKDAGAIAGLNVVRILNEPTA 197

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYG  K+   E N++IFDL
Sbjct: 198 AAIAYGFSKRKLKE-NLVIFDL 218



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 2/76 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVA-YKG-EDKTFFPEEV 427
           +P+ T+++ KRL+GRKF D +VQ D K  P+E+V    KP+I V   KG   K F PEE+
Sbjct: 79  NPSRTLYNIKRLMGRKFADPSVQNDRKFMPYEIVELDDKPQIMVQNIKGFSSKMFAPEEI 138

Query: 428 SSMVLTKMKETAEAYL 475
           S+MVL KMKE +E YL
Sbjct: 139 SAMVLMKMKEISETYL 154



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 14/25 (56%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGT+DVSI++I+DG  +V +T+G T
Sbjct: 220 GGTYDVSIVSIDDGDIQVIATSGIT 244


>UniRef50_A4RYG3 Cluster: Heat Shock Protein 70, cytosolic; n=2;
           Ostreococcus|Rep: Heat Shock Protein 70, cytosolic -
           Ostreococcus lucimarinus CCE9901
          Length = 711

 Score =  130 bits (313), Expect = 5e-29
 Identities = 81/205 (39%), Positives = 121/205 (59%), Gaps = 12/205 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-TT 266
           +GIDLGTTYSCV V+++G+  ++ N +G+RTTPS+VAFT+  RL+GDAAK Q A+ P  T
Sbjct: 172 IGIDLGTTYSCVSVWRNGEAHVLTNAEGDRTTPSWVAFTEQGRLVGDAAKRQAAINPKNT 231

Query: 267 QYSMPNV----SSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK-SV 431
            +++  +     S+ + ++ L       G     ++  ++        + K F+P + S 
Sbjct: 232 LFNIKRIIGRQYSECAHELELMPFDVKEGEGGKPIVSVDVNG------EKKDFAPEQISA 285

Query: 432 PWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        +     +      AYFND+QR+ TKDAG I+GL+VLRIINEPTAAA+
Sbjct: 286 MVLQKMKATAEAQLGVPITKAVVTVPAYFNDAQRRQTKDAGAIAGLDVLRIINEPTAAAL 345

Query: 612 AYGLDKK--GTGE--RN--VLIFDL 668
           AYGLD++    GE  +N  +L+FDL
Sbjct: 346 AYGLDRREGENGEVIKNQCILVFDL 370



 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 66/173 (38%), Positives = 93/173 (53%), Gaps = 9/173 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+F+ KR+IGR++ +   + ++   PF+V   +GGKP + V   GE K F PE++S
Sbjct: 227 NPKNTLFNIKRIIGRQYSECAHELELM--PFDVKEGEGGKPIVSVDVNGEKKDFAPEQIS 284

Query: 431 SMVLTKMKETAEAYLG----KLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TD 598
           +MVL KMK TAEA LG    K      + F   Q   +T        L + R  N     
Sbjct: 285 AMVLQKMKATAEAQLGVPITKAVVTVPAYFNDAQ-RRQTKDAGAIAGLDVLRIINEPTAA 343

Query: 599 CCCDCL--RS*QKG-YWRTKCTYL*PRG-GTFDVSILTIEDGIFEVKSTAGDT 745
                L  R  + G   + +C  +   G GTFDVS+L ++DG+FEV STAGDT
Sbjct: 344 ALAYGLDRREGENGEVIKNQCILVFDLGGGTFDVSLLNLQDGVFEVLSTAGDT 396


>UniRef50_Q7WGI4 Cluster: Chaperone protein dnaK; n=41; cellular
           organisms|Rep: Chaperone protein dnaK - Bordetella
           bronchiseptica (Alcaligenes bronchisepticus)
          Length = 641

 Score =  128 bits (310), Expect = 1e-28
 Identities = 81/196 (41%), Positives = 109/196 (55%), Gaps = 3/196 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP-T 263
           +GIDLGTT SCV V   G+V+II N +G RTTPS VA+ D  E L+G  AK Q    P  
Sbjct: 5   IGIDLGTTNSCVAVLDGGQVKIIENAEGARTTPSIVAYMDDGETLVGAPAKRQAVTNPKN 64

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK-SVPWC 440
           T Y++  +      +  + K      L   S+++A+      + V+ K  +P + S    
Sbjct: 65  TLYAVKRLIGRKFDEKAVQK---DIDLMPYSIVKADNGDA-WVEVRGKKLAPPQVSAEVL 120

Query: 441 XXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 620
                     +     E      AYFNDSQRQATKDAG I+GL V RIINEPTAAA+A+G
Sbjct: 121 RKMKKTAEDYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFG 180

Query: 621 LDKKGTGERNVLIFDL 668
           LDK   G+R ++++DL
Sbjct: 181 LDKTEKGDRKIVVYDL 196



 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 62/173 (35%), Positives = 84/173 (48%), Gaps = 9/173 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT++  KRLIGRKF++  VQ D+   P+ +V +D G   ++V      K   P +VS
Sbjct: 61  NPKNTLYAVKRLIGRKFDEKAVQKDIDLMPYSIVKADNGDAWVEV----RGKKLAPPQVS 116

Query: 431 SMVLTKMKETAEAYLGKLCRMQL----SRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TD 598
           + VL KMK+TAE YLG+     +    + F   Q  +     R    L ++R  N     
Sbjct: 117 AEVLRKMKKTAEDYLGEEVTEAVITVPAYFNDSQRQATKDAGRIA-GLEVKRIINEPTAA 175

Query: 599 CCCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIED----GIFEVKSTAGDT 745
                L   +KG    K       GGTFDVSI+ I D      FEV ST GDT
Sbjct: 176 ALAFGLDKTEKG--DRKIVVYDLGGGTFDVSIIEIADVDGEMQFEVLSTNGDT 226


>UniRef50_P02826 Cluster: Heat shock 70 kDa protein cognate 1; n=2;
           melanogaster subgroup|Rep: Heat shock 70 kDa protein
           cognate 1 - Drosophila simulans (Fruit fly)
          Length = 214

 Score =  125 bits (302), Expect = 1e-27
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 252 MTP 260
           M P
Sbjct: 61  MNP 63



 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 32/43 (74%), Positives = 40/43 (93%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIK 382
           +PNNTIFDAKRLIGR+F+DATVQ+DMKHWPFE  ++ GKP+I+
Sbjct: 62  NPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEAFAENGKPRIR 104



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/24 (87%), Positives = 23/24 (95%)
 Frame = +2

Query: 674 GTFDVSILTIEDGIFEVKSTAGDT 745
           GTFDVS+LTIEDG FEVK+TAGDT
Sbjct: 105 GTFDVSVLTIEDG-FEVKATAGDT 127


>UniRef50_A3LSS7 Cluster: Heat shock protein 70; n=1; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 593

 Score =  125 bits (301), Expect = 1e-27
 Identities = 84/195 (43%), Positives = 108/195 (55%), Gaps = 1/195 (0%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT- 263
           A+GIDLGTTYSCVGVF++ +VEII N+ G RTTPS VAF      IG+AA N+ A  PT 
Sbjct: 4   AIGIDLGTTYSCVGVFRNQRVEIIPNELGKRTTPSCVAFNSFHTHIGEAAVNERAENPTN 63

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCX 443
           T + +  +    S   +   P   T      V++ +   +   + K KP     S     
Sbjct: 64  TIFGIKRIIGKDSYDDVGKFPFEITKSKSGLVIKVSFNGK---KRKLKP--ELISAMILR 118

Query: 444 XXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    + A+         A FND QRQATKDA  I+GLNV RIINEPTAAA++YG+
Sbjct: 119 KLKTDAEIYLGADVKNAVITVPATFNDKQRQATKDAALIAGLNVKRIINEPTAAALSYGI 178

Query: 624 DKKGTGERNVLIFDL 668
           DKK     NVL++DL
Sbjct: 179 DKK-QETLNVLVYDL 192



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 30/76 (39%), Positives = 45/76 (59%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 430
           ++P NTIF  KR+IG+   D     D+  +PFE+        IKV++ G+ +   PE +S
Sbjct: 59  ENPTNTIFGIKRIIGKDSYD-----DVGKFPFEITKSKSGLVIKVSFNGKKRKLKPELIS 113

Query: 431 SMVLTKMKETAEAYLG 478
           +M+L K+K  AE YLG
Sbjct: 114 AMILRKLKTDAEIYLG 129



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 14/23 (60%), Positives = 18/23 (78%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAG 739
           GGT DVS+L + +G F VK+TAG
Sbjct: 194 GGTLDVSLLEVTEGKFTVKATAG 216


>UniRef50_Q95YL9 Cluster: Mitochondrial-type heat shock protein 70;
           n=11; Entamoeba histolytica|Rep: Mitochondrial-type heat
           shock protein 70 - Entamoeba histolytica
          Length = 598

 Score =  123 bits (296), Expect = 5e-27
 Identities = 78/200 (39%), Positives = 107/200 (53%), Gaps = 2/200 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A++  +GIDLGTT SC+ VF      I+ N +G RTTPS V+FT T  L+G+AAK   A+
Sbjct: 7   ARSTCIGIDLGTTNSCMCVFDKTTPRILENAEGKRTTPSCVSFTPTGILVGEAAKRMEAL 66

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVP 434
            PTT  S          +M+ C+        +   +         I +  K +SP +   
Sbjct: 67  HPTTTVSGVK-------RMIGCQYKNVEQQRKPYKIVEGRNGEGWIYINGKTYSPSEISS 119

Query: 435 WCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
           +            L     E      AYFND+QRQATKDAGT++GL V RIINEPTAAA+
Sbjct: 120 FILKKLKKDAEAKLGKRVDEAVITCPAYFNDAQRQATKDAGTLAGLKVKRIINEPTAAAL 179

Query: 612 AYGLDKKGTGE-RNVLIFDL 668
           AYG+D +   E +N+ ++DL
Sbjct: 180 AYGIDTRKENEGKNIAVYDL 199



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 51/167 (30%), Positives = 80/167 (47%), Gaps = 4/167 (2%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 436
           P  T+   KR+IG ++++   Q      P+++V +G   +  +   G  KT+ P E+SS 
Sbjct: 68  PTTTVSGVKRMIGCQYKNVEQQRK----PYKIV-EGRNGEGWIYING--KTYSPSEISSF 120

Query: 437 VLTKMKETAEAYLGKLCRMQL----SRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TDCC 604
           +L K+K+ AEA LGK     +    + F   Q    T        L ++R  N       
Sbjct: 121 ILKKLKKDAEAKLGKRVDEAVITCPAYFNDAQ-RQATKDAGTLAGLKVKRIINEPTAAAL 179

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
              + + ++   +    Y    GGTFD+SIL I  GIF+VK+T GDT
Sbjct: 180 AYGIDTRKENEGKNIAVY-DLGGGTFDISILNINKGIFQVKATNGDT 225


>UniRef50_A2E1T4 Cluster: Heat shock cognate protein, putative; n=2;
           Trichomonas vaginalis|Rep: Heat shock cognate protein,
           putative - Trichomonas vaginalis G3
          Length = 622

 Score =  123 bits (296), Expect = 5e-27
 Identities = 75/203 (36%), Positives = 108/203 (53%), Gaps = 6/203 (2%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           K P +GIDLGTT+SCVGVF +GKV+II N+ GNR TPS V   + ++++GDAA   +   
Sbjct: 15  KHPIIGIDLGTTFSCVGVFMNGKVDIIPNEVGNRITPSVVYIGNGKKIVGDAAMPYLVSE 74

Query: 258 P-TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT----KPFSPR 422
           P  T Y++  +     S      P     +  L     +  +  ++ +      + +SP 
Sbjct: 75  PKNTIYAIKRLIGRRFSD-----PEVQNEIPHLGYKVIDKNNHPYVEINNNGVIEHYSPE 129

Query: 423 KSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPT 599
           +                L     E      AYFND+QR++T DAG I GL + RIINEPT
Sbjct: 130 EISSMILYKMKSVAESYLGYQINESVVTVPAYFNDNQRKSTFDAGKIIGLKITRIINEPT 189

Query: 600 AAAIAYGLDKKGTGERNVLIFDL 668
           AA++AYGLD+K     N+L++DL
Sbjct: 190 AASLAYGLDRKNQDSVNILVYDL 212



 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 33/75 (44%), Positives = 49/75 (65%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTI+  KRLIGR+F D  VQ ++ H  ++V+     P +++   G  + + PEE+SS
Sbjct: 74  EPKNTIYAIKRLIGRRFSDPEVQNEIPHLGYKVIDKNNHPYVEINNNGVIEHYSPEEISS 133

Query: 434 MVLTKMKETAEAYLG 478
           M+L KMK  AE+YLG
Sbjct: 134 MILYKMKSVAESYLG 148



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 17/25 (68%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+S+LT+ED  FEV +T+GDT
Sbjct: 214 GGTFDISLLTVEDSFFEVLATSGDT 238


>UniRef50_P38646 Cluster: Stress-70 protein, mitochondrial
           precursor; n=291; root|Rep: Stress-70 protein,
           mitochondrial precursor - Homo sapiens (Human)
          Length = 679

 Score =  122 bits (294), Expect = 9e-27
 Identities = 82/213 (38%), Positives = 113/213 (53%), Gaps = 3/213 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HI 392
           RL+G  AK Q    P  T Y+   +         + K   +     +     +      +
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDA----WV 154

Query: 393 RVKTKPFSPRKSVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGL 569
               K +SP +   +            L + A+ +     AYFNDSQRQATKDAG ISGL
Sbjct: 155 EAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGL 214

Query: 570 NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NVLR+INEPTAAA+AYGLDK  + ++ + ++DL
Sbjct: 215 NVLRVINEPTAAALAYGLDK--SEDKVIAVYDL 245



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 167

Query: 431 SMVLTKMKETAEAYLG 478
           + VL KMKETAE YLG
Sbjct: 168 AFVLMKMKETAENYLG 183



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVKST GDT
Sbjct: 247 GGTFDISILEIQKGVFEVKSTNGDT 271


>UniRef50_A5UYA4 Cluster: Chaperone protein DnaK; n=5; Bacteria|Rep:
           Chaperone protein DnaK - Roseiflexus sp. RS-1
          Length = 624

 Score =  122 bits (293), Expect = 1e-26
 Identities = 85/200 (42%), Positives = 108/200 (54%), Gaps = 7/200 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTPTT 266
           VGIDLGTT S V V + G   +I N +GNRTTPS VAFT   ERL+G  AK Q  + P  
Sbjct: 5   VGIDLGTTNSVVAVMEGGDPVVIPNAEGNRTTPSVVAFTKNGERLVGQTAKRQATINPDN 64

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRS-R*HIRVKT----KPFSPRKSV 431
            +         S K  + +    T + R  V    ++  R  +RV +    K ++P++  
Sbjct: 65  TF--------YSIKRFIGRNFDETTVEREMVPFKVVKGPRNDVRVFSPVTGKEYAPQEIS 116

Query: 432 PWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         L     +      AYFNDSQRQATKDAG I+GL VLRIINEPTAAA
Sbjct: 117 AMVLQKLKTDAEAYLGEPVTKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAA 176

Query: 609 IAYGLDKKGTGERNVLIFDL 668
           +AYGLDKK   +  +L+FDL
Sbjct: 177 LAYGLDKK--KDETILVFDL 194



 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P+NT +  KR IGR F++ TV+ +M   PF+VV  G +  ++V      K + P+E+S+
Sbjct: 61  NPDNTFYSIKRFIGRNFDETTVEREMV--PFKVVK-GPRNDVRVFSPVTGKEYAPQEISA 117

Query: 434 MVLTKMKETAEAYLGK 481
           MVL K+K  AEAYLG+
Sbjct: 118 MVLQKLKTDAEAYLGE 133



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L + DG+ EVK+T GDT
Sbjct: 196 GGTFDVSVLEVGDGVVEVKATNGDT 220


>UniRef50_Q55154 Cluster: Chaperone protein dnaK1; n=85; cellular
           organisms|Rep: Chaperone protein dnaK1 - Synechocystis
           sp. (strain PCC 6803)
          Length = 692

 Score =  119 bits (287), Expect = 7e-26
 Identities = 81/199 (40%), Positives = 109/199 (54%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMTPTT 266
           +GIDLGTT SC  V + GK  +I N +G RTTPS V FT  ++RL+G  AK Q       
Sbjct: 5   IGIDLGTTNSCASVLEGGKPIVITNTEGGRTTPSIVGFTKGSQRLVGQLAKRQ------- 57

Query: 267 QYSMPNVSSDVSS-KMLLCKPT*STGLSRLSVMEANLRSR*H---IRVKTKPFSPRKSVP 434
             S+ N  + V S K  + +    T   R  V    ++ R     + ++ + ++P++   
Sbjct: 58  --SVTNAENTVYSIKRFIGRRWDDTVEERSRVPYNCVKGRDDTVSVSIRGQSYTPQEISA 115

Query: 435 WCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L     +      AYF D+QRQATKDAGTI+GL VLRIINEPTAAA+
Sbjct: 116 MILQKLKADSEAFLGEPVTQAVITVPAYFTDAQRQATKDAGTIAGLEVLRIINEPTAAAL 175

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLDK+ T E  +L+FDL
Sbjct: 176 AYGLDKQET-EELILVFDL 193



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 27/73 (36%), Positives = 47/73 (64%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           NT++  KR IGR+++D TV+ +    P+  V  G    + V+ +G+  T  P+E+S+M+L
Sbjct: 64  NTVYSIKRFIGRRWDD-TVE-ERSRVPYNCVK-GRDDTVSVSIRGQSYT--PQEISAMIL 118

Query: 443 TKMKETAEAYLGK 481
            K+K  +EA+LG+
Sbjct: 119 QKLKADSEAFLGE 131



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 15/24 (62%), Positives = 21/24 (87%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVS+L + +G+FEV ST+G+
Sbjct: 195 GGTFDVSLLQLGNGVFEVLSTSGN 218


>UniRef50_Q8YE76 Cluster: Chaperone protein dnaK; n=345; cellular
           organisms|Rep: Chaperone protein dnaK - Brucella
           melitensis
          Length = 637

 Score =  116 bits (279), Expect = 6e-25
 Identities = 76/199 (38%), Positives = 104/199 (52%), Gaps = 3/199 (1%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMT 257
           A  +GID+GTT SCV V      ++I N +G RTTPS +AFTD  ERL G  AK Q    
Sbjct: 2   AKVIGIDMGTTNSCVAVMDGKNAKVIENAEGARTTPSIIAFTDGDERLAGQPAKRQAVTN 61

Query: 258 PT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVP 434
           P  T +++  +        ++ K      L    +++ +      + V  K +SP +   
Sbjct: 62  PEGTLFAVKRLIGRRYDDPMVTK---DKDLVPYKIVKGDNGDA-WVEVHGKKYSPSQISA 117

Query: 435 WCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L     +      AYFND+QRQATKDAG I+GL VLRIINEPTAAA+
Sbjct: 118 MILQKMKETAESYLGETVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAAL 177

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLDK  +  + + ++DL
Sbjct: 178 AYGLDK--SEGKTIAVYDL 194



 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 61/168 (36%), Positives = 87/168 (51%), Gaps = 4/168 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P  T+F  KRLIGR+++D  V  D    P+++V  D G   ++V      K + P ++S
Sbjct: 61  NPEGTLFAVKRLIGRRYDDPMVTKDKDLVPYKIVKGDNGDAWVEV----HGKKYSPSQIS 116

Query: 431 SMVLTKMKETAEAYLGK-LCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDC 601
           +M+L KMKETAE+YLG+ + +  ++         + + K       LE  R  N      
Sbjct: 117 AMILQKMKETAESYLGETVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAA 176

Query: 602 CCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
               L    K   +T   Y    GGTFDVS+L I DG+FEVKST GDT
Sbjct: 177 LAYGL---DKSEGKTIAVY-DLGGGTFDVSVLEIGDGVFEVKSTNGDT 220


>UniRef50_A2ZTS5 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 623

 Score =  116 bits (278), Expect = 8e-25
 Identities = 73/201 (36%), Positives = 109/201 (54%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD--TERLIGDAAKNQVAMTPT 263
           +GID+G TYSCV V+  G+VEII NDQG+R TPS+VAFTD     ++G+AAK Q   +P 
Sbjct: 37  LGIDIGATYSCVAVYCKGRVEIIPNDQGSRLTPSWVAFTDGGGRLVVGEAAKEQAVGSPG 96

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK-----TKPFSPRKS 428
              ++ +    +  K  L        ++RL     ++  + H+ V+      +  SP + 
Sbjct: 97  R--AVHDFMRLLGKK--LGDDDVQREMTRLPYAVVDMEGKPHVLVEAADGDVRVLSPEEI 152

Query: 429 VPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L      +      YFND+QR+A  DAG I+GL+V+RI++EP AA
Sbjct: 153 AAAVLAKMKKTAEAHLGRTVSSAVVAVPVYFNDAQRRAISDAGDIAGLDVMRIVSEPIAA 212

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           A+AYGLD   +  + V++FDL
Sbjct: 213 AVAYGLDNVRSNGKRVVVFDL 233



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 34/83 (40%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query: 236 QEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV-AYKGEDKTF 412
           +E     P   + D  RL+G+K  D  VQ +M   P+ VV   GKP + V A  G+ +  
Sbjct: 88  KEQAVGSPGRAVHDFMRLLGKKLGDDDVQREMTRLPYAVVDMEGKPHVLVEAADGDVRVL 147

Query: 413 FPEEVSSMVLTKMKETAEAYLGK 481
            PEE+++ VL KMK+TAEA+LG+
Sbjct: 148 SPEEIAAAVLAKMKKTAEAHLGR 170


>UniRef50_UPI00005A5F0E Cluster: PREDICTED: similar to Heat shock
           cognate 71 kDa protein (Heat shock 70 kDa protein 8);
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           Heat shock cognate 71 kDa protein (Heat shock 70 kDa
           protein 8) - Canis familiaris
          Length = 393

 Score =  115 bits (276), Expect = 1e-24
 Identities = 50/71 (70%), Positives = 63/71 (88%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTK 448
           +F+AK LIG +F+DA VQ+DMKHWPF VV+D G+PK++V YKG+ K+F+PEE+SSMVLTK
Sbjct: 7   VFNAKCLIGCRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGKTKSFYPEELSSMVLTK 66

Query: 449 MKETAEAYLGK 481
           MKE AEAYLGK
Sbjct: 67  MKEIAEAYLGK 77



 Score =  100 bits (240), Expect = 3e-20
 Identities = 49/53 (92%), Positives = 50/53 (94%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 88  AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDL 140



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIF 718
           GGTFDVSIL IEDGIF
Sbjct: 142 GGTFDVSILIIEDGIF 157


>UniRef50_UPI0000E47BD9 Cluster: PREDICTED: similar to heat shock
           protein protein; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 502

 Score =  114 bits (274), Expect = 2e-24
 Identities = 51/77 (66%), Positives = 63/77 (81%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 430
           ++P NTIFDAKRLIGR+F D  V++ MKHWPF V++  GKP ++V + GE KT  PEEVS
Sbjct: 32  ENPKNTIFDAKRLIGRQFNDEVVRSGMKHWPFTVINTDGKPMLQVEHIGETKTLSPEEVS 91

Query: 431 SMVLTKMKETAEAYLGK 481
           SMVLTK+KETAEAYLG+
Sbjct: 92  SMVLTKLKETAEAYLGE 108



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 17/25 (68%), Positives = 19/25 (76%)
 Frame = +2

Query: 668 RGGTFDVSILTIEDGIFEVKSTAGD 742
           R    DVS+L IEDGIFEV +TAGD
Sbjct: 137 RRSELDVSLLVIEDGIFEVLTTAGD 161



 Score = 33.9 bits (74), Expect = 4.2
 Identities = 39/138 (28%), Positives = 58/138 (42%), Gaps = 5/138 (3%)
 Frame = +3

Query: 195 VAFTDTERLIGDAAKNQVAMTP-TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEAN 371
           VAFTD E LIGDAAKN ++  P  T +    +     +  ++         + ++     
Sbjct: 13  VAFTDREILIGDAAKNHMSENPKNTIFDAKRLIGRQFNDEVVRSGMKHWPFTVINTDGKP 72

Query: 372 LRSR*HIRVKTKPFSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATK- 545
           +    HI  +TK  SP +                L     +       YFND+QRQATK 
Sbjct: 73  MLQVEHIG-ETKTLSPEEVSSMVLTKLKETAEAYLGEKITDAVITVPTYFNDAQRQATKE 131

Query: 546 DAGTI--SGLNVLRIINE 593
           D G +  S L+V  ++ E
Sbjct: 132 DQGEVRRSELDVSLLVIE 149


>UniRef50_Q824B2 Cluster: Chaperone protein dnaK; n=786; cellular
           organisms|Rep: Chaperone protein dnaK - Chlamydophila
           caviae
          Length = 664

 Score =  112 bits (269), Expect = 1e-23
 Identities = 76/199 (38%), Positives = 105/199 (52%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP--- 260
           +GIDLGTT SCV V + G+ ++I + +G RTTPS VAF   E L+G  AK Q    P   
Sbjct: 11  IGIDLGTTNSCVSVMEGGQAKVITSSEGTRTTPSIVAFKGNETLVGIPAKRQAVTNPEKT 70

Query: 261 --TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVP 434
             +T+  +    S+V S++       ++G S   V+           V  K ++P +   
Sbjct: 71  LASTKRFIGRKHSEVESEIKTVPYKVASG-SNGDVV---------FLVDGKQYTPEEIGA 120

Query: 435 WCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L     E      AYFNDSQR +TKDAG I+GL+V RII EPTAAA+
Sbjct: 121 QVLIKMKETAEAYLGEPVTEAVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAAL 180

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYG+DK   G++ + +FDL
Sbjct: 181 AYGIDK--AGDKKIAVFDL 197



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 31/76 (40%), Positives = 46/76 (60%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  T+   KR IGRK  +  V++++K  P++V S        V +  + K + PEE+ +
Sbjct: 66  NPEKTLASTKRFIGRKHSE--VESEIKTVPYKVASGSNGD---VVFLVDGKQYTPEEIGA 120

Query: 434 MVLTKMKETAEAYLGK 481
            VL KMKETAEAYLG+
Sbjct: 121 QVLIKMKETAEAYLGE 136



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 19/25 (76%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I DG+FEV ST GDT
Sbjct: 199 GGTFDISILEIGDGVFEVLSTNGDT 223


>UniRef50_UPI000058655A Cluster: PREDICTED: similar to heat shock
           protein protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to heat shock protein protein -
           Strongylocentrotus purpuratus
          Length = 684

 Score =  110 bits (265), Expect = 3e-23
 Identities = 50/76 (65%), Positives = 60/76 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGR+F D  VQ+ MKHWPF V++  GKP ++V Y G   T  PEEVSS
Sbjct: 64  NPKNTIFDAKRLIGRQFNDEVVQSGMKHWPFTVINTDGKPMLQVEYIGVTGTLSPEEVSS 123

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTK+KETAEAY+G+
Sbjct: 124 MVLTKLKETAEAYIGE 139



 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 42/61 (68%), Positives = 49/61 (80%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           K+P +GIDLGT+ SCVGVFQ+G VEII ND GNRTTPS VAFTD E LIG+ A NQ++  
Sbjct: 5   KSPVIGIDLGTSCSCVGVFQNGTVEIIPNDYGNRTTPSCVAFTDREILIGEEANNQMSKN 64

Query: 258 P 260
           P
Sbjct: 65  P 65



 Score = 32.7 bits (71), Expect = 9.8
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTI 560
           YFND+QRQATK+AG I
Sbjct: 151 YFNDAQRQATKEAGVI 166


>UniRef50_Q3LVU5 Cluster: Chaperone HSP70; n=1; Bigelowiella
           natans|Rep: Chaperone HSP70 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 610

 Score =  109 bits (262), Expect = 7e-23
 Identities = 72/179 (40%), Positives = 97/179 (54%), Gaps = 4/179 (2%)
 Frame = +3

Query: 144 KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT-TQYSMPNVSSDVSSKMLLC 320
           KV+II+N+ GNRTT S VAFTD ++L+GDAAKNQ    P+   Y    +     +   + 
Sbjct: 6   KVQIISNEAGNRTTASVVAFTDDDKLVGDAAKNQAIFHPSQVVYDSKRMLGKKYNDETIQ 65

Query: 321 KPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK-SVPWCXXXXXXXXXXILANCAECS 497
               +     L   + ++     I+ +T+ FSP + S               L    +  
Sbjct: 66  DDMKTWPFKVLQGPKESILISVQIKGETREFSPEQISSIVLRKMREIGENFTLKPINDVV 125

Query: 498 YHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLD--KKGTGERNVLIFDL 668
               AYFND QR ATKDAG ++ L V RI+NEPTAA IAYG+D  KK + ER+VLIFDL
Sbjct: 126 ITVPAYFNDGQRIATKDAGALAELKVNRIVNEPTAACIAYGMDRTKKQSRERSVLIFDL 184



 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 60/169 (35%), Positives = 89/169 (52%), Gaps = 6/169 (3%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPK--IKVAYKGEDKTFFPEEVS 430
           P+  ++D+KR++G+K+ D T+Q DMK WPF+V+  G K    I V  KGE + F PE++S
Sbjct: 44  PSQVVYDSKRMLGKKYNDETIQDDMKTWPFKVL-QGPKESILISVQIKGETREFSPEQIS 102

Query: 431 SMVLTKMKETAEAY----LGKLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TD 598
           S+VL KM+E  E +    +  +     + F   Q ++ T        L + R  N     
Sbjct: 103 SIVLRKMREIGENFTLKPINDVVITVPAYFNDGQRIA-TKDAGALAELKVNRIVNEPTAA 161

Query: 599 CCCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
           C    +   +K             GGTFDVSIL I+ G+FEVK+T G+T
Sbjct: 162 CIAYGMDRTKKQSRERSVLIFDLGGGTFDVSILCIDGGVFEVKATHGNT 210


>UniRef50_P73098 Cluster: Chaperone protein dnaK3; n=123; cellular
           organisms|Rep: Chaperone protein dnaK3 - Synechocystis
           sp. (strain PCC 6803)
          Length = 771

 Score =  105 bits (251), Expect = 2e-21
 Identities = 76/199 (38%), Positives = 101/199 (50%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPTT 266
           VGIDLGTT S V V + GK  +IAN +G RTTPS V F  + E ++G   + Q  + P  
Sbjct: 5   VGIDLGTTNSVVAVMEGGKPIVIANAEGMRTTPSVVGFNKEGELVVGQMGRRQAVLNP-- 62

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT----KPFSPRKSVP 434
           Q +   V   +  +     P      S+          R +I+V+     K F+P +   
Sbjct: 63  QNTFYGVKRFMGRRYTDLTPE-----SKRVAYTIRRDDRDNIKVRCPRLKKDFAPEEISA 117

Query: 435 WCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L            AYFNDSQRQAT+DAG I+GL VLRIINEPTAA++
Sbjct: 118 MILRKLAEEASRYLGEKVTGAVITVPAYFNDSQRQATRDAGKIAGLEVLRIINEPTAASL 177

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLD+     + +L+FDL
Sbjct: 178 AYGLDQGRI--QKILVFDL 194



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/76 (36%), Positives = 43/76 (56%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT +  KR +GR++ D T ++  K   + +  D  +  IKV      K F PEE+S+
Sbjct: 61  NPQNTFYGVKRFMGRRYTDLTPES--KRVAYTIRRDD-RDNIKVRCPRLKKDFAPEEISA 117

Query: 434 MVLTKMKETAEAYLGK 481
           M+L K+ E A  YLG+
Sbjct: 118 MILRKLAEEASRYLGE 133



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/25 (76%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L + DGIFEVK+T+GDT
Sbjct: 196 GGTFDVSVLEVGDGIFEVKATSGDT 220


>UniRef50_Q4P628 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 225

 Score =  103 bits (248), Expect = 4e-21
 Identities = 78/184 (42%), Positives = 98/184 (53%), Gaps = 1/184 (0%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           A+GIDLGTTYSCVG + + +VEIIANDQGNRTTPSYVAFT++ERLIGDAAKN        
Sbjct: 18  AIGIDLGTTYSCVGWWVNERVEIIANDQGNRTTPSYVAFTESERLIGDAAKN-------- 69

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK-SVPWCX 443
           Q +M    +   +K L+ +            +E N         +TK FSP++ S     
Sbjct: 70  QAAMNPKQTVFDAKRLIGRRYDDPD-DGSPFIEVNYLG------ETKQFSPQEISSMVLT 122

Query: 444 XXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    I     +      AYFNDSQR ATKDAGT     +L I +   AA+ A G 
Sbjct: 123 KMKEIAEAKIGKEVKKAVITVPAYFNDSQRLATKDAGTYC-FPLLNITSTCAAASAATGK 181

Query: 624 DKKG 635
           +  G
Sbjct: 182 NNGG 185



 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 39/76 (51%), Positives = 48/76 (63%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  T+FDAKRLIGR+++D                D G P I+V Y GE K F P+E+SS
Sbjct: 74  NPKQTVFDAKRLIGRRYDDP---------------DDGSPFIEVNYLGETKQFSPQEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEA +GK
Sbjct: 119 MVLTKMKEIAEAKIGK 134


>UniRef50_Q82EX9 Cluster: Chaperone protein dnaK1; n=8; cellular
           organisms|Rep: Chaperone protein dnaK1 - Streptomyces
           avermitilis
          Length = 622

 Score =  103 bits (246), Expect = 6e-21
 Identities = 75/197 (38%), Positives = 104/197 (52%), Gaps = 1/197 (0%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A AVGIDLGTT S V V + G+  +I N +G RTTPS VAF       G+    +VA   
Sbjct: 2   ARAVGIDLGTTNSVVSVLEGGEPTVITNAEGARTTPSVVAFAKN----GEVLVGEVAK-- 55

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWC 440
             + ++ NV   V S                  ++ ++ +   I +  K F+P++   + 
Sbjct: 56  --RQAVTNVDRTVRS------------------VKRHMGTDWKINLDGKDFNPQQMSAFI 95

Query: 441 XXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
                      L     +      AYFNDS+RQATK+AG I+GLNVLRI+NEPTAAA+AY
Sbjct: 96  LQKLKRDAEAYLGEKVTDAVITVPAYFNDSERQATKEAGEIAGLNVLRIVNEPTAAALAY 155

Query: 618 GLDKKGTGERNVLIFDL 668
           GLDK    ++ +L+FDL
Sbjct: 156 GLDK---DDQTILVFDL 169



 Score = 39.5 bits (88), Expect = 0.085
 Identities = 17/24 (70%), Positives = 20/24 (83%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVS+L I DG+ EVK+T GD
Sbjct: 171 GGTFDVSLLEIGDGVVEVKATNGD 194



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 13/28 (46%), Positives = 21/28 (75%)
 Frame = +2

Query: 398 EDKTFFPEEVSSMVLTKMKETAEAYLGK 481
           + K F P+++S+ +L K+K  AEAYLG+
Sbjct: 82  DGKDFNPQQMSAFILQKLKRDAEAYLGE 109


>UniRef50_A2FJR4 Cluster: DnaK protein; n=2; Trichomonas
           vaginalis|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 617

 Score =  102 bits (245), Expect = 8e-21
 Identities = 69/199 (34%), Positives = 110/199 (55%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-TT 266
           +GIDLGTT+S VG++++G+VEII N+   + TPS V++ +  R++GD+A     ++P TT
Sbjct: 15  IGIDLGTTFSVVGIYKNGEVEIIPNEINKKITPSVVSYYNGSRVVGDSAVRLGTISPETT 74

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP----FSPRK-SV 431
            +++  +   +  K     P     + R+         R +I++ T+      SP + S 
Sbjct: 75  VFAVKRL---IGRKF--SDPIVQQEMHRVPFTIVERDERPYIKISTEEEDTLISPEEISA 129

Query: 432 PWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        +     E      AYFN+ QR+AT  AG I+GL V RII+EPTAAA+
Sbjct: 130 LVLKKLKQQAELYLNETIHEAVITVPAYFNEDQRKATITAGQIAGLKVDRIISEPTAAAL 189

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGL+K+   E+ V+++DL
Sbjct: 190 AYGLNKE--DEKYVIVYDL 206



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 36/79 (45%), Positives = 49/79 (62%)
 Frame = +2

Query: 245 GGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEE 424
           G   P  T+F  KRLIGRKF D  VQ +M   PF +V    +P IK++ + ED    PEE
Sbjct: 67  GTISPETTVFAVKRLIGRKFSDPIVQQEMHRVPFTIVERDERPYIKISTEEEDTLISPEE 126

Query: 425 VSSMVLTKMKETAEAYLGK 481
           +S++VL K+K+ AE YL +
Sbjct: 127 ISALVLKKLKQQAELYLNE 145



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 15/25 (60%), Positives = 20/25 (80%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LT++   F+V +T GDT
Sbjct: 208 GGTFDVSLLTLDKDYFQVVATGGDT 232


>UniRef50_Q2VA67 Cluster: Putative heat schock protein 70; n=1;
           Theileria sp. China|Rep: Putative heat schock protein 70
           - Theileria sp. China
          Length = 372

 Score =  102 bits (244), Expect = 1e-20
 Identities = 48/53 (90%), Positives = 51/53 (96%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAGTI+GLNV+RIINEPTAAAIAYGLDKK  GE+NVLIFDL
Sbjct: 4   AYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKKSGGEKNVLIFDL 56



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 24/25 (96%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVK+TAGDT
Sbjct: 58  GGTFDVSILTIEDGIFEVKATAGDT 82


>UniRef50_Q9UQC1 Cluster: Heat shock protein 72; n=10; Fungi/Metazoa
           group|Rep: Heat shock protein 72 - Homo sapiens (Human)
          Length = 151

 Score =  101 bits (242), Expect = 2e-20
 Identities = 48/53 (90%), Positives = 50/53 (94%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDL
Sbjct: 62  AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDL 114



 Score = 92.7 bits (220), Expect = 9e-18
 Identities = 38/50 (76%), Positives = 46/50 (92%)
 Frame = +2

Query: 329 MKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG 478
           MKHWPF+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG
Sbjct: 1   MKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLG 50



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 116 GGTFDVSILTIDDGIFEVKATAGDT 140


>UniRef50_Q1D8Q9 Cluster: Heat shock protein 70 family protein; n=2;
           Cystobacterineae|Rep: Heat shock protein 70 family
           protein - Myxococcus xanthus (strain DK 1622)
          Length = 535

 Score =   99 bits (238), Expect = 6e-20
 Identities = 72/202 (35%), Positives = 103/202 (50%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQV 248
           MA   A+GIDLGT++SCV V Q G+  +I N+ G  T  S V+F  D   L+G+AAK  +
Sbjct: 1   MADDIAIGIDLGTSFSCVAVVQDGQPTVIPNEWGETTHASCVSFLEDGSVLVGNAAKKNI 60

Query: 249 AMTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFS-PR 422
              P  T YS   +         + K   +  +    ++E +  S   I +    +S P 
Sbjct: 61  ITNPEQTVYSAKRLIGRYYFSDEVKK---AQAVMPYRIVEGDNNSV-RIAMNEHSYSLPE 116

Query: 423 KSVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
            S              +     +      AYFND+QRQATKDAG I+G+ VLRI+NEPTA
Sbjct: 117 ISALVLKELKAVAETYLGQEVTKAVVTVPAYFNDNQRQATKDAGRIAGMEVLRILNEPTA 176

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AA+AYG  +     + V+++DL
Sbjct: 177 AALAYGFGR--DVNQRVVVYDL 196



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/76 (31%), Positives = 44/76 (57%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  T++ AKRLIGR +    V+      P+ +V +G    +++A    + ++   E+S+
Sbjct: 63  NPEQTVYSAKRLIGRYYFSDEVKKAQAVMPYRIV-EGDNNSVRIAM--NEHSYSLPEISA 119

Query: 434 MVLTKMKETAEAYLGK 481
           +VL ++K  AE YLG+
Sbjct: 120 LVLKELKAVAETYLGQ 135



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 18/25 (72%), Positives = 20/25 (80%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL I   +FEV +TAGDT
Sbjct: 198 GGTFDVSILEIGKDVFEVLATAGDT 222


>UniRef50_A2Y4X8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 391

 Score =   99 bits (238), Expect = 6e-20
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 430
           +P  TI+DAKRLIGR+F DA VQ DMK  PF VV   GKP ++V  K G+ + F PEEVS
Sbjct: 103 NPERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVS 162

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVLT+MKETAEAYLG+
Sbjct: 163 AMVLTRMKETAEAYLGE 179



 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 44/58 (75%), Positives = 51/58 (87%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPS+VAFTD  ERLIG+AAKNQ A  P
Sbjct: 47  IGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP 104


>UniRef50_O09356 Cluster: Mitochondrial-type HSP70; n=2; Antonospora
           locustae|Rep: Mitochondrial-type HSP70 - Antonospora
           locustae (Nosema locustae)
          Length = 622

 Score = 99.5 bits (237), Expect = 8e-20
 Identities = 74/202 (36%), Positives = 100/202 (49%), Gaps = 2/202 (0%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           ++ K+  +GIDLGTT SCV V +    +II N  G RTTPS V F D   +  +      
Sbjct: 34  EVEKSTIIGIDLGTTNSCVSVIKDRYPKIIRNRTGKRTTPSTVTFGDKIVVGSELVDGDP 93

Query: 249 AMTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK 425
             T   T+  +     D   +  + K      L   +V   N  +   I+V  + FSP +
Sbjct: 94  GATVFGTKRLIGRKFEDPEIQKYIQK------LPYKTVSHVNGDA--WIKVSDRMFSPSQ 145

Query: 426 SVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
              +            L +    S     AYFNDSQRQATKDAG ++GL VLR+INEPTA
Sbjct: 146 IAAYILTELKRCAEDFLKSPVSKSVITVPAYFNDSQRQATKDAGRLAGLKVLRVINEPTA 205

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AA+AYGL +   G   + +FDL
Sbjct: 206 AALAYGLGRTENG--TIAVFDL 225



 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 430
           DP  T+F  KRLIGRKFED  +Q  ++  P++ VS   G   IKV+    D+ F P +++
Sbjct: 92  DPGATVFGTKRLIGRKFEDPEIQKYIQKLPYKTVSHVNGDAWIKVS----DRMFSPSQIA 147

Query: 431 SMVLTKMKETAEAYL 475
           + +LT++K  AE +L
Sbjct: 148 AYILTELKRCAEDFL 162



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/25 (80%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+DGIFEVKST G+T
Sbjct: 227 GGTFDISILEIKDGIFEVKSTNGNT 251


>UniRef50_P20030 Cluster: Heat shock cognate HSP70 protein; n=9;
           Trypanosomatidae|Rep: Heat shock cognate HSP70 protein -
           Trypanosoma brucei brucei
          Length = 676

 Score = 99.5 bits (237), Expect = 8e-20
 Identities = 65/166 (39%), Positives = 90/166 (54%), Gaps = 4/166 (2%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVSSM 436
           N  IFDAKRLIGRKF D+ VQ+DMKHWPF+V   + G   ++V + GE     PE++S+ 
Sbjct: 64  NGVIFDAKRLIGRKFSDSVVQSDMKHWPFKVEEGEKGGAVMRVEHLGEGMLLQPEQISAR 123

Query: 437 VLTKMKETAEAYLGK-LCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDCCC 607
           VL  +K  AE+YLGK + +  ++         + + K       LE  R  N        
Sbjct: 124 VLAYLKSCAESYLGKQVAKAVVTVPAYFNDSQRQATKDAGTIAGLEVLRIINEPTAAAIA 183

Query: 608 DCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
             L    +G  R    +    GGTFDVSI+++  G+FEVK+T GDT
Sbjct: 184 YGLDKADEGKERNVLVF-DFGGGTFDVSIISVSGGVFEVKATNGDT 228



 Score = 93.1 bits (221), Expect = 7e-18
 Identities = 42/55 (76%), Positives = 49/55 (89%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           A+GIDLGTTYSCVGV+Q+ +VEIIANDQGNRTTPSYVAF + E L+GDAAK+  A
Sbjct: 6   AIGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFVNNEVLVGDAAKSHAA 60



 Score = 93.1 bits (221), Expect = 7e-18
 Identities = 46/53 (86%), Positives = 48/53 (90%), Gaps = 1/53 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG-ERNVLIFD 665
           AYFNDSQRQATKDAGTI+GL VLRIINEPTAAAIAYGLDK   G ERNVL+FD
Sbjct: 149 AYFNDSQRQATKDAGTIAGLEVLRIINEPTAAAIAYGLDKADEGKERNVLVFD 201


>UniRef50_Q1IUG5 Cluster: Heat shock protein 70; n=2; Bacteria|Rep:
           Heat shock protein 70 - Acidobacteria bacterium (strain
           Ellin345)
          Length = 634

 Score = 98.3 bits (234), Expect = 2e-19
 Identities = 72/205 (35%), Positives = 103/205 (50%), Gaps = 6/205 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI-GDAAKNQV 248
           MA+   VGIDLGTT S V   +  +  +I  + G    PS VA     ++I G+AA+  +
Sbjct: 1   MAEERVVGIDLGTTNSLVAYMEGDRPVVIPGEDGANLVPSIVALDPAAQIIVGNAARKYL 60

Query: 249 AMTPTTQ-YSMPNVSS----DVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
             TP    YS+  +      D+  ++ L     +  L+   V+  +L  R +   +   F
Sbjct: 61  IETPERAVYSIKRLMGRGIEDIQDELKLFPFRVADDLAAGEVIRIHLGERTYTPPEISAF 120

Query: 414 SPRKSVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
             R+                 A   +      AYFND+QRQATKDAG I+GL VLR++NE
Sbjct: 121 ILRQ-------LKKNAERYFGAPVTKAVITVPAYFNDAQRQATKDAGRIAGLEVLRLVNE 173

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAA++AYGLDKK  G   V ++DL
Sbjct: 174 PTAASLAYGLDKKRNG--TVAVYDL 196



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 54/169 (31%), Positives = 82/169 (48%), Gaps = 4/169 (2%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 430
           + P   ++  KRL+GR  ED  +Q ++K +PF V  D    ++   + GE +T+ P E+S
Sbjct: 62  ETPERAVYSIKRLMGRGIED--IQDELKLFPFRVADDLAAGEVIRIHLGE-RTYTPPEIS 118

Query: 431 SMVLTKMKETAEAYLG-KLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDC 601
           + +L ++K+ AE Y G  + +  ++         + + K       LE  R  N      
Sbjct: 119 AFILRQLKKNAERYFGAPVTKAVITVPAYFNDAQRQATKDAGRIAGLEVLRLVNEPTAAS 178

Query: 602 CCDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDGIFEVKSTAGDT 745
               L   + G   T   Y    GG TFD+SIL + DGIFEV ST GDT
Sbjct: 179 LAYGLDKKRNG---TVAVY--DLGGGTFDISILKLHDGIFEVMSTNGDT 222


>UniRef50_Q3SD91 Cluster: Cytosol-type hsp70; n=1; Paramecium
           tetraurelia|Rep: Cytosol-type hsp70 - Paramecium
           tetraurelia
          Length = 604

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 72/200 (36%), Positives = 103/200 (51%), Gaps = 6/200 (3%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT- 263
           A+GIDLG  YS VGV  + + E+IAN+ GN+ TPSYVAF D E LIG+AA NQ A  PT 
Sbjct: 8   AIGIDLGLKYSRVGVMINDQFELIANEFGNKFTPSYVAFVDNEILIGEAALNQQAKNPTN 67

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP----FSPRKSV 431
           T Y++  +     S  ++ +       + L  +E++   R  I V+ K       P +  
Sbjct: 68  TIYNVMRLMGRRFSDKIVQEEI----QNLLFKVESDEHDRPKIVVQQKQEQLRLHPEEVC 123

Query: 432 PWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         L +   +     S   N   ++A +DAG ISGL +LRII + TAA 
Sbjct: 124 SMILSKMKTAAEIHLGHKVNQAVITTSCNLNFCSKRAIEDAGLISGLRILRIIIDSTAAY 183

Query: 609 IAYGLDKKGTGERNVLIFDL 668
            AYG++ +    R +LIF+L
Sbjct: 184 FAYGMNLQNINLRTILIFNL 203



 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 36/76 (47%), Positives = 50/76 (65%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVS 430
           +P NTI++  RL+GR+F D  VQ ++++  F+V SD   +PKI V  K E     PEEV 
Sbjct: 64  NPTNTIYNVMRLMGRRFSDKIVQEEIQNLLFKVESDEHDRPKIVVQQKQEQLRLHPEEVC 123

Query: 431 SMVLTKMKETAEAYLG 478
           SM+L+KMK  AE +LG
Sbjct: 124 SMILSKMKTAAEIHLG 139


>UniRef50_Q3LWC2 Cluster: Chaperone DnaK; n=2; Bigelowiella
           natans|Rep: Chaperone DnaK - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 653

 Score = 93.1 bits (221), Expect = 7e-18
 Identities = 65/193 (33%), Positives = 90/193 (46%), Gaps = 1/193 (0%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMTPTT 266
           VGIDLGTT S +     G+  I+ N  G R TPS +        ++GD AK Q  + P  
Sbjct: 67  VGIDLGTTNSAIATMVAGQPSILPNSSGARLTPSVIGIDKQNNFVVGDIAKRQAVVNPQN 126

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
            Y   +V S +  K     P  S+    +      L      ++ T  +  + S      
Sbjct: 127 TYY--SVKSLIGRKYQTTAPNLSSLAYPIKEGPNGLIKVSCPQLNTDFYPEQPSAKVLEQ 184

Query: 447 XXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLD 626
                     +          AYF+D+QR ATKDAG+I+GLNV RIINEPTAA++AYG D
Sbjct: 185 LESNYHTAFDSKPELAVITVPAYFDDAQRNATKDAGSIAGLNVQRIINEPTAASLAYGFD 244

Query: 627 KKGTGERNVLIFD 665
           K  +    + +FD
Sbjct: 245 K--SDNSIIFVFD 255



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 20/67 (29%), Positives = 35/67 (52%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT +  K LIGRK++          +P   + +G    IKV+    +  F+PE+ S+
Sbjct: 123 NPQNTYYSVKSLIGRKYQTTAPNLSSLAYP---IKEGPNGLIKVSCPQLNTDFYPEQPSA 179

Query: 434 MVLTKMK 454
            VL +++
Sbjct: 180 KVLEQLE 186



 Score = 37.9 bits (84), Expect = 0.26
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L   DG+FEV  T GD+
Sbjct: 258 GGTFDVSLLEAGDGVFEVIQTGGDS 282


>UniRef50_A2Q3S0 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 592

 Score = 93.1 bits (221), Expect = 7e-18
 Identities = 43/60 (71%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCV V+  +H +VEII NDQGN+TTPS+VAFTD +RL+GDAAKNQ    P
Sbjct: 9   AVGIDLGTTYSCVAVWLDEHNRVEIIHNDQGNKTTPSFVAFTDDQRLVGDAAKNQAPTNP 68



 Score = 91.9 bits (218), Expect = 2e-17
 Identities = 44/75 (58%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGRKF D+ VQ DM  WPF+V+     KP I V  KG++K    EE+S
Sbjct: 67  NPENTVFDAKRLIGRKFGDSVVQNDMMLWPFKVICGVNDKPMISVKCKGQEKHLCAEEIS 126

Query: 431 SMVLTKMKETAEAYL 475
           SMVLTKM++TAE +L
Sbjct: 127 SMVLTKMRKTAEEFL 141



 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 33/41 (80%), Positives = 39/41 (95%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           AYFND+QR+AT DAG I+GLN++RIINEPTAAAIAYGLDK+
Sbjct: 154 AYFNDAQRKATIDAGVIAGLNIMRIINEPTAAAIAYGLDKR 194


>UniRef50_Q8MV55 Cluster: Mitochondrial-like Hsp70; n=2;
           Pansporablastina|Rep: Mitochondrial-like Hsp70 -
           Trachipleistophora hominis
          Length = 543

 Score = 92.7 bits (220), Expect = 9e-18
 Identities = 60/185 (32%), Positives = 95/185 (51%), Gaps = 1/185 (0%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K   VGIDLGTT SC+ + Q     II N +G RTTPS +  +    ++G  A+ ++ 
Sbjct: 1   MSKPAIVGIDLGTTNSCISIMQDNVATIIENQEGQRTTPSVINISGENVIVGKPAQRKLL 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
             P  ++++ NV   +  K    K    T     SV++ N   +  I+V  K + P K  
Sbjct: 61  TDP--EHTIFNVKRLIGRKYADVKE--YTKRLPFSVIDDNGELK--IKVDDKRYEPAKLS 114

Query: 432 PWCXXXXXXXXXXILANCAECS-YHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
            +            L+   + +     AYFN +QR+ TK AG ++GL VLR++NEPT+AA
Sbjct: 115 SFVLSKLRSAAESFLSRPVKFAVITVPAYFNHTQREETKKAGELAGLKVLRVLNEPTSAA 174

Query: 609 IAYGL 623
           + + +
Sbjct: 175 LNHAI 179



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 18/25 (72%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL   D IFEVK+TAGD+
Sbjct: 190 GGTFDISILEKSDNIFEVKATAGDS 214


>UniRef50_Q0VDF9 Cluster: Heat shock 70 kDa protein 14; n=25;
           Euteleostomi|Rep: Heat shock 70 kDa protein 14 - Homo
           sapiens (Human)
          Length = 509

 Score = 90.2 bits (214), Expect = 5e-17
 Identities = 61/199 (30%), Positives = 102/199 (51%), Gaps = 5/199 (2%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK-NQVAMTPT 263
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK +++     
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISN 62

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV--KTKPFSPRKSVPW 437
           T   +  +    SS     K       S+  V+E N + R  I    +TK  +P      
Sbjct: 63  TVMKVKQILGRSSSDPQAQK---YIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARL 119

Query: 438 CXXXXXXXXXXILANCAECSYHGSAY-FNDSQRQATKDAGTISGLNVLRIINEPTAAAIA 614
                      +L + A        + F + Q+ A  +A   +G NVLR+I+EP+AA +A
Sbjct: 120 IFSKMKETAHSVLGSDANDVVITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLA 179

Query: 615 YGLDKKG-TGERNVLIFDL 668
           YG+ +   TG+ N+L+F L
Sbjct: 180 YGIGQDSPTGKSNILVFKL 198



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 23/73 (31%), Positives = 39/73 (53%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           +NT+   K+++GR   D   Q  +      V+   GK + ++    E K   PE+V+ ++
Sbjct: 61  SNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLI 120

Query: 440 LTKMKETAEAYLG 478
            +KMKETA + LG
Sbjct: 121 FSKMKETAHSVLG 133


>UniRef50_A3CIL0 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 382

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 2/55 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           AYFN SQRQATKDA  I+GLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDL
Sbjct: 182 AYFNYSQRQATKDARVIAGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDL 236



 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +2

Query: 275 DAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKM 451
           DAKRLIG++F DA+VQ+D+  WPF+V++  G K  I V YKGE+K F  EE+SSMVL KM
Sbjct: 102 DAKRLIGQRFTDASVQSDIMLWPFKVIAGPGDKSMIVVQYKGEEKQFAAEEISSMVLIKM 161

Query: 452 KETAEAYLG 478
           +E AEAYLG
Sbjct: 162 REIAEAYLG 170



 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 34/76 (44%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           N   +AKRLIGR+F DA+VQ+D+K WPF+V++  G K  I V YKGE+K    E++    
Sbjct: 22  NMAENAKRLIGRRFTDASVQSDIKLWPFKVIAGPGDKSTIVVQYKGEEKQVAAEQIDDET 81

Query: 440 LTKMKETAEAYLGKLC 487
           ++     A+ Y G LC
Sbjct: 82  ISPSVCYADPYDGGLC 97


>UniRef50_Q05931 Cluster: Heat shock protein SSQ1, mitochondrial
           precursor; n=18; Ascomycota|Rep: Heat shock protein
           SSQ1, mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 657

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 71/206 (34%), Positives = 101/206 (49%), Gaps = 13/206 (6%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGK----VEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAM 254
           +GIDLGTT S V   +         II ND+G RTTPS VAF   +     D  K  V M
Sbjct: 31  IGIDLGTTNSAVAYIRDSNDKKSATIIENDEGQRTTPSIVAFDVKSSPQNKDQMKTLVGM 90

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSR-LSVMEANL---RSR*HIRVKTKPF--- 413
               Q ++ + ++  ++K L+ +      + R ++VM   +    S     + T      
Sbjct: 91  AAKRQNAINSENTFFATKRLIGRAFNDKEVQRDMAVMPYKIVKCESNGQAYLSTSNGLIQ 150

Query: 414 SPRKSVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIIN 590
           SP +                L      +     AYFNDSQRQATKDAG ++GLNVLR+IN
Sbjct: 151 SPSQIASILLKYLKQTSEEYLGEKVNLAVITVPAYFNDSQRQATKDAGKLAGLNVLRVIN 210

Query: 591 EPTAAAIAYGLDKKGTGERNVLIFDL 668
           EPTAAA+++G+D K      + ++DL
Sbjct: 211 EPTAAALSFGIDDK-RNNGLIAVYDL 235



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 26/73 (35%), Positives = 41/73 (56%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           NT F  KRLIGR F D  VQ DM   P+++V      +  ++         P +++S++L
Sbjct: 102 NTFFATKRLIGRAFNDKEVQRDMAVMPYKIVKCESNGQAYLS-TSNGLIQSPSQIASILL 160

Query: 443 TKMKETAEAYLGK 481
             +K+T+E YLG+
Sbjct: 161 KYLKQTSEEYLGE 173



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 19/25 (76%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL IEDG+FEV++T GDT
Sbjct: 237 GGTFDISILDIEDGVFEVRATNGDT 261


>UniRef50_A2WTX8 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 359

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 41/76 (53%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+F  KRL+GR+F DA+VQ  +K WPF+VV   G KP +  +YKG+ K    EEV+
Sbjct: 117 NPTNTVFATKRLMGRRFSDASVQDGLKLWPFKVVPGRGDKPMVAASYKGKQKLLAAEEVA 176

Query: 431 SMVLTKMKETAEAYLG 478
           SM+L+KMK  AEAY+G
Sbjct: 177 SMLLSKMKAEAEAYIG 192



 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 37/60 (61%), Positives = 46/60 (76%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           P +GIDLGT  SCV V+Q+G+ EI+ N+ G R TPSY AFTD ERL+GDAAK+Q +  PT
Sbjct: 60  PVIGIDLGTACSCVAVWQNGRAEIVTNEHGGRATPSYAAFTDAERLVGDAAKSQASRNPT 119


>UniRef50_Q54MR6 Cluster: Heat shock protein Hsp70 family protein;
           n=1; Dictyostelium discoideum AX4|Rep: Heat shock
           protein Hsp70 family protein - Dictyostelium discoideum
           AX4
          Length = 517

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 60/212 (28%), Positives = 100/212 (47%), Gaps = 13/212 (6%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MA    +GID GT ++CVG+F++ ++EI  N QGNRTTPS V+F   ++L+GD AK Q+ 
Sbjct: 1   MANNNIMGIDFGTHFACVGIFKNERIEICPNQQGNRTTPSVVSFVGDDKLVGDEAKAQMD 60

Query: 252 MTP-TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTK--PFSPR 422
             P  T Y +  +    ++  L             +  + N +    +  K+     +P 
Sbjct: 61  RNPLNTIYDVKRLLGRKTTDELFDHEVKKLSFKVTTYEDNNEKIEFQVNYKSNVVTLTPI 120

Query: 423 KSVPWCXXXXXXXXXXILA--NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
           +                +   +  +        F + QR   K+A T +G+ V+R+I+E 
Sbjct: 121 EIATSILEQIKHTAETFIGGESIKKAVISVPTDFTEKQRNDLKEAATAAGITVVRMIHEH 180

Query: 597 TAAAIAYGLDK--------KGTGERNVLIFDL 668
           +A A+AYG D+          + E NV++FDL
Sbjct: 181 SAVALAYGYDQVKECSETTNESKESNVMVFDL 212



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 3/78 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS---DGGKPKIKVAYKGEDKTFFPEE 424
           +P NTI+D KRL+GRK  D     ++K   F+V +   +  K + +V YK    T  P E
Sbjct: 62  NPLNTIYDVKRLLGRKTTDELFDHEVKKLSFKVTTYEDNNEKIEFQVNYKSNVVTLTPIE 121

Query: 425 VSSMVLTKMKETAEAYLG 478
           +++ +L ++K TAE ++G
Sbjct: 122 IATSILEQIKHTAETFIG 139


>UniRef50_A3GGV8 Cluster: Heat shock protein 70; n=2; Pichia
           stipitis|Rep: Heat shock protein 70 - Pichia stipitis
           (Yeast)
          Length = 946

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 42/77 (54%), Positives = 55/77 (71%)
 Frame = +2

Query: 248 GDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEV 427
           G +P NT++  KRLIGR F+D  VQ D+ H+ F+VV+  GKP I+V YK E +T  PEE+
Sbjct: 58  GKNPENTVYGTKRLIGRDFDDPEVQHDITHFLFKVVNRNGKPFIQVQYKKEIRTLPPEEI 117

Query: 428 SSMVLTKMKETAEAYLG 478
           S+MVL  +K TAE YLG
Sbjct: 118 SAMVLESVKCTAEEYLG 134



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 1/54 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG-LDKKGTGERNVLIFDL 668
           AYFNDSQR+ATK AG I+GLNVL IINEPTAAA+AYG  + K   ERN+L++DL
Sbjct: 146 AYFNDSQRKATKAAGEIAGLNVLGIINEPTAAALAYGQSNNKDCKERNLLVYDL 199



 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 35/59 (59%), Positives = 43/59 (72%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           P +GIDLGTT SCV VF + KVE+IAN  G+R TPS V+F D E +IG+ AKNQ+   P
Sbjct: 4   PVIGIDLGTTNSCVAVFNN-KVEVIANVLGSRITPSCVSFDDNETIIGEGAKNQLGKNP 61


>UniRef50_O88687 Cluster: Heat shock protein 70; n=2;
           Euteleostomi|Rep: Heat shock protein 70 - Mus musculus
           (Mouse)
          Length = 43

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 39/43 (90%), Positives = 40/43 (93%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVA 200
           MAK  A+GIDLGTTYSCVGV QHGKVEIIANDQGNRTTPSYVA
Sbjct: 1   MAKNTAIGIDLGTTYSCVGVLQHGKVEIIANDQGNRTTPSYVA 43


>UniRef50_A2Q6C3 Cluster: Heat shock protein Hsp70; n=1; Medicago
           truncatula|Rep: Heat shock protein Hsp70 - Medicago
           truncatula (Barrel medic)
          Length = 599

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 41/55 (74%), Positives = 47/55 (85%), Gaps = 2/55 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           AYFNDSQR+ATKDAG I+GLNV+RIINEPTAAA+AYGL K+     ERN+ IFDL
Sbjct: 124 AYFNDSQRKATKDAGAIAGLNVMRIINEPTAAALAYGLQKRANCLEERNIFIFDL 178



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query: 275 DAKRLIGRKFEDATVQADMKHWPFEVVSDGG-KPKIKVAYKGEDKTFFPEEVSSMVLTKM 451
           +AKRLIGRK+ D+ +Q D++ WPF+V++    KP+I V YKGE+K    EE+SSMVL KM
Sbjct: 44  NAKRLIGRKYSDSIIQNDIQLWPFKVLAGSDDKPEIIVKYKGEEKHLCAEEISSMVLKKM 103

Query: 452 KETAEAYL 475
           +E AE +L
Sbjct: 104 REIAENFL 111



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++ +F VK+TAGDT
Sbjct: 180 GGTFDVSLLTIKNNVFVVKATAGDT 204


>UniRef50_UPI00015B551B Cluster: PREDICTED: similar to
           ENSANGP00000015293; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000015293 - Nasonia
           vitripennis
          Length = 822

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 58/189 (30%), Positives = 82/189 (43%), Gaps = 2/189 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ-V 248
           MA    +GID G     + V + G +E IAND   R TPS VAF+   R++G AAKNQ V
Sbjct: 1   MAAMSVIGIDFGNDNCYIAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQLV 60

Query: 249 AMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKS 428
                T Y    +     +     K   S       + +  +        +   F+P + 
Sbjct: 61  TNMKNTIYGFKRLLGRKYNDPFAQKELQSLPYRTSQLADGGIGIHVQYLNEDHVFTPEQI 120

Query: 429 VPWCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L     +C     +YF  ++RQA  DA  I+GLNVLR+ NE TA 
Sbjct: 121 TAMLFTKLKDTSVTALQTAVNDCVISVPSYFTQAERQALLDAARIAGLNVLRLFNETTAT 180

Query: 606 AIAYGLDKK 632
           A+ YG+ K+
Sbjct: 181 ALTYGIYKQ 189



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 28/69 (40%), Positives = 45/69 (65%), Gaps = 2/69 (2%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEV--VSDGGKPKIKVAYKGEDKTFFPEEVSSM 436
           NTI+  KRL+GRK+ D   Q +++  P+    ++DGG   I V Y  ED  F PE++++M
Sbjct: 65  NTIYGFKRLLGRKYNDPFAQKELQSLPYRTSQLADGGIG-IHVQYLNEDHVFTPEQITAM 123

Query: 437 VLTKMKETA 463
           + TK+K+T+
Sbjct: 124 LFTKLKDTS 132


>UniRef50_A6E733 Cluster: Heat shock protein 70; n=1; Pedobacter sp.
           BAL39|Rep: Heat shock protein 70 - Pedobacter sp. BAL39
          Length = 617

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 62/197 (31%), Positives = 95/197 (48%), Gaps = 4/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRT-TPSYVAFT-DTERLIGDAAKNQVAMTPT 263
           VGIDLGTT S V      K+  + ND G     PS V F    + L+G+ AK  +   P 
Sbjct: 20  VGIDLGTTNSLVAFINPDKLPQVINDTGKGLLVPSVVHFNAHGDTLVGNEAKEFLITDPA 79

Query: 264 -TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK-SVPW 437
            T +S+  +       +   + T S       +++    +   I+   K ++P + S   
Sbjct: 80  NTIFSVKRLLGRSYKDLAAHQDTFS-----YKIIDDENDTLVKIKAGDKFYTPIELSAEI 134

Query: 438 CXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
                      +            AYFNDSQRQAT+DAG ++GL+VLRI+NEPTAA++AY
Sbjct: 135 LKELKGRAEHALKTPVNRAVITVPAYFNDSQRQATRDAGKLAGLDVLRIVNEPTAASLAY 194

Query: 618 GLDKKGTGERNVLIFDL 668
           G+      ++ + ++DL
Sbjct: 195 GIGLDPNKQQTIAVYDL 211



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 25/71 (35%), Positives = 41/71 (57%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           DP NTIF  KRL+GR ++D     D   + ++++ D     +K+  K  DK + P E+S+
Sbjct: 77  DPANTIFSVKRLLGRSYKDLAAHQDT--FSYKIIDDENDTLVKI--KAGDKFYTPIELSA 132

Query: 434 MVLTKMKETAE 466
            +L ++K  AE
Sbjct: 133 EILKELKGRAE 143



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL I++GIFEV ST G+T
Sbjct: 213 GGTFDVSILAIQNGIFEVLSTNGNT 237


>UniRef50_Q74IT6 Cluster: Chaperone protein dnaK; n=27; cellular
           organisms|Rep: Chaperone protein dnaK - Lactobacillus
           johnsonii
          Length = 624

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 39/53 (73%), Positives = 46/53 (86%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFND+QRQATKDAG I+GLNV RIINEPTA+A+AYGLDK    E+ VL++DL
Sbjct: 119 AYFNDAQRQATKDAGKIAGLNVQRIINEPTASALAYGLDKDENDEK-VLVYDL 170



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 31/63 (49%), Positives = 40/63 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GIDLGTT S V V +  + +II N +GNRTTPS VAF + E  +G+ AK Q    P T 
Sbjct: 5   IGIDLGTTNSAVAVLEGKEPKIITNPEGNRTTPSVVAFKNGEIQVGEVAKRQAITNPNTI 64

Query: 270 YSM 278
            S+
Sbjct: 65  VSI 67



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 18/25 (72%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL + DG+F+V ST GDT
Sbjct: 172 GGTFDVSILQLGDGVFQVLSTNGDT 196


>UniRef50_Q8ZN42 Cluster: Chaperone protein hscA; n=29;
           Proteobacteria|Rep: Chaperone protein hscA - Salmonella
           typhimurium
          Length = 616

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 63/196 (32%), Positives = 87/196 (44%), Gaps = 2/196 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           A GIDLGTT S V   + G+ E + + +G    PS V +      +G AA++  A     
Sbjct: 21  AAGIDLGTTNSLVATVRSGQAETLPDHEGRHLLPSVVHYQQQGHTVGYAARDNAAQDTA- 79

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSV-MEANLRSR*HIRVKTKPFSP-RKSVPWC 440
                N  S V   M        T    L    +A++     I       +P R S    
Sbjct: 80  -----NTISSVKRMMGRSLADIQTRYPHLPYRFKASVNGLPMIDTAAGLLNPVRVSADIL 134

Query: 441 XXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 620
                     +            AYF+D+QRQ TKDA  ++GL+VLR++NEPTAAAIAYG
Sbjct: 135 KALAARASESLSGELDGVVITVPAYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYG 194

Query: 621 LDKKGTGERNVLIFDL 668
           LD    G   + ++DL
Sbjct: 195 LDSGKEGV--IAVYDL 208



 Score = 37.9 bits (84), Expect = 0.26
 Identities = 15/25 (60%), Positives = 20/25 (80%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL +  G+FEV +T GD+
Sbjct: 210 GGTFDISILRLSRGVFEVLATGGDS 234


>UniRef50_Q7UM31 Cluster: Chaperone protein dnaK; n=3;
           Planctomycetaceae|Rep: Chaperone protein dnaK -
           Rhodopirellula baltica
          Length = 645

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 38/53 (71%), Positives = 46/53 (86%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFND+QRQATKDAG I+GL V RIINEPTAAA+AYGLDKK   + ++++FDL
Sbjct: 145 AYFNDAQRQATKDAGQIAGLEVARIINEPTAAALAYGLDKK--KDESIIVFDL 195



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMTP-T 263
           +GIDLGTT S V + +  + ++I N +GNR TPS VAFTD  E ++G+ A+ Q    P  
Sbjct: 8   IGIDLGTTNSVVAIMEGSEPKVIPNPEGNRLTPSVVAFTDKQETIVGEPARRQAVTNPKR 67

Query: 264 TQYS 275
           T YS
Sbjct: 68  TVYS 71



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 28/75 (37%), Positives = 46/75 (61%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  T++ AKR +GR+  +  VQ++ K  P+ +    G P   V  +  D  + P+E+S+
Sbjct: 64  NPKRTVYSAKRFMGRRHNE--VQSEEKMVPYGIT---GGPGDYVKIQVGDSEYTPQEISA 118

Query: 434 MVLTKMKETAEAYLG 478
            VL K+KE+AE+YLG
Sbjct: 119 KVLRKLKESAESYLG 133


>UniRef50_Q23841 Cluster: LAC ORF protein; n=2; Drosophila
           auraria|Rep: LAC ORF protein - Drosophila auraria (Fruit
           fly)
          Length = 613

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 38/62 (61%), Positives = 47/62 (75%), Gaps = 3/62 (4%)
 Frame = -3

Query: 254 HRHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDS---YCG 84
           HRHLVLG ++D+TLGVCE ++   G VALVVGDDLHL +L D +A VRG Q+DS   +C 
Sbjct: 551 HRHLVLGRVADQTLGVCECHVGGRGAVALVVGDDLHLSMLVDAHAGVRGAQVDSNGRHCV 610

Query: 83  CF 78
           CF
Sbjct: 611 CF 612



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 58/172 (33%), Positives = 82/172 (47%), Gaps = 9/172 (5%)
 Frame = -1

Query: 742 VAGGGFHLED-TILDGKDGHVEGTAARSKISTFRSPVPFLSRP*AIAAAVGSLMIRRTFK 566
           V+GGG  LE  +++DG+DG VEG AA+ +      P+  L +P      VG    R    
Sbjct: 386 VSGGGPDLEQGSLVDGQDGDVEGAAAQVEDEHVALPLEVLVQP------VGQCRRRGLVD 439

Query: 565 -PEMV-PASFVACL*E-SLKYAEP**LHSA-----QFAKISFGSFLHFRKHHGTDFLGEK 410
            PE V P      L   +L+  E    HS      + A+I      H  +HH  DFLG +
Sbjct: 440 DPEHVQPGDAAGVLGGLALRVVEVGG-HSDDRVRDRLAQIGLRRLPHLDQHHRADFLGGE 498

Query: 409 GFVFTLICYLDLRFASITDNLERPVLHVGLHSSIFELTSDETFGIEYCVVGV 254
                L  + DL  +++ D+LE PVLHV     +  L SDE  G+++ V GV
Sbjct: 499 ALGLALELHADLGLSAVADHLEGPVLHVLRDLRVVVLASDEALGVKHRVPGV 550



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 18/54 (33%), Positives = 31/54 (57%)
 Frame = -3

Query: 668 EVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEVRG 507
           +V+D++++    + V+ V        +DD E+VQ  D   +  GL+LRV+EV G
Sbjct: 412 QVEDEHVALPLEVLVQPVGQCRRRGLVDDPEHVQPGDAAGVLGGLALRVVEVGG 465


>UniRef50_UPI0000499AA8 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 757

 Score = 79.8 bits (188), Expect = 7e-14
 Identities = 64/216 (29%), Positives = 98/216 (45%), Gaps = 15/216 (6%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA--------KN 242
           AVGID+G     V V +   ++I+ N+  NR TP++V+F D ER IG+A         KN
Sbjct: 4   AVGIDIGNRNITVAVVRKKGIDIVVNEVSNRQTPTFVSFNDKERAIGEAGFSLYLRNVKN 63

Query: 243 QVAMTPTT---QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
            V         QY  P+V +++             G+  + VM         +R + K F
Sbjct: 64  TVVDVKRLIGRQYDCPDVQTELKELPYQTVKL-EDGMIGMKVM---------MRGEQKVF 113

Query: 414 SPRKSVPWCXXXXXXXXXXILANC-AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIIN 590
            P + +                +   +C      YF ++QR A  DA  I+G++ LR++N
Sbjct: 114 RPEQIIAMLLIQIKQFTEEYTKDIFTDCVISVPGYFTENQRIAMLDAAKIAGISCLRLMN 173

Query: 591 EPTAAAIAYGL---DKKGTGERNVLIFDLAAVPSTC 689
           E TA A+AYG+   D   T  R V+I D+    +TC
Sbjct: 174 EHTATALAYGIYKTDLSETEPRPVVILDVGHCNTTC 209



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 28/71 (39%), Positives = 46/71 (64%), Gaps = 1/71 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+ D KRLIGR+++   VQ ++K  P++ V  + G   +KV  +GE K F PE++ +M+
Sbjct: 63  NTVVDVKRLIGRQYDCPDVQTELKELPYQTVKLEDGMIGMKVMMRGEQKVFRPEQIIAML 122

Query: 440 LTKMKETAEAY 472
           L ++K+  E Y
Sbjct: 123 LIQIKQFTEEY 133


>UniRef50_A7PQC7 Cluster: Chromosome chr18 scaffold_24, whole genome
           shotgun sequence; n=3; core eudicotyledons|Rep:
           Chromosome chr18 scaffold_24, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 667

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 37/53 (69%), Positives = 43/53 (81%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG +KK      +L+FDL
Sbjct: 177 AYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKK--NNETILVFDL 227



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +3

Query: 66  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKN 242
           + +     VGIDLGTT S V   + GK  I+ N +G RTTPS VA+T + + L+G  AK 
Sbjct: 53  FHVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKNGDMLVGQIAKR 112

Query: 243 QVAMTPTTQY 272
           Q  + P   +
Sbjct: 113 QAVVNPENTF 122



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 18/25 (72%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L + DG+FEV ST+GDT
Sbjct: 229 GGTFDVSVLEVGDGVFEVLSTSGDT 253


>UniRef50_UPI0000499C8E Cluster: heat shock protein 70; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 603

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 35/53 (66%), Positives = 45/53 (84%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQR++TK+AG I+G +V+RIINEPTAAAIAYG ++    + NVL+FDL
Sbjct: 145 AYFNDSQRESTKNAGKIAGFDVMRIINEPTAAAIAYGFEQNIKEKSNVLVFDL 197



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 2/53 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG--KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           +GIDLGTT+SC+ V++    +VEII N QG  TTPS VAFTD +RLIG+ A N
Sbjct: 5   IGIDLGTTFSCMAVWKESSKRVEIITNRQGKETTPSVVAFTDKQRLIGEEAIN 57



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%), Gaps = 1/72 (1%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLT 445
           +FD KRLIGRK+ D  +Q D+K+  + +  +G  +P I+V Y      F PE++S+M+L 
Sbjct: 63  VFDVKRLIGRKYNDPELQKDLKYITYSIKDNGKNEPIIEVPYMSVLSAFRPEDISAMLLR 122

Query: 446 KMKETAEAYLGK 481
           + KE A   +G+
Sbjct: 123 RFKEIASDAMGR 134



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 14/25 (56%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDV++L+I++G ++V +T GDT
Sbjct: 199 GGTFDVTLLSIDNGEYKVIATDGDT 223


>UniRef50_UPI00015B45D7 Cluster: PREDICTED: similar to heat shock
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to heat shock protein - Nasonia vitripennis
          Length = 523

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 36/79 (45%), Positives = 55/79 (69%)
 Frame = +2

Query: 245 GGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEE 424
           G  +  NTI+ +KRLIGR+F D  V+A+ +HWPF VV   G+P  +V +K E K + P++
Sbjct: 71  GQRNSKNTIYSSKRLIGREF-DNEVKAESEHWPFAVVDKEGRPFYEVNHKSEIKYYSPQD 129

Query: 425 VSSMVLTKMKETAEAYLGK 481
           ++SM+L  +K+ AE+YL K
Sbjct: 130 IASMILEYVKQFAESYLTK 148



 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 71/215 (33%), Positives = 100/215 (46%), Gaps = 16/215 (7%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVF------------QHGKVEIIANDQGNRTTPSYVAFTDTE 215
           M++ P++GIDLGTT + +  +              G V IIAN +G+RTTPS VAF + E
Sbjct: 1   MSEVPSIGIDLGTTNTVIAAWIPETNKDLNSTKSSGTVNIIANSKGHRTTPSCVAFNEKE 60

Query: 216 RLIG-DAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HI 392
           RLIG  A       +  T YS   +        +  +    +     +V++   R    +
Sbjct: 61  RLIGTSALSQGQRNSKNTIYSSKRLIGREFDNEVKAE----SEHWPFAVVDKEGRPFYEV 116

Query: 393 RVKT--KPFSPRKSVPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTIS 563
             K+  K +SP+                 L     +      A FN  QR+ATK AG ++
Sbjct: 117 NHKSEIKYYSPQDIASMILEYVKQFAESYLTKKITDVVITVPANFNTIQREATKFAGEMA 176

Query: 564 GLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
            LNV  II+EP AAA+AYGL+ K      VLIFDL
Sbjct: 177 VLNV-SIISEPIAAALAYGLNHKINYNDYVLIFDL 210



 Score = 33.9 bits (74), Expect = 4.2
 Identities = 13/24 (54%), Positives = 21/24 (87%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVS++T+++ I  V++T+GD
Sbjct: 212 GGTFDVSVVTMQNDILIVEATSGD 235


>UniRef50_Q9M7S4 Cluster: Heat shock protein 70; n=1; Triticum
           aestivum|Rep: Heat shock protein 70 - Triticum aestivum
           (Wheat)
          Length = 130

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 38/94 (40%), Positives = 56/94 (59%)
 Frame = +2

Query: 74  GKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCRQEPGGD 253
           G+    R+R  +H+L+R  + AR   DHRQRPGQ  H+++  +HR  ASHRRC +     
Sbjct: 36  GRGAGHRHRPRHHLLVRRRVAARPRRDHRQRPGQPHHALVRRLHRLGASHRRCAKNQVAM 95

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV 355
           +P NT+FDA  L          Q+D+K WP++V+
Sbjct: 96  NPINTVFDANVLSAEGLL-MPCQSDIKMWPYKVI 128


>UniRef50_Q9PQF2 Cluster: Chaperone protein dnaK; n=38;
           Bacteria|Rep: Chaperone protein dnaK - Ureaplasma parvum
           (Ureaplasma urealyticum biotype 1)
          Length = 603

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 36/53 (67%), Positives = 46/53 (86%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+D+QRQATK+AG I+GL+V RIINEPTAAA+AYG+DK    E+ +L+FDL
Sbjct: 120 AYFDDAQRQATKNAGIIAGLSVERIINEPTAAALAYGIDKLDK-EQKILVFDL 171



 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 32/65 (49%), Positives = 41/65 (63%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAK   +GIDLGTT SCV V ++ K  ++ N +G RT PS V+F   E L+GDAAK +  
Sbjct: 1   MAKEIILGIDLGTTNSCVAVIENKKPIVLENPEGKRTVPSVVSFNGDEVLVGDAAKRKQI 60

Query: 252 MTPTT 266
             P T
Sbjct: 61  TNPNT 65



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 41/130 (31%), Positives = 60/130 (46%), Gaps = 3/130 (2%)
 Frame = +2

Query: 362 GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG-KLCRMQLSRFRVLQ*LSKTS 538
           G K K+ V     +K + PEE+S+ +LT +KE AE  +G K+ +  ++         + +
Sbjct: 74  GTKEKVTVL----NKDYTPEEISAKILTYIKEYAEKKIGAKVNKAVITVPAYFDDAQRQA 129

Query: 539 HKRCRY--HLWLERSPNHQ*TDCCCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDG 712
            K       L +ER  N          +    K     K       GGTFDVS+L + DG
Sbjct: 130 TKNAGIIAGLSVERIINEPTAAALAYGIDKLDK---EQKILVFDLGGGTFDVSVLDMADG 186

Query: 713 IFEVKSTAGD 742
            FEV ST+GD
Sbjct: 187 TFEVLSTSGD 196


>UniRef50_A2DML1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 708

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 52/197 (26%), Positives = 87/197 (44%), Gaps = 3/197 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGK-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           P +GIDLGTTY C+  F   K ++    D  +   PS+V+F + ER++G  A  Q+   P
Sbjct: 4   PHLGIDLGTTYCCIFAFDEKKNIKFSIRDGDSEQIPSFVSFANEERIVGRKAMAQMITNP 63

Query: 261 T-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPW 437
           T T Y    +        +  +   +   +    ME ++     I  +T    P +   +
Sbjct: 64  TNTIYDSKRMIGRNFDNQIFQEDRKNWMFTTTRGMEGSININATINNQTITLLPEEISGY 123

Query: 438 CXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAG-TISGLNVLRIINEPTAAAIA 614
                      ++ NC +      A FN+ QR+ T  A   I+G   + +++EP++AA+ 
Sbjct: 124 ILKHLKDTAELVIGNCTDVVITIPAAFNERQREKTIFAAQEIAGFRSVILLDEPSSAALE 183

Query: 615 YGLDKKGTGERNVLIFD 665
           Y        +  VLIFD
Sbjct: 184 YAQGLPSNADELVLIFD 200



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 430
           +P NTI+D+KR+IGR F++   Q D K+W F       G   I      +  T  PEE+S
Sbjct: 62  NPTNTIYDSKRMIGRNFDNQIFQEDRKNWMFTTTRGMEGSININATINNQTITLLPEEIS 121

Query: 431 SMVLTKMKETAEAYLG 478
             +L  +K+TAE  +G
Sbjct: 122 GYILKHLKDTAELVIG 137


>UniRef50_Q96269 Cluster: Heat-shock protein; n=14;
           Magnoliophyta|Rep: Heat-shock protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 831

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 58/201 (28%), Positives = 86/201 (42%), Gaps = 12/201 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT- 266
           +G D G     V V +   ++++ ND+ NR TP+ V F D ER IG A      M P   
Sbjct: 4   IGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDNERFIGTAGAASTMMNPKNS 63

Query: 267 ----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFS 416
                     Q+S P +  D+ S         + G     ++ AN         + + F+
Sbjct: 64  ISQIKRLIGRQFSDPELQRDIKSFPFSV----TEGPDGYPLIHANYLG------EKRAFT 113

Query: 417 PRKSVPWCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P + +              L     +C      YF D QR+A  DA TI+GL+ LR+I+E
Sbjct: 114 PTQVMGMMLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHE 173

Query: 594 PTAAAIAYGLDKKGTGERNVL 656
            TA A+AYG+ K    E + L
Sbjct: 174 TTATALAYGIYKTDLPESDQL 194



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 32/75 (42%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P N+I   KRLIGR+F D  +Q D+K +PF V     G P I   Y GE + F P +V 
Sbjct: 59  NPKNSISQIKRLIGRQFSDPELQRDIKSFPFSVTEGPDGYPLIHANYLGEKRAFTPTQVM 118

Query: 431 SMVLTKMKETAEAYL 475
            M+L+ +K  AE  L
Sbjct: 119 GMMLSNLKGIAEKNL 133


>UniRef50_A7RF55 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 391

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 65/199 (32%), Positives = 93/199 (46%), Gaps = 15/199 (7%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MA   A+G+ LG T SCV V   G   IIAND G+R TP+ VAF+DTE+ +G  AK  + 
Sbjct: 1   MADYLAIGVHLGATTSCVAVSADGNTTIIANDAGDRVTPAMVAFSDTEKNVGLPAKQGLI 60

Query: 252 MTPTT-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV 398
                            YS   V  + ++  L CK     GL    V E+N R   +I+V
Sbjct: 61  RNARNTILRAKRVLGKSYSDSVVQEEAAA--LQCKLIDKDGLPYYEV-ESNER---NIQV 114

Query: 399 KTKPFSPRKSVPWCXXXXXXXXXXILANCAECSYH----GSAYFNDSQRQATKDAGTISG 566
                SP++ +               ++C   S H        F + +    ++A   +G
Sbjct: 115 -----SPKEVI---NMIYKKMLETAQSHCGSSSNHVVLTVPVNFQEKEVSLLREAAEEAG 166

Query: 567 LNVLRIINEPTAAAIAYGL 623
            ++LRIINEP AAA+AYG+
Sbjct: 167 FHILRIINEPVAAALAYGM 185



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/72 (31%), Positives = 40/72 (55%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           NTI  AKR++G+ + D+ VQ +      +++   G P  +V     +    P+EV +M+ 
Sbjct: 65  NTILRAKRVLGKSYSDSVVQEEAAALQCKLIDKDGLPYYEVESNERNIQVSPKEVINMIY 124

Query: 443 TKMKETAEAYLG 478
            KM ETA+++ G
Sbjct: 125 KKMLETAQSHCG 136


>UniRef50_Q9VUC1 Cluster: CG6603-PA, isoform A; n=7;
           Endopterygota|Rep: CG6603-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 804

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 57/197 (28%), Positives = 88/197 (44%), Gaps = 5/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           +GID G     V   + G +E +AND   R TPS+VAF   +R+IG AAKN QV     T
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQQVTNMKNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
                 +     +   +     S      +  + ++  + +   + + F P +       
Sbjct: 64  VGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFT 123

Query: 447 XXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    +     +C      +F +++R+A  DA  I+GLNVLR++NE TA A+AYG 
Sbjct: 124 KLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGF 183

Query: 624 DKKGTGE---RNVLIFD 665
            K    E   RNV+  D
Sbjct: 184 YKNDLFEDKPRNVIFVD 200



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE++++M+
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAML 121

Query: 440 LTKMKETAEA 469
            TK+KET+ A
Sbjct: 122 FTKLKETSAA 131


>UniRef50_A7HDT8 Cluster: 2-alkenal reductase; n=7; Bacteria|Rep:
           2-alkenal reductase - Anaeromyxobacter sp. Fw109-5
          Length = 623

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 35/53 (66%), Positives = 43/53 (81%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFND QRQATKDAG I+GL VLRI+NEPTAAA+AYG  ++   +  V++FDL
Sbjct: 148 AYFNDGQRQATKDAGRIAGLEVLRIVNEPTAAALAYGFGRQVRSK--VVVFDL 198



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/79 (36%), Positives = 47/79 (59%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  T+F AKRLIGR++  + V+   K  P+E+V+      ++V   G  +     E+S+
Sbjct: 64  NPEGTVFAAKRLIGRRWGSSEVEDARKALPYELVAGPEGNDVRVQLGG--RAVSMPELSA 121

Query: 434 MVLTKMKETAEAYLGKLCR 490
           +VL ++K  AEA+LGK  R
Sbjct: 122 LVLAELKADAEAFLGKPVR 140



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/60 (45%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           P VGIDLGTT S V   Q G   +I    G   TPS VA   +  RL+G  AK Q    P
Sbjct: 6   PVVGIDLGTTNSVVATVQDGVPRVIPGRTGQPLTPSVVAVAKNGRRLVGALAKRQAITNP 65


>UniRef50_A5CDY3 Cluster: Heat shock chaperone protein hscA; n=1;
           Orientia tsutsugamushi Boryong|Rep: Heat shock chaperone
           protein hscA - Orientia tsutsugamushi (strain Boryong)
           (Rickettsia tsutsugamushi)
          Length = 616

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 57/187 (30%), Positives = 85/187 (45%), Gaps = 3/187 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI--GDAAKNQVAMTPT 263
           VGID GTT S V    + K  +IAN QG    PS V+F     +I  G   K+ +A+T  
Sbjct: 21  VGIDFGTTNSLVAHSINSKAYVIANSQGLNKLPSIVSFNHEGNVISIGSKEKHYIAITSV 80

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK-SVPWC 440
            +    +    ++S  +         +  L V   N+ S   +++  K  SP + S    
Sbjct: 81  KRLLGKSTEEILNSSAI------GQEIKELLVKNTNITS---LKIADKTISPIEISAKII 131

Query: 441 XXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 620
                           +      A+F+D+ R + K A  I+ L+VLR+I+EPTAAA +YG
Sbjct: 132 NQLKLQAEQYFNQKIKKAVISVPAHFDDAARNSIKQAAKIADLDVLRLISEPTAAAYSYG 191

Query: 621 LDKKGTG 641
           LDK   G
Sbjct: 192 LDKGSNG 198



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 15/24 (62%), Positives = 20/24 (83%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVS+L I++ IF+V +T GD
Sbjct: 207 GGTFDVSLLKIKNKIFQVIATGGD 230


>UniRef50_Q4SW20 Cluster: Chromosome undetermined SCAF13693, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF13693,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 857

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 60/196 (30%), Positives = 91/196 (46%), Gaps = 3/196 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP- 260
           +G+DLGTT+  VGVF    G+VE++A+ +G R+ PS V+FT    L+G  A  Q    P 
Sbjct: 32  IGLDLGTTFCSVGVFYPGSGEVEVLADAEGRRSIPSCVSFTAAAVLVGHEAAEQADRNPR 91

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWC 440
            T Y        +    +L +   +   SR    E  + +     V       R  +   
Sbjct: 92  NTIYDAKRFIGKLFEPGVLEREERALHPSRNGSAEFLVSTNRSFGVSPTFVGSRLLL--- 148

Query: 441 XXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 620
                     + A   +      A F++ QR  T  A  ++GL VLR+I+EPTAAA+AYG
Sbjct: 149 -RMRSMAERRLGAPVHKAVVSVPADFDERQRNYTVKAAQLAGLEVLRVISEPTAAAMAYG 207

Query: 621 LDKKGTGERNVLIFDL 668
           + +      +VL+ DL
Sbjct: 208 VHRAEV--LSVLVVDL 221



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 25/80 (31%), Positives = 37/80 (46%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFP 418
           E    +P NTI+DAKR IG+ FE   ++ + +       S  G  +  V+         P
Sbjct: 84  EQADRNPRNTIYDAKRFIGKLFEPGVLEREERALH---PSRNGSAEFLVS-TNRSFGVSP 139

Query: 419 EEVSSMVLTKMKETAEAYLG 478
             V S +L +M+  AE  LG
Sbjct: 140 TFVGSRLLLRMRSMAERRLG 159


>UniRef50_Q73CC4 Cluster: Dnak protein, truncation; n=1; Bacillus
           cereus ATCC 10987|Rep: Dnak protein, truncation -
           Bacillus cereus (strain ATCC 10987)
          Length = 505

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 32/53 (60%), Positives = 47/53 (88%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+D+QR+AT+DAG I+GL+VL++INEPTAAA+AYGL  +   ++NV+++DL
Sbjct: 119 AYFDDAQRKATQDAGRIAGLHVLKVINEPTAAALAYGLANR-EQKQNVMVYDL 170



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           +GIDLGTT S V  +   G   I+ N +G R TPS + F D   +IG  AK+     PT
Sbjct: 3   IGIDLGTTNSAVAYIDDSGNPTILPNREGERVTPSVIFFEDGSPVIGSTAKSISVSDPT 61


>UniRef50_A1WTC7 Cluster: Heat shock protein 70; n=1; Halorhodospira
           halophila SL1|Rep: Heat shock protein 70 -
           Halorhodospira halophila (strain DSM 244 / SL1)
           (Ectothiorhodospirahalophila (strain DSM 244 / SL1))
          Length = 577

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 33/53 (62%), Positives = 45/53 (84%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+D+QRQAT+DAGT++GL V+RIINEPTAAA+AY  D+     R++L++DL
Sbjct: 120 AYFSDAQRQATRDAGTLAGLEVVRIINEPTAAALAYESDQ--AERRHILVYDL 170



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           +GIDLGTT S V V ++G+V++I  +      PS V   +    L+G AA+NQ+A+ P
Sbjct: 6   IGIDLGTTNSEVAVVRNGQVQLIEVEDA-YLMPSAVGLDEEGGLLVGYAARNQLALHP 62


>UniRef50_Q62IZ5 Cluster: Chaperone protein hscA homolog; n=27;
           Proteobacteria|Rep: Chaperone protein hscA homolog -
           Burkholderia mallei (Pseudomonas mallei)
          Length = 622

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 32/44 (72%), Positives = 38/44 (86%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG 641
           AYF+D+QRQATKDA  ++GLNVLR++NEPTAAAIAYGLD    G
Sbjct: 157 AYFDDAQRQATKDAARLAGLNVLRLLNEPTAAAIAYGLDNGAEG 200



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 26/59 (44%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           AVGIDLGTT S V   ++   E + +D G    PS V + D   R IG AAK + A+ P
Sbjct: 21  AVGIDLGTTNSLVAAVRNSIPEALPDDAGRVLLPSVVRYLDKGGRRIGHAAKEEAAIDP 79



 Score = 36.3 bits (80), Expect = 0.80
 Identities = 26/81 (32%), Positives = 38/81 (46%)
 Frame = +2

Query: 236 QEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFF 415
           +E    DP NTI   KR +GR   +    A+    P+E V   G  +I+      D    
Sbjct: 72  KEEAAIDPRNTIVSVKRFMGRGKAEVEGAANA---PYEFVDAPGMVQIRTV----DGVKS 124

Query: 416 PEEVSSMVLTKMKETAEAYLG 478
           P EVS+ +L  +++ AE  LG
Sbjct: 125 PVEVSAEILATLRQRAEDTLG 145



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 14/25 (56%), Positives = 19/25 (76%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL +  G+FEV +  GD+
Sbjct: 209 GGTFDLSILKLTKGVFEVLAAGGDS 233


>UniRef50_A5CWM2 Cluster: Molecular chaperone HscA; n=2;
           Gammaproteobacteria|Rep: Molecular chaperone HscA -
           Vesicomyosocius okutanii subsp. Calyptogena okutanii
           (strain HA)
          Length = 614

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 35/54 (64%), Positives = 44/54 (81%), Gaps = 1/54 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV-LIFDL 668
           AYFND+QRQATKDA T++GL  LR++NEPTAAA+AYGL+   +GE  V  I+DL
Sbjct: 157 AYFNDAQRQATKDAATLAGLKTLRLLNEPTAAAVAYGLE---SGEEGVHAIYDL 207



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 44/167 (26%), Positives = 71/167 (42%), Gaps = 4/167 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           DP NTI   KR +G  +E+ +     K+ P++++ DG      V +          E+S+
Sbjct: 78  DPTNTIISIKRFMGMSYEEVST---FKNCPYQLIKDGN----NVLFHTSMGNLSAVEISA 130

Query: 434 MVLTKMKETAEAYL-GKLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDCC 604
            +L+ +K+ AE  L G L    ++         + + K       L+  R  N       
Sbjct: 131 SILSSLKQRAENSLGGVLSGAVITTPAYFNDAQRQATKDAATLAGLKTLRLLNEPTAAAV 190

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDGIFEVKSTAGD 742
              L S ++G       Y    GG TFD+SIL    G+F+V +  GD
Sbjct: 191 AYGLESGEEG---VHAIY--DLGGGTFDISILNFSKGVFKVLAIGGD 232


>UniRef50_Q7X1K7 Cluster: HscA chaperone; n=1; Leptospirillum
           ferrooxidans|Rep: HscA chaperone - Leptospirillum
           ferrooxidans
          Length = 588

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 60/185 (32%), Positives = 92/185 (49%), Gaps = 7/185 (3%)
 Frame = +3

Query: 135 QHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT-TQYS----MPNVSSDV 299
           + GK+ +I + +G +  PS VA + +   +G AAK+++    T   YS    M    SDV
Sbjct: 2   EDGKLRVIPDTEGRKLLPSVVALSSSGVQVGFAAKSRLNDPETIVVYSAKRLMGRSFSDV 61

Query: 300 SSKM-LLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXXXXXXXXXXIL 476
             ++  L  P     +  L ++    R R H+       +P+                + 
Sbjct: 62  EQEIGQLAYPV--ENVDGLPLIPDPFRKR-HLS------APQIGAMILSELRKRAEVALG 112

Query: 477 ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNV- 653
               +      AYFND+QRQATKDAG ++GLNVLRI+NEPT+AA+AYG    G G+  + 
Sbjct: 113 QTVTDAVITVPAYFNDAQRQATKDAGEMAGLNVLRILNEPTSAALAYGF---GAGKDGLY 169

Query: 654 LIFDL 668
            ++DL
Sbjct: 170 AVYDL 174



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 17/25 (68%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD S+L+I  G+FEVK+T+GDT
Sbjct: 176 GGTFDFSLLSIRRGVFEVKATSGDT 200



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +2

Query: 251 DDPNN-TIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEV 427
           +DP    ++ AKRL+GR F D   +     +P E V   G P I   ++   +     ++
Sbjct: 40  NDPETIVVYSAKRLMGRSFSDVEQEIGQLAYPVENVD--GLPLIPDPFR--KRHLSAPQI 95

Query: 428 SSMVLTKMKETAEAYLGK 481
            +M+L+++++ AE  LG+
Sbjct: 96  GAMILSELRKRAEVALGQ 113


>UniRef50_Q9TW52 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 607

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 33/53 (62%), Positives = 42/53 (79%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFN +QR+AT++A  I+GL VLRI+NEPTAAAIAY L  +    RN+LI+DL
Sbjct: 145 AYFNATQRRATEEAAEIAGLKVLRILNEPTAAAIAYSLKGQRLSRRNILIYDL 197



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/68 (41%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTPT 263
           ++GIDLGTT+SCV  +Q+G+V I+ N+ G RTTPS +A   D + LIG  AK+ +     
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNILENENGCRTTPSVLAVGEDGDLLIGQHAKDVIGKATN 61

Query: 264 TQYSMPNV 287
           + + +  +
Sbjct: 62  SLFDVKRI 69



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           N++FD KR+IGR+++D  +Q DM  WPF+V   D G P +++    +   F    VSS++
Sbjct: 61  NSLFDVKRIIGRRYDDVLLQRDMPLWPFKVEKDDNGIPYLEIHKNEKPLKFSAVTVSSLI 120

Query: 440 LTKMKETAEAYLG 478
           L  +K  AE  LG
Sbjct: 121 LRCLKYNAERKLG 133


>UniRef50_Q5UPU0 Cluster: Heat shock protein 70 homolog; n=1;
           Acanthamoeba polyphaga mimivirus|Rep: Heat shock protein
           70 homolog - Mimivirus
          Length = 941

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 34/58 (58%), Positives = 46/58 (79%), Gaps = 3/58 (5%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLIFDLAA 674
           AYFND+QRQAT D+  I+GL+VL+IINEPTAAA+AYGL  +   ++   NV+++DL A
Sbjct: 168 AYFNDAQRQATLDSAKIAGLDVLKIINEPTAAALAYGLGSEKWNKKTGGNVIVYDLGA 225



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/49 (46%), Positives = 35/49 (71%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           +GIDLGT +SCV ++++ + EII +  GNRT PS V+F  + +L+G  A
Sbjct: 20  IGIDLGTRFSCVSIWRNKRFEIIPDQFGNRTIPSVVSFYKSAKLVGHNA 68



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 7/83 (8%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGK-PKIKVAYKGEDKT------F 412
           +P NTI+D KR+IGR+  D +++       +E+VSD  K   I V     D T      +
Sbjct: 75  NPKNTIYDIKRIIGRRMNDKSIEQTKNLISYELVSDESKHENILVQLDKSDYTLTHKYQY 134

Query: 413 FPEEVSSMVLTKMKETAEAYLGK 481
            PEE+ + +L +++  A  YL K
Sbjct: 135 KPEEICAQILIEIRRIASQYLQK 157


>UniRef50_Q7ZUM5 Cluster: Heat shock protein 4; n=20;
           Euteleostomi|Rep: Heat shock protein 4 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 840

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 54/185 (29%), Positives = 85/185 (45%), Gaps = 4/185 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ-VAMTPTT 266
           VG D+G     V V + G +E +AN+  +R TP+ V+F    R IG AAK+Q V     T
Sbjct: 4   VGFDVGFLNCYVAVARAGGIETVANEYSDRCTPACVSFGPRNRSIGAAAKSQMVTNCKNT 63

Query: 267 QYSMPNVSSDVSSKMLL--CKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWC 440
            +          S   +   KP+    L+++      L+       + K FS  +     
Sbjct: 64  VHGFKRFHGRAFSDPFVQNLKPSLVYDLAQMPSGTTGLKVM--YMEEEKVFSIEQVTAML 121

Query: 441 XXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
                      L    A+C      ++ D++R++  DA  I+GLN LR++NE TA A+AY
Sbjct: 122 LTKLKETAESALKKPVADCVISVPCFYTDAERRSVIDAAQIAGLNCLRLMNETTAVALAY 181

Query: 618 GLDKK 632
           G+ K+
Sbjct: 182 GIYKQ 186



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 30/74 (40%), Positives = 42/74 (56%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR  GR F D  VQ       +++     G   +KV Y  E+K F  E+V++M+
Sbjct: 62  NTVHGFKRFHGRAFSDPFVQNLKPSLVYDLAQMPSGTTGLKVMYMEEEKVFSIEQVTAML 121

Query: 440 LTKMKETAEAYLGK 481
           LTK+KETAE+ L K
Sbjct: 122 LTKLKETAESALKK 135


>UniRef50_Q2J6R7 Cluster: Heat shock protein 70; n=3; Frankia|Rep:
           Heat shock protein 70 - Frankia sp. (strain CcI3)
          Length = 556

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 32/53 (60%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF D +R+ATK AG ++GLNV+ IINEPTAAA AYG  + G  E  VL++DL
Sbjct: 128 AYFGDEERKATKLAGELAGLNVVDIINEPTAAAFAYGFGQDGAEESTVLVYDL 180



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 6/69 (8%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFT-----DTERLIGDA 233
           MA     GIDLGTTYSC+  V ++G+ E+I N +   TTPS V F       T  ++G  
Sbjct: 1   MAGTKVFGIDLGTTYSCIAQVDEYGRPEVIRNIESQPTTPSVVLFDTGAEGPTSFVVGTQ 60

Query: 234 AKNQVAMTP 260
           AK Q  + P
Sbjct: 61  AKRQARIRP 69


>UniRef50_A5AUN6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 153

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 32/38 (84%), Positives = 34/38 (89%)
 Frame = +3

Query: 147 VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           V+ IANDQGNRT PSYV FT+TERLIGDAAKNQVAM P
Sbjct: 5   VDFIANDQGNRTMPSYVDFTNTERLIGDAAKNQVAMNP 42



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +3

Query: 531 RQATKDAGTISGLNVLRIINEPTAA 605
           RQATKDA  I+GL+V+RIINEP AA
Sbjct: 90  RQATKDARAIAGLDVVRIINEPIAA 114


>UniRef50_O59838 Cluster: Heat shock protein homolog pss1; n=21;
           Fungi|Rep: Heat shock protein homolog pss1 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 720

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 52/197 (26%), Positives = 94/197 (47%), Gaps = 12/197 (6%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           ++   VGID G + + + V ++  +++I N+  NR+TPS V++ +  R +G+AAK+  A 
Sbjct: 3   SRTNVVGIDFGNSKTVIAVARNRAIDVIVNEVSNRSTPSLVSYGERSRFLGEAAKSAEAS 62

Query: 255 T-----------PTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR-*HIRV 398
                           Y  P +  D+ S  +  K T   G     V   N  +   +I++
Sbjct: 63  NFRNTVGSLKRLAGRTYDDPEI-KDIESNFISAKLTEVDGFVGAKVQYLNEETAFSNIQL 121

Query: 399 KTKPFSPRKSVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVL 578
               F+  K++             ++ + ++      A+F D QR+A  +A  I+GLN L
Sbjct: 122 IAAYFTKIKAI---------AEAELIGSVSDVVISIPAWFTDIQRRALLEAANIAGLNPL 172

Query: 579 RIINEPTAAAIAYGLDK 629
           R++N+  AAA+ YG+ K
Sbjct: 173 RLMNDNAAAALTYGITK 189



 Score = 32.7 bits (71), Expect = 9.8
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQ-ADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KRL GR ++D  ++  +      ++    G    KV Y  E+  F   ++ +  
Sbjct: 66  NTVGSLKRLAGRTYDDPEIKDIESNFISAKLTEVDGFVGAKVQYLNEETAFSNIQLIAAY 125

Query: 440 LTKMKETAEAYL 475
            TK+K  AEA L
Sbjct: 126 FTKIKAIAEAEL 137


>UniRef50_O14992 Cluster: HS24/P52; n=8; Eutheria|Rep: HS24/P52 -
           Homo sapiens (Human)
          Length = 474

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 14/195 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP--T 263
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV      T
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNT 63

Query: 264 TQ---------YSMPNVSSDVSSKM--LLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
            Q         +S P V ++ S+    ++  PT  TG+ +++ ME           + + 
Sbjct: 64  VQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGI-KVTYME-----------EERN 111

Query: 411 FSPRKSVPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+  +               +L     +C      ++ D++R++  DA  I+GLN LR++
Sbjct: 112 FTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLM 171

Query: 588 NEPTAAAIAYGLDKK 632
           NE TA A+AYG+ K+
Sbjct: 172 NETTAVALAYGIYKQ 186



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V++M+
Sbjct: 62  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAML 121

Query: 440 LTKMKETAEAYLGK 481
           L+K+KETAE+ L K
Sbjct: 122 LSKLKETAESVLKK 135


>UniRef50_Q8ZCS5 Cluster: Chaperone protein hscA; n=188;
           Bacteria|Rep: Chaperone protein hscA - Yersinia pestis
          Length = 650

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 33/54 (61%), Positives = 45/54 (83%), Gaps = 1/54 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL-IFDL 668
           AYF+D+QRQ TKDA  ++GL+VLR++NEPTAAAIAYGLD   +G+  V+ ++DL
Sbjct: 192 AYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLD---SGQEGVIAVYDL 242



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 49/167 (29%), Positives = 73/167 (43%), Gaps = 3/167 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           DP NTI   KR++GR   D   +     + F   S+ G P I+ A +G      P +VS+
Sbjct: 111 DPVNTISSVKRMMGRSLADIVQRYPNLPYQFHA-SENGLPMIQTA-RG---LVNPVQVSA 165

Query: 434 MVLTKMKETAEAYL-GKLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDCC 604
            +L  + + A+A L G+L  + ++         +   K       L   R  N       
Sbjct: 166 EILKTLAQRAQAALAGELDGVVITVPAYFDDAQRQGTKDAARLAGLHVLRLLNEPTAAAI 225

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
              L S Q+G            GGTFD+SIL +  G+FEV +T GD+
Sbjct: 226 AYGLDSGQEGVIAVYDL----GGGTFDISILRLSRGVFEVLATGGDS 268


>UniRef50_Q8SSB1 Cluster: HEAT SHOCK RELATED 70kDa PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: HEAT SHOCK RELATED 70kDa
           PROTEIN - Encephalitozoon cuniculi
          Length = 683

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +3

Query: 63  KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTE-RLIGDAAK 239
           K K   + A+GIDLGTT+SCV  +  GKVE+I N  G RTTPS V+F +    ++G AA+
Sbjct: 5   KAKSNTSRAIGIDLGTTFSCVAGYISGKVEVITNQDGERTTPSVVSFDENNCTVVGTAAR 64

Query: 240 NQVAMTP 260
           N V   P
Sbjct: 65  NMVGSDP 71



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 37/95 (38%), Positives = 50/95 (52%), Gaps = 18/95 (18%)
 Frame = +2

Query: 248 GDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEV--------------VSDGGKP---- 373
           G DP + IFDAKR+IGR+F+D  +Q  +K WPF+V              VS+G       
Sbjct: 68  GSDPMSVIFDAKRMIGREFDDPKIQNAIKGWPFKVVRYNHREKREEPNKVSEGSNSYDNI 127

Query: 374 KIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG 478
            IK+   G+   + P E+S  VL  +K  AEA LG
Sbjct: 128 AIKITRNGKTNYYAPVEISGKVLLYLKNAAEARLG 162



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 7/60 (11%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGL--NVLRIINEPTAAAIAYG-----LDKKGTGERNVLIFDL 668
           AYF + Q+  TK A TI+G   N +R++ EPTAAA+AYG      +   + + +VL+FDL
Sbjct: 174 AYFEEPQKDVTKAAATIAGFDPNKVRLLAEPTAAAMAYGHIQTQKNANFSAKEDVLVFDL 233


>UniRef50_A5WFY3 Cluster: 2-alkenal reductase; n=3;
           Psychrobacter|Rep: 2-alkenal reductase - Psychrobacter
           sp. PRwf-1
          Length = 650

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 34/59 (57%), Positives = 44/59 (74%), Gaps = 6/59 (10%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG------ERNVLIFDL 668
           AYF+++QRQATKDA  ++GL VLR++NEPTAAA+AYGLD+          ER  LI+DL
Sbjct: 166 AYFDEAQRQATKDAAQLAGLKVLRLLNEPTAAAVAYGLDRAAGSSDETQQERLFLIYDL 224



 Score = 36.7 bits (81), Expect = 0.60
 Identities = 14/25 (56%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L + +G+FEV +T G++
Sbjct: 226 GGTFDVSLLKMNEGVFEVLATGGNS 250


>UniRef50_Q7M080 Cluster: DnaK-type molecular chaperone; n=1;
           Cricetulus griseus|Rep: DnaK-type molecular chaperone -
           Cricetulus griseus (Chinese hamster)
          Length = 137

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 33/41 (80%), Positives = 37/41 (90%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           AYFND+QR    DAGTI+GLNV+RIINEPTAAAIAYGLDK+
Sbjct: 46  AYFNDAQR----DAGTIAGLNVMRIINEPTAAAIAYGLDKR 82



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 19/33 (57%), Positives = 25/33 (75%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEV 352
           +P NT+FDAK LIGR + D +VQ D+K  PF+V
Sbjct: 6   NPENTVFDAK-LIGRTWNDPSVQQDIKFLPFKV 37


>UniRef50_Q1Q0A3 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 545

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 31/53 (58%), Positives = 41/53 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF D +R ATK+AG I+G NVL +I+EP AAA++YGLDK    ++NV +FDL
Sbjct: 153 AYFGDPERAATKEAGVIAGFNVLAVIDEPVAAALSYGLDKL-KQDQNVFVFDL 204



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 3/64 (4%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQH--GKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQV 248
           K   VGIDLGTT+S +       GK EII + + +R TPS V      + ++G+ AK   
Sbjct: 17  KTTVVGIDLGTTFSAIAHINEDTGKAEIIPSPEQDRITPSVVLIEKVNDIIVGEIAKQNA 76

Query: 249 AMTP 260
              P
Sbjct: 77  VAEP 80


>UniRef50_Q1CWT5 Cluster: DnaK family protein; n=2;
           Cystobacterineae|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 608

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 32/60 (53%), Positives = 46/60 (76%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           +C     A F+D+QRQAT++A +I+GL+V+R++NEPTAAA+AYGL +   G  N L+FDL
Sbjct: 138 KCVITVPANFDDNQRQATREAASIAGLDVVRLVNEPTAAALAYGLSRGFEG--NALVFDL 195



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 16/24 (66%), Positives = 21/24 (87%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVSIL ++ G+FEV++T GD
Sbjct: 197 GGTFDVSILEVKSGVFEVRATGGD 220



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKN 242
           +GIDLGTT S V   + G+  +I    G R TPS +      ER++G AA++
Sbjct: 6   IGIDLGTTNSAVATVEDGRPRMIPPRAGGRLTPSTLGVNKAGERVVGVAAQS 57


>UniRef50_A0NBI8 Cluster: ENSANGP00000031574; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031574 - Anopheles gambiae
           str. PEST
          Length = 503

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 32/50 (64%), Positives = 41/50 (82%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLI 659
           A F+D QRQA  DA TI+GL+VLR+INEPTAAAI+ G++KK  GE+ VL+
Sbjct: 127 AQFSDGQRQAVLDAATIAGLSVLRLINEPTAAAISIGINKKLIGEQYVLV 176



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 30/58 (51%), Positives = 41/58 (70%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A+GID GT++S VG++++GK EIIAN+ GN   PS VAFT+  RL+G+ A  Q    P
Sbjct: 5   AIGIDFGTSFSSVGIYRNGKFEIIANECGNHRIPSVVAFTEKGRLVGEEALAQADTDP 62



 Score = 37.5 bits (83), Expect = 0.34
 Identities = 15/25 (60%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GG  DVSI+TI +G+F+VK+++GDT
Sbjct: 181 GGFLDVSIVTIYNGVFQVKASSGDT 205



 Score = 36.3 bits (80), Expect = 0.80
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 7/82 (8%)
 Frame = +2

Query: 257 PNNTIFDAK-RLIGRKFEDATVQADMK--HWPFEVVSDGGKPK----IKVAYKGEDKTFF 415
           P+   F  K RL+G   E+A  QAD    +   EV    G+ K    ++V +KGE K + 
Sbjct: 38  PSVVAFTEKGRLVG---EEALAQADTDPANCVIEVKRILGRHKKEGGLQVQFKGETKCYQ 94

Query: 416 PEEVSSMVLTKMKETAEAYLGK 481
           PEE+  ++L  ++  AE  LG+
Sbjct: 95  PEEICGIILAHLRSMAERQLGE 116


>UniRef50_A6C7U8 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Planctomyces maris DSM 8797|Rep: DnaK protein (Heat
           shock protein), C-terminal region has VWA type A domain
           - Planctomyces maris DSM 8797
          Length = 715

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 30/53 (56%), Positives = 42/53 (79%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF D++R+AT +AG  +GLN+L++INEPTAAAIAYG+  +     NVL++DL
Sbjct: 121 AYFYDAERKATIEAGRQAGLNILQLINEPTAAAIAYGVTAQPKSTSNVLVYDL 173



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/51 (45%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           +GIDLGTT S V  V    +VE++ N+ G   TPS V F +   ++GD AK
Sbjct: 5   IGIDLGTTNSVVATVGCSERVEVLPNEHGKSITPSVVLFENGSVVVGDEAK 55


>UniRef50_A2ECF5 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 730

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 30/78 (38%), Positives = 49/78 (62%), Gaps = 1/78 (1%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEV 427
           ++P NT++D+KR+IG+KF +   Q D ++WPF    +D    +I V+ +G+     PEEV
Sbjct: 61  NNPENTVYDSKRMIGKKFSNPDFQIDRQNWPFNTSQADDDSIRINVSARGKKLNLRPEEV 120

Query: 428 SSMVLTKMKETAEAYLGK 481
           S  +L  +K TAE  +G+
Sbjct: 121 SGNILRYLKATAEKVIGE 138



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 50/195 (25%), Positives = 81/195 (41%), Gaps = 3/195 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGK-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-T 263
           +GIDLGTTY C+  +   K V     DQ +    SYV++   + + G  A+NQV   P  
Sbjct: 6   LGIDLGTTYCCIYYYDEKKHVAEAIKDQDSSQIASYVSYNKDDVVYGSVAQNQVMNNPEN 65

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCX 443
           T Y    +     S         +   +     + ++R     R K     P +      
Sbjct: 66  TVYDSKRMIGKKFSNPDFQIDRQNWPFNTSQADDDSIRINVSARGKKLNLRPEEVSGNIL 125

Query: 444 XXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAG-TISGLNVLRIINEPTAAAIAYG 620
                    ++  C++      A F++ QR+ T  A   I+G   + +++EP+AAA+ Y 
Sbjct: 126 RYLKATAEKVIGECSDVVITIPASFDEIQREKTIFAAKEIAGFKNVALLDEPSAAALEYA 185

Query: 621 LDKKGTGERNVLIFD 665
            +     E  VLIFD
Sbjct: 186 QNLPPNSEEKVLIFD 200


>UniRef50_Q2AVL1 Cluster: Heat shock protein Hsp70; n=1; Bacillus
           weihenstephanensis KBAB4|Rep: Heat shock protein Hsp70 -
           Bacillus weihenstephanensis KBAB4
          Length = 578

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 32/53 (60%), Positives = 42/53 (79%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+DSQR+AT+ AG I+GL V RIINEPTAAAIAYG +     + ++L++DL
Sbjct: 119 AYFSDSQRKATQKAGEIAGLKVERIINEPTAAAIAYGFENLDQNQ-HILVYDL 170



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 29/58 (50%), Positives = 37/58 (63%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV-AFTDTERLIGDAAKNQVAMTP 260
           VGIDLGTT S +   ++GK EII N +GNRTTPS V      E +IG+ AK+ +   P
Sbjct: 4   VGIDLGTTNSAIAYLKNGKPEIIENKKGNRTTPSVVQKDLKGEIIIGEDAKSGIKSLP 61



 Score = 36.3 bits (80), Expect = 0.80
 Identities = 15/24 (62%), Positives = 21/24 (87%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVSI+ I +G+ EVK++AG+
Sbjct: 172 GGTFDVSIIEIFEGVVEVKASAGN 195


>UniRef50_Q00YD5 Cluster: Heat shock protein 91-Arabidopsis
           thaliana; n=1; Ostreococcus tauri|Rep: Heat shock
           protein 91-Arabidopsis thaliana - Ostreococcus tauri
          Length = 779

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 47/182 (25%), Positives = 78/182 (42%), Gaps = 2/182 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-TT 266
           VGID G   + V + +   ++++ ND+  R TPS V F + +R IG AA +++ M P  T
Sbjct: 32  VGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKINMKPRNT 91

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
              +  +         + +                +        K K F+P + V     
Sbjct: 92  VTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQCVASILS 151

Query: 447 XXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                          +C      Y  D+ R+A  DA ++ GLNVLR+++E TA A++YG+
Sbjct: 152 DLKRIAEKDNGTKVTDCVISVPVYATDAHRRAMLDAASMCGLNVLRLLHETTATALSYGI 211

Query: 624 DK 629
            K
Sbjct: 212 FK 213



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           P NT+   KRL+GR F+D  VQ D++   + V     G+   ++ Y G+ K F PE+  +
Sbjct: 88  PRNTVTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQCVA 147

Query: 434 MVLTKMKETAE 466
            +L+ +K  AE
Sbjct: 148 SILSDLKRIAE 158


>UniRef50_Q92598 Cluster: Heat shock protein 105 kDa; n=92;
           Eumetazoa|Rep: Heat shock protein 105 kDa - Homo sapiens
           (Human)
          Length = 858

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKN Q+     T
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
             +         +   + K   +     + +    +  +     +   FS  +       
Sbjct: 64  VSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLT 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L     +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+
Sbjct: 124 KLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 436
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 437 VLTKMKETAEAYLGK 481
           +LTK+KETAE  L K
Sbjct: 121 LLTKLKETAENSLKK 135


>UniRef50_A6VV43 Cluster: 2-alkenal reductase; n=1; Marinomonas sp.
           MWYL1|Rep: 2-alkenal reductase - Marinomonas sp. MWYL1
          Length = 552

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 30/53 (56%), Positives = 43/53 (81%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFN+ QRQAT+ A +++GL+V R++NEPTAAA+AYGLD + + E+  L+ DL
Sbjct: 118 AYFNNKQRQATQQAASLAGLDVERLLNEPTAAALAYGLDNQDS-EQTYLVLDL 169



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 26/58 (44%), Positives = 40/58 (68%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTT+S VGV++ G V++I + +GN   PS V  + D   L+G AA++++A  P
Sbjct: 3   IGIDLGTTHSVVGVWKDGSVQLIPDMEGNILVPSAVGISEDNYILVGQAARDRLATNP 60



 Score = 33.1 bits (72), Expect = 7.4
 Identities = 12/24 (50%), Positives = 20/24 (83%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVS++ + + IFE+ +++GD
Sbjct: 171 GGTFDVSVIEVFNEIFEIHASSGD 194


>UniRef50_Q7QU88 Cluster: GLP_226_13599_12049; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_226_13599_12049 - Giardia lamblia
           ATCC 50803
          Length = 516

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 31/62 (50%), Positives = 44/62 (70%), Gaps = 1/62 (1%)
 Frame = -3

Query: 245 LVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDSYCGCFCH-F 69
           LVLGG++DETL + E ++   G  AL++GDDLH  VL + NA V G+++D+Y  C CH F
Sbjct: 452 LVLGGVADETLCIREGDVGGRGVRALLIGDDLHFFVLINANAGVSGSEVDAYSRCSCHDF 511

Query: 68  VF 63
           +F
Sbjct: 512 IF 513



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 27/70 (38%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = -1

Query: 478 AKISFGSFLHFRKHHGTDFLGEKGFVFTLICYLDL-RFASITDNLERPVLHVGLHSSIFE 302
           A++  G  LH  + HG D LG +    TL+  LDL       D+LER VL V LH  + E
Sbjct: 373 AEVVAGDILHLGEDHGGDLLGSERLRLTLVDNLDLGLLVGAADDLEREVLEVCLHFRVVE 432

Query: 301 LTSDETFGIE 272
             +D+  G+E
Sbjct: 433 PATDQALGVE 442


>UniRef50_A2G5H6 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 707

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 46/165 (27%), Positives = 84/165 (50%), Gaps = 2/165 (1%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 436
           P NT++D+KR+IG+ + +   + D+++WPF+V   GG P I+   K + + + P E+SS 
Sbjct: 63  PQNTVYDSKRMIGKMYSELD-ENDIRNWPFKVNDYGGAPSIQAVLKRQIREYRPYEISSY 121

Query: 437 VLTKMKETAEAYLG-KLCRMQLSRFRVLQ*LSKTSHK-RCRYHLWLERSPNHQ*TDCCCD 610
           +L+ +K+ +E  LG  + +  ++         K   K   ++  + +    ++ T     
Sbjct: 122 ILSYLKKKSEDQLGVPIKKAVITVPAYFDDRQKAETKLAAKFAGFGDFELMNEPTAAALC 181

Query: 611 CLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
            + + QK    +K       GGTFDVS++ I    FEV    GD+
Sbjct: 182 YMHTFQKFSDSSKILVYDFGGGTFDVSLVGINGKNFEVIGYDGDS 226



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEI-IANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           M + P VGIDLGTT+S V V++  +    +    G+   PS +AF D E + G  AK+ +
Sbjct: 1   MNEGPFVGIDLGTTFSTVAVYKPAQKSFDVLKIDGDTQVPSVIAFGD-ELVYGQRAKSLM 59

Query: 249 AMTP-TTQYSMPNVSSDVSSKM 311
           A  P  T Y    +   + S++
Sbjct: 60  ANIPQNTVYDSKRMIGKMYSEL 81



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY-GLDKKGTGERNVLIFD 665
           AYF+D Q+  TK A   +G     ++NEPTAAA+ Y    +K +    +L++D
Sbjct: 147 AYFDDRQKAETKLAAKFAGFGDFELMNEPTAAALCYMHTFQKFSDSSKILVYD 199


>UniRef50_Q220H1 Cluster: Heat shock protein 70; n=3; cellular
           organisms|Rep: Heat shock protein 70 - Rhodoferax
           ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118)
          Length = 633

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/53 (56%), Positives = 42/53 (79%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+D+QR ATKDA  I+GL V+R++NEPTAA++AYGLD+  + E  + + DL
Sbjct: 123 AYFDDNQRSATKDACRIAGLEVIRLVNEPTAASLAYGLDRL-SEELRIAVIDL 174



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 5/62 (8%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQ----GNRTTPSYVAFT-DTERLIGDAAKNQVAM 254
           +GIDLGT+ S   V + G+  II + +    G +  PSYVA T D + L+G+ A+ Q   
Sbjct: 4   IGIDLGTSNSAAAVLRGGRPVIIPSAEGLSIGGKAFPSYVALTADGQMLVGEPARRQATA 63

Query: 255 TP 260
            P
Sbjct: 64  NP 65



 Score = 37.5 bits (83), Expect = 0.34
 Identities = 15/25 (60%), Positives = 20/25 (80%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGT DV+I+    G+FEVK+T+GDT
Sbjct: 176 GGTLDVTIMEFGKGVFEVKATSGDT 200


>UniRef50_A7HCM0 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 509

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 32/53 (60%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF D QRQA K+AG +  L V+RIINEPTAAA+AYG+ K+   E  VL++DL
Sbjct: 150 AYFTDRQRQAVKEAGALVDLEVVRIINEPTAAALAYGIGKR--LEERVLVYDL 200



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGV-FQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 245
           +A  P +GIDLGTT SC  V +  G+V++I    G+ T PS  A  D    LIG  AK Q
Sbjct: 4   LAADPIIGIDLGTTNSCGAVAYGDGQVKLIPYKGGDYTIPSIFAIDDKGNELIGHEAKRQ 63

Query: 246 VAMTP 260
             + P
Sbjct: 64  WQLNP 68



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 17/24 (70%), Positives = 20/24 (83%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVSI+ I D +FEVK+T GD
Sbjct: 202 GGTFDVSIIEIRDRVFEVKATGGD 225



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 21/75 (28%), Positives = 42/75 (56%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT++  KRLIGR   D  V +  +   +++ + G    ++V   G  ++F  +++ S
Sbjct: 67  NPRNTLYATKRLIGRAPRDEVVDSMQRSVQYQLHA-GANHDVEVDCHG--RSFSIQQIGS 123

Query: 434 MVLTKMKETAEAYLG 478
            +L K+++ A  +LG
Sbjct: 124 RILGKIRDVASDHLG 138


>UniRef50_P48723 Cluster: Stress 70 protein chaperone
           microsome-associated 60 kDa protein precursor; n=19;
           Tetrapoda|Rep: Stress 70 protein chaperone
           microsome-associated 60 kDa protein precursor - Homo
           sapiens (Human)
          Length = 471

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 34/80 (42%), Positives = 48/80 (60%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFP 418
           E    +P NTI+DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  P
Sbjct: 86  ELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSP 144

Query: 419 EEVSSMVLTKMKETAEAYLG 478
           E V S +L K+KE AEAYLG
Sbjct: 145 EYVGSRLLLKLKEMAEAYLG 164



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 27/53 (50%), Positives = 37/53 (69%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DL
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDL 226



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>UniRef50_Q06068 Cluster: 97 kDa heat shock protein; n=3;
           Strongylocentrotus|Rep: 97 kDa heat shock protein -
           Strongylocentrotus purpuratus (Purple sea urchin)
          Length = 889

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 48/183 (26%), Positives = 80/183 (43%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ-VAMTPTT 266
           VG D+G   S + V + G +E +AN+  +R TPS V+F +  R  G AA++Q +     T
Sbjct: 4   VGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNYKNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
                   +   S   + K           +   N+  +     +T+ F+P +       
Sbjct: 64  LSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAMILT 123

Query: 447 XXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L     +C      Y+ D +R+    A  I+GLN LR+I++ TA A+AYG+
Sbjct: 124 KLKSTAEINLCRKVVDCVISVPQYYTDLERRGVIHAAEIAGLNCLRVISDTTAVALAYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 33/77 (42%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR I R+F D +VQ D K  P+++     G   ++V Y GE +TF PE++ +M+
Sbjct: 62  NTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAMI 121

Query: 440 LTKMKETAEAYLGKLCR 490
           LTK+K TAE     LCR
Sbjct: 122 LTKLKSTAEI---NLCR 135


>UniRef50_P57660 Cluster: Chaperone protein hscA; n=2; Buchnera
           aphidicola|Rep: Chaperone protein hscA - Buchnera
           aphidicola subsp. Acyrthosiphon pisum (Acyrthosiphon
           pisumsymbiotic bacterium)
          Length = 611

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 30/53 (56%), Positives = 41/53 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFND Q++ TK A  +SG+N++R++NEPTAAA+AYGL K   G   VL++DL
Sbjct: 150 AYFNDFQKKETKKAAVLSGINLIRLLNEPTAAAVAYGLQKLKKG--IVLVYDL 200



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL +  GIFEV +T+GD+
Sbjct: 202 GGTFDVSILNLNKGIFEVLATSGDS 226



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 21/71 (29%), Positives = 31/71 (43%)
 Frame = +3

Query: 63  KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           K K  K   +GIDLGTTYS     +   V ++ + +     PS V +   +  +G  A  
Sbjct: 5   KKKHDKKLLLGIDLGTTYSLAATVREKSVILLLDKKKRYLLPSVVHYKKNKISVGWKALE 64

Query: 243 QVAMTPTTQYS 275
            +   PT   S
Sbjct: 65  NITEDPTNTIS 75


>UniRef50_UPI0000D56BFD Cluster: PREDICTED: similar to CG8937-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8937-PA, isoform A - Tribolium castaneum
          Length = 767

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/58 (50%), Positives = 40/58 (68%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           VGIDLGTT SC+ V ++GK+E+I N +GNRTT SYV + +   L+G  AK   +  P+
Sbjct: 6   VGIDLGTTNSCIAVERNGKIEVIPNREGNRTTLSYVYYGEDSILVGKTAKYMASANPS 63



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/53 (50%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFN++QR AT+DA  I+G  VL+++NEP+AAA+AY  + +    R +LI+DL
Sbjct: 148 AYFNNNQRAATRDAARIAGFEVLKLVNEPSAAALAYVRENRIKNGRVILIYDL 200



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P+N I++ KRLIG   +D  ++++ K   +E+V    G+  I+V    E     PEEV 
Sbjct: 61  NPSNGIYEIKRLIGCLHDDPDIESERKSLNYELVRGTNGEILIQVEQNSEKFHTLPEEVC 120

Query: 431 SMVLTKMKETAEAYLGK 481
           + +L ++K  AE YLG+
Sbjct: 121 ARILHRLKIDAEMYLGQ 137



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSI+  E+G  +V S  GDT
Sbjct: 202 GGTFDVSIVRTENGTIKVLSVDGDT 226


>UniRef50_A6TJZ9 Cluster: 2-alkenal reductase; n=1; Alkaliphilus
           metalliredigens QYMF|Rep: 2-alkenal reductase -
           Alkaliphilus metalliredigens QYMF
          Length = 569

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/53 (56%), Positives = 41/53 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF D QR+AT +AG ++GL V RIINEPTAAA+AYG+D     + ++L++DL
Sbjct: 120 AYFTDEQRRATVEAGGLAGLKVERIINEPTAAALAYGIDHMDENQ-HILVYDL 171



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMTP 260
           +GIDLGT+ S VG+F+ GK  +I N    + TPS V   +  +L IG  AK+Q+   P
Sbjct: 5   IGIDLGTSTSEVGIFETGKPIVIGNHLNEKITPSVVGLGEEGQLIIGRDAKDQMLFKP 62


>UniRef50_Q5C1F3 Cluster: SJCHGC04997 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC04997 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 252

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 48/182 (26%), Positives = 80/182 (43%), Gaps = 2/182 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK-NQVAMTPTT 266
           VG D+GT  S +GV + G +E+I N+   R TP+ VAF+    L+G AAK  QV  T  T
Sbjct: 5   VGFDIGTLTSYIGVARGGGIEVITNEYSERATPTCVAFSGELVLVGTAAKLQQVMNTRNT 64

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVP-WCX 443
                 +     S + +      T        +  +     +  +   F P + +     
Sbjct: 65  FTDFTRLLGKRLSDLTVVDGRKFTTHQVEESSDGRITLSAVLNGEKTSFVPEQILAIQMN 124

Query: 444 XXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    I +   +   +   Y+ D++R+A  DA  ++GLN ++++N+ TA   AYG 
Sbjct: 125 KLKEVAEATIGSKVVDVVVNVPTYYTDTERRAVLDATKVAGLNCVKVVNDITAIGTAYGF 184

Query: 624 DK 629
            K
Sbjct: 185 YK 186



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT  D  RL+G++  D TV    K    +V  S  G+  +     GE  +F PE++ ++ 
Sbjct: 63  NTFTDFTRLLGKRLSDLTVVDGRKFTTHQVEESSDGRITLSAVLNGEKTSFVPEQILAIQ 122

Query: 440 LTKMKETAEAYLG 478
           + K+KE AEA +G
Sbjct: 123 MNKLKEVAEATIG 135


>UniRef50_A6EQS3 Cluster: Heat shock protein Hsp70; n=1;
           unidentified eubacterium SCB49|Rep: Heat shock protein
           Hsp70 - unidentified eubacterium SCB49
          Length = 730

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 54/197 (27%), Positives = 89/197 (45%), Gaps = 4/197 (2%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-T 263
           A+GIDLGT+ S +  F+   V+II N +    T S +     E L+G  A   +   P  
Sbjct: 4   AIGIDLGTSNSVIA-FKDTSVKIIRNKENEELTRSCIGLRKEEILVGRTAYQLLKTDPIN 62

Query: 264 TQYSMPNVSSD-VSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWC 440
           T  S+  +    +  KM+      S     ++ ++        + +  K ++P +     
Sbjct: 63  TILSVKRLMGGAIKDKMVQDMIESSYYKFGIAPLKGGTDDAVAVILGGKQYTPEQLSSEI 122

Query: 441 XXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
                      L +          AYF + Q+ AT+ A  ++GL V +++ EPTAAAIAY
Sbjct: 123 LKKIKKDAEEKLGDEVTHAVITVPAYFTEKQKNATRIAAQLAGLKVQKLLAEPTAAAIAY 182

Query: 618 GLDKKGTGE-RNVLIFD 665
           G+D    G+ + VLI+D
Sbjct: 183 GVDNLKVGDAKTVLIYD 199



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 2/77 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQ--ADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEV 427
           DP NTI   KRL+G   +D  VQ   +  ++ F +    G     VA     K + PE++
Sbjct: 59  DPINTILSVKRLMGGAIKDKMVQDMIESSYYKFGIAPLKGGTDDAVAVILGGKQYTPEQL 118

Query: 428 SSMVLTKMKETAEAYLG 478
           SS +L K+K+ AE  LG
Sbjct: 119 SSEILKKIKKDAEEKLG 135


>UniRef50_UPI00005F8697 Cluster: COG0443: Molecular chaperone; n=1;
           Yersinia mollaretii ATCC 43969|Rep: COG0443: Molecular
           chaperone - Yersinia mollaretii ATCC 43969
          Length = 571

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 31/53 (58%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFN+ QRQA K AG I+GLNV+R++NEPTAA++AYGL      ++  L FDL
Sbjct: 128 AYFNNVQRQAVKTAGRIAGLNVIRLLNEPTAASLAYGL--LNNTQQKYLTFDL 178



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/65 (38%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +3

Query: 72  MAKAPA-VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQ 245
           +A+A A +GIDLGT+ S V ++Q G+  ++ N +G+  TPS V   D  + ++G AAK +
Sbjct: 6   VAQANALIGIDLGTSNSAVSLWQDGQAILLPNAEGDHLTPSVVGVDDHGQFIVGQAAKLR 65

Query: 246 VAMTP 260
           +   P
Sbjct: 66  LQSHP 70



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 12/24 (50%), Positives = 20/24 (83%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVS++ + +G+ EV+++ GD
Sbjct: 180 GGTFDVSVIDMFEGVIEVRASCGD 203


>UniRef50_A2VD43 Cluster: Heat shock protein 14; n=3;
           Clupeocephala|Rep: Heat shock protein 14 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 504

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 25/51 (49%), Positives = 39/51 (76%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+  G T +CV VF+ G+ +++AND G+R TP+ VA+ DTE+++G AAK
Sbjct: 3   AIGVHFGYTCACVAVFKDGRADVVANDAGDRVTPAVVAYRDTEQIVGIAAK 53



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 24/72 (33%), Positives = 42/72 (58%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           NT+   K+++GR+++D   QA  +     VV+  G P+ ++      K   PE+V+ ++ 
Sbjct: 62  NTVVKVKQILGRRYDDPDAQAHKEESKCIVVNKSGLPRYEIDTGATTKYVSPEDVAKLIF 121

Query: 443 TKMKETAEAYLG 478
            KMKETA++ LG
Sbjct: 122 HKMKETAQSALG 133


>UniRef50_Q81NJ0 Cluster: Chaperone protein hscC; n=26;
           Bacteria|Rep: Chaperone protein hscC - Bacillus
           anthracis
          Length = 566

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 32/53 (60%), Positives = 41/53 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFND+QR++TK A  I+GL V R+I+EPTAAAIAYGL ++   E   L+FDL
Sbjct: 119 AYFNDTQRKSTKRAAEIAGLTVERLISEPTAAAIAYGLYQE-ESETKFLVFDL 170



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 40/115 (34%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 407 TFFPEEVSSMVLTKMKETAEAYLGK-LCRMQLSRFRVLQ*LSKTSHKRCRY--HLWLERS 577
           TF  EE+SS V+  +K+ AEAYL + +    +S         + S KR      L +ER 
Sbjct: 84  TFSSEELSSFVIKSLKQDAEAYLNEEVTGAVISVPAYFNDTQRKSTKRAAEIAGLTVERL 143

Query: 578 PNHQ*TDCCCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGD 742
            +          L   +     TK       GGTFDVSIL + +GI +VKS AGD
Sbjct: 144 ISEPTAAAIAYGLYQEES---ETKFLVFDLGGGTFDVSILELFEGIMDVKSIAGD 195



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           +GIDLGTT S V  +      +I N  G   TPS V+  +T E L+G  AK ++   P
Sbjct: 4   IGIDLGTTNSLVATWSEDGATLIPNVLGEFLTPSVVSVDETGEILVGRIAKERLITHP 61


>UniRef50_Q61QF8 Cluster: Putative uncharacterized protein CBG07033;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG07033 - Caenorhabditis
           briggsae
          Length = 547

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 28/68 (41%), Positives = 46/68 (67%), Gaps = 1/68 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPT 263
           ++GIDLGTT+SCV  +Q+G+V ++ N+ G RTTPS +A T D + LIG  AK+ +    +
Sbjct: 2   SIGIDLGTTFSCVAYYQNGQVNVLENENGCRTTPSVLAMTEDGDCLIGQHAKDVITKATS 61

Query: 264 TQYSMPNV 287
           + + +  +
Sbjct: 62  SLFDVKRI 69



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 1/65 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMV 439
           +++FD KR+IGR+F+D  +Q DM  WPF V  D  G P +++    +   F    VSS++
Sbjct: 61  SSLFDVKRIIGRRFDDVLLQRDMPLWPFRVEKDTDGTPYLQIQNDAKKVKFSAVTVSSLI 120

Query: 440 LTKMK 454
           L  +K
Sbjct: 121 LKCLK 125


>UniRef50_A0CCS3 Cluster: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_168,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 636

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 32/63 (50%), Positives = 42/63 (66%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           P +GIDLGTTYS V +F+  KVEII N+ G ++TP+ VAF  T  LIG+ AK Q  + P 
Sbjct: 22  PIIGIDLGTTYSSVCIFRDDKVEIIPNEYGFKSTPTVVAFNGT-FLIGEEAKEQGIINPQ 80

Query: 264 TQY 272
             +
Sbjct: 81  NTF 83



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = +2

Query: 236 QEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY--KGEDKT 409
           +E G  +P NT +D KRL GR + D  V    K  PF ++ +  K  IKV+      +K 
Sbjct: 72  KEQGIINPQNTFYDIKRLTGRTYLDPNVNRVKKGLPFTIMQENDKICIKVSQPRNKSNKI 131

Query: 410 FFPEEVSSMVLTKMKETAEAYLG 478
           F  + + + VLTK+K  A +YLG
Sbjct: 132 FNIDYIQAKVLTKLKNIASSYLG 154



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/50 (54%), Positives = 35/50 (70%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           FND Q+QAT D   I+GL V+R+I+EP AA IAYG D   T + N+ +FD
Sbjct: 168 FNDIQKQATIDIAEIAGLKVVRLISEPNAAVIAYGRDYV-TEKTNIFVFD 216


>UniRef50_UPI0000510557 Cluster: COG0443: Molecular chaperone; n=1;
           Brevibacterium linens BL2|Rep: COG0443: Molecular
           chaperone - Brevibacterium linens BL2
          Length = 340

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 31/53 (58%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF + +R AT+DA  ++GL +LRIINEPTAAAIA+G    G+   NVL+FDL
Sbjct: 126 AYFGELERSATRDAAEMAGLPLLRIINEPTAAAIAHGFG-GGSRSENVLVFDL 177



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 25/59 (42%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQ-HGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMTP 260
           +GIDLGTT S V      G    IA   G+RT PS V F  ++ + IG  AK+   M P
Sbjct: 4   IGIDLGTTNSAVAATDAMGITTTIAARDGSRTLPSAVYFEPSDEVSIGARAKSMAVMEP 62


>UniRef50_Q9SAB1 Cluster: F25C20.19 protein; n=3; core
           eudicotyledons|Rep: F25C20.19 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 763

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 51/187 (27%), Positives = 86/187 (45%), Gaps = 7/187 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D+G     + V +   ++++ ND+ NR  P+ V+F + +R +G AA     M P + 
Sbjct: 4   VGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHPKST 63

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTK------PFSPRKSV 431
            S   +   +  K    +P     L RL   E +  S   I+++ +       FSP + +
Sbjct: 64  IS--QLKRLIGRKFR--EPDVQNDL-RLFPFETSEDSDGGIQIRLRYMGEIQSFSPVQIL 118

Query: 432 PWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         L    ++C     +YF +SQR A  DA  I+GL  LR++++ TA A
Sbjct: 119 GMLLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATA 178

Query: 609 IAYGLDK 629
           + YG+ K
Sbjct: 179 LGYGIYK 185



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/74 (41%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSS 433
           P +TI   KRLIGRKF +  VQ D++ +PFE   D  G  +I++ Y GE ++F P ++  
Sbjct: 60  PKSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEIQSFSPVQILG 119

Query: 434 MVLTKMKETAEAYL 475
           M+L+ +K+ AE  L
Sbjct: 120 MLLSHLKQIAEKSL 133


>UniRef50_Q4XZF4 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 128

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
 Frame = +3

Query: 66  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKN 242
           +  A    +GIDLGTT SCV + +  + ++I N +G RTTPS VAFT D +RL+G  AK 
Sbjct: 36  HNRASGDIIGIDLGTTNSCVAIMEGKQGKVIENAEGFRTTPSVVAFTNDNQRLVGIVAKR 95

Query: 243 QVAMTP 260
           Q    P
Sbjct: 96  QAITNP 101


>UniRef50_Q7UVU8 Cluster: Chaperone protein HscC; n=4;
           Planctomycetaceae|Rep: Chaperone protein HscC -
           Rhodopirellula baltica
          Length = 587

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 30/53 (56%), Positives = 39/53 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFND QR AT+ AG ++GLNV R+INEPTAAA+ YG   +   E+N+ + DL
Sbjct: 133 AYFNDHQRTATRLAGEMAGLNVRRMINEPTAAALVYGFHAR-EDEKNLCVIDL 184



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +3

Query: 54  TD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV-AFTDTERLIGD 230
           +D  +   +   +GIDLGTT+S V VF+ GK E+I+N  G + TPS V    D + ++G 
Sbjct: 6   SDSSFPTEEPVCIGIDLGTTHSLVSVFRDGKPELISNAHGEKLTPSIVGVLQDGQIVVGS 65

Query: 231 AAKNQVAMTP 260
           AA+      P
Sbjct: 66  AARELRVTAP 75



 Score = 33.9 bits (74), Expect = 4.2
 Identities = 11/25 (44%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDV+++ + +G  E+++TAG++
Sbjct: 186 GGTFDVTVMEVFEGTLEIRATAGES 210


>UniRef50_Q64YI6 Cluster: Chaperone protein DnaK; n=2; Bacteroides
           fragilis|Rep: Chaperone protein DnaK - Bacteroides
           fragilis
          Length = 529

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 31/53 (58%), Positives = 39/53 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF   +R  TK AG I+GLNVL IINEPTAAAI+YG+  K   ++ VL++DL
Sbjct: 130 AYFGTKERMQTKQAGEIAGLNVLSIINEPTAAAISYGV--KTDQKKTVLVYDL 180



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 2/59 (3%)
 Frame = +3

Query: 93  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMTPT 263
           GIDLGTTYSC+  V +  +  ++ N +G+ TTPS V F D +  ++G  AK  +A  PT
Sbjct: 9   GIDLGTTYSCIAQVDKFDQAIVLRNFEGDATTPSAVYFEDMDHVVVGKEAKGMLATEPT 67


>UniRef50_Q2GEA8 Cluster: Putative chaperone protein HscA; n=1;
           Neorickettsia sennetsu str. Miyayama|Rep: Putative
           chaperone protein HscA - Neorickettsia sennetsu (strain
           Miyayama)
          Length = 593

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 28/53 (52%), Positives = 42/53 (79%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+++ R A KDA TI+GLNV+R+++EPTAAA+ YG+D+K   E   +++DL
Sbjct: 134 AYFDNASRTAIKDAATIAGLNVVRLLSEPTAAALFYGIDEK-KEEGRYIVYDL 185



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = +3

Query: 63  KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           + K+ +   +GID GTT S V +F   K  +I  + G+   PS +   D + +IG  AK
Sbjct: 10  RQKLDREVIIGIDFGTTNSLVCIFDGSKCVVIPQEGGDVLLPSVIGVKDKDIIIGKEAK 68



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 16/24 (66%), Positives = 17/24 (70%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVSIL    GIF+V  T GD
Sbjct: 187 GGTFDVSILEFHKGIFKVSCTDGD 210


>UniRef50_A4J964 Cluster: Heat shock protein 70; n=2;
           Clostridiales|Rep: Heat shock protein 70 -
           Desulfotomaculum reducens MI-1
          Length = 619

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 31/53 (58%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF D QR+ATK AG ++G  V RIINEPTAAA+A+GL      +R++LI+DL
Sbjct: 132 AYFTDEQRRATKQAGELAGFVVERIINEPTAAALAFGLAHM-EEDRHILIYDL 183



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 1/74 (1%)
 Frame = +3

Query: 42  TSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTER 218
           T+ K D   + +  P VGIDLGTT S V    + K EII + Q     PS V    + + 
Sbjct: 2   TNRKND-ATRQSFRPIVGIDLGTTNSAVAYIHNSKPEIIPSPQSKHIIPSVVLLDPEGKV 60

Query: 219 LIGDAAKNQVAMTP 260
           ++G+ A+  +   P
Sbjct: 61  VVGEDARAALIAMP 74



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 12/25 (48%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS++ +  G+ EVK+++G++
Sbjct: 185 GGTFDVSVVEMMSGVLEVKASSGNS 209


>UniRef50_Q05036 Cluster: Uncharacterized protein C30C11.4; n=2;
           Caenorhabditis|Rep: Uncharacterized protein C30C11.4 -
           Caenorhabditis elegans
          Length = 776

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 56/206 (27%), Positives = 93/206 (45%), Gaps = 13/206 (6%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +G D+G     +GV + G +E+I ND     TP+ V+F   +R +G AA+   A+T   +
Sbjct: 4   LGFDIGNLNCYIGVARQGGIEVITNDYSLHATPACVSFGPKDRSMGVAARQ--AVTTNIK 61

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*---HIRVKTKP--FSPRKSVP 434
            ++ N    +  K     P     +  +      L +      +    +P  F+P + + 
Sbjct: 62  NTVINFKHLIGRKF--SDPVAQRFIPFIPCKVVKLPNDDIGVQVSYLGEPHTFTPEQVLA 119

Query: 435 WCXXXXXXXXXXILANC---AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                        L++    ++C     +YF D QR+A   A   +GLN LRI+NE TA 
Sbjct: 120 ALLTKLRTIVESQLSDVKKVSDCVLAVPSYFTDVQRRAVLSAIQYAGLNSLRIVNETTAI 179

Query: 606 AIAYGLDKKGTGE-----RNVLIFDL 668
           A+AYG+ K+   E     RNV+  D+
Sbjct: 180 ALAYGIYKQDLPEEDAKSRNVVFLDI 205



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+ + K LIGRKF D   Q  +   P +VV        ++V+Y GE  TF PE+V + +
Sbjct: 62  NTVINFKHLIGRKFSDPVAQRFIPFIPCKVVKLPNDDIGVQVSYLGEPHTFTPEQVLAAL 121

Query: 440 LTKMKETAEAYL 475
           LTK++   E+ L
Sbjct: 122 LTKLRTIVESQL 133


>UniRef50_Q97LT1 Cluster: DnaK protein (Heat shock protein),
           C-terminal region has VWA type A domain; n=1;
           Clostridium acetobutylicum|Rep: DnaK protein (Heat shock
           protein), C-terminal region has VWA type A domain -
           Clostridium acetobutylicum
          Length = 698

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/54 (57%), Positives = 43/54 (79%), Gaps = 1/54 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDL 668
           AYFN+ QRQ+T +AG  +  NVL I+NEPTAAA+AYG+  K +GE +N+L++DL
Sbjct: 121 AYFNNIQRQSTINAGKRAEFNVLSILNEPTAAAMAYGM--KASGENKNILVYDL 172



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVF-QHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           ++GIDLGTT+S V +  ++G  +++ N +GN  TPS + F+  E ++GD AK   AM
Sbjct: 4   SLGIDLGTTFSVVSIIDENGAPKVLKNKEGNTLTPSVIYFSGEEIIVGDDAKEMQAM 60


>UniRef50_Q8XNT4 Cluster: DnaK protein; n=4; Clostridium|Rep: DnaK
           protein - Clostridium perfringens
          Length = 575

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 30/52 (57%), Positives = 39/52 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           A FND QR+ATK+AG I+G  V RIINEPTAAA+AYG+D       N++++D
Sbjct: 121 ANFNDIQRKATKNAGEIAGFKVERIINEPTAAAMAYGVDNLDK-NGNIIVYD 171



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIAN-DQGN-RTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTT S +   + GK  II N ++G+    PS V+    E  +G  AKNQ+ + P
Sbjct: 5   IGIDLGTTTSEIAYVKDGKPCIIRNIEEGDEHAIPSVVSIEGDEIKVGKKAKNQILLKP 63



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +2

Query: 398 EDKTFFPEEVSSMVLTKMKETAEAYLGK 481
           + K + PEE+S+++L K+KE AE +LG+
Sbjct: 83  QGKEYRPEEISALILKKLKEVAEYFLGE 110


>UniRef50_Q1Q021 Cluster: Strongly similar to molecular chaperone
           DnaK; n=1; Candidatus Kuenenia stuttgartiensis|Rep:
           Strongly similar to molecular chaperone DnaK -
           Candidatus Kuenenia stuttgartiensis
          Length = 586

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 30/53 (56%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+D QR AT+DAG ++GL+V+RIINEPT+AAIAY  D        +L++DL
Sbjct: 119 AYFDDRQRNATRDAGLLAGLDVVRIINEPTSAAIAY--DAGHPENHKLLVYDL 169



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI-GDAAKNQVAMTP-T 263
           VGIDLGTT S + + ++GK ++I  D  +   PS V    T +LI G  AKNQ   +P +
Sbjct: 5   VGIDLGTTNSEISILENGKPKVIPVDD-DLIMPSCVGIDITGKLIVGKTAKNQAVSSPES 63

Query: 264 TQYSMP-NVSSDVSSKM 311
           T +S+   +  DV  ++
Sbjct: 64  TIFSIKRKMGEDVKVRL 80



 Score = 36.7 bits (81), Expect = 0.60
 Identities = 14/25 (56%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS++ +E+G+ EV ++ GDT
Sbjct: 171 GGTFDVSLVVVENGVVEVLASHGDT 195



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 14/26 (53%), Positives = 19/26 (73%)
 Frame = +2

Query: 401 DKTFFPEEVSSMVLTKMKETAEAYLG 478
           +K F PEE+SS +L  +K+ AE YLG
Sbjct: 82  EKEFRPEEISSFILLTLKKHAEKYLG 107


>UniRef50_Q01SX4 Cluster: Heat shock protein 70; n=1; Solibacter
           usitatus Ellin6076|Rep: Heat shock protein 70 -
           Solibacter usitatus (strain Ellin6076)
          Length = 619

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/54 (53%), Positives = 43/54 (79%), Gaps = 1/54 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERN-VLIFDL 668
           AYF+D+QR AT++AG ++GL V+RI+NEPTAA++AYG      G R+ V+++DL
Sbjct: 120 AYFSDAQRNATREAGMLAGLEVVRILNEPTAASLAYGF---ADGSRHTVMVYDL 170



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           VGIDLGTT S V  F +G+V ++     ++  PS V  + + E ++G+AA NQ  + P
Sbjct: 6   VGIDLGTTNSEVAAFLNGRVRVL-GPNASKMLPSCVGISPSGELMVGEAALNQQRIYP 62



 Score = 32.7 bits (71), Expect = 9.8
 Identities = 15/24 (62%), Positives = 19/24 (79%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVSI+TIE  + EV S+ G+
Sbjct: 172 GGTFDVSIVTIEGEVTEVLSSHGN 195


>UniRef50_Q2FPF2 Cluster: Heat shock protein 70; n=1;
           Methanospirillum hungatei JF-1|Rep: Heat shock protein
           70 - Methanospirillum hungatei (strain JF-1 / DSM 864)
          Length = 571

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/52 (55%), Positives = 41/52 (78%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           A ++DSQRQA  DA  I+G+NV+R+INEPTAAA+AYG+  +   +R VL++D
Sbjct: 121 ANYSDSQRQAIMDAAEIAGINVVRLINEPTAAALAYGI--REDRDRKVLVYD 170



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTP 260
           +GID GTT S +      +  +I NDQG++ TPS V F  + E  IG+ AK+   + P
Sbjct: 6   IGIDFGTTNSKMAYMLLDEPVVIENDQGSKITPSVVYFKNEKEFSIGEQAKHNQIIHP 63



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVSIL++  G F+V ++ G+
Sbjct: 173 GGTFDVSILSVSSGFFDVDASTGE 196


>UniRef50_Q6F9S6 Cluster: Chaperone protein; n=2; Acinetobacter|Rep:
           Chaperone protein - Acinetobacter sp. (strain ADP1)
          Length = 566

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 32/53 (60%), Positives = 39/53 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFND QRQAT  A  ++GL V R+INEPTAAA+AYGL +  + +   LIFDL
Sbjct: 122 AYFNDIQRQATISAAELAGLKVSRLINEPTAAALAYGLGQ--SDDSCFLIFDL 172



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 27/52 (51%), Positives = 37/52 (71%), Gaps = 1/52 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAA 236
           P +GIDLGT+ S VGVF++G+  +I N  GN+ TPS +A  + E+ LIG AA
Sbjct: 6   PLIGIDLGTSNSLVGVFENGQPRLIENAYGNKLTPSAIAMDEDEQILIGQAA 57



 Score = 37.9 bits (84), Expect = 0.26
 Identities = 15/24 (62%), Positives = 21/24 (87%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVSI+ + DG+ EV+++AGD
Sbjct: 174 GGTFDVSIVELFDGVIEVRASAGD 197


>UniRef50_Q5PAP4 Cluster: Heat shock protein; n=1; Anaplasma
           marginale str. St. Maries|Rep: Heat shock protein -
           Anaplasma marginale (strain St. Maries)
          Length = 602

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 54/189 (28%), Positives = 90/189 (47%), Gaps = 3/189 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           A GIDLGTT S + V  H G V++  +  G    PS V +T D    +G  A N +    
Sbjct: 17  AFGIDLGTTNSLIAVVGHDGGVKVFEDPAGRSLIPSIVEYTRDGVVKVGHDA-NPLRALR 75

Query: 261 TTQYSMPNVSSDVS-SKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPW 437
           +T+  M  ++ DV  S+      T   G + LS+ +  + +   +  +       + V  
Sbjct: 76  STKRLMGKLAKDVHHSQFCGATVTDKNGSAALSIDQNKVVTPVEVAAEVLKRLV-ELVKS 134

Query: 438 CXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
           C           +           AYF++  R+AT+DA  ++G+ VLR++NEPTA+A++Y
Sbjct: 135 CTGQDVTHAVITVP----------AYFDEIARKATRDAARMAGIEVLRLLNEPTASALSY 184

Query: 618 GLDKKGTGE 644
            +++ G  E
Sbjct: 185 KVEQAGDAE 193



 Score = 39.5 bits (88), Expect = 0.085
 Identities = 15/25 (60%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L + +G+F+V +T GDT
Sbjct: 202 GGTFDVSVLRLHNGVFQVLATGGDT 226


>UniRef50_A6C0T7 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 527

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 32/60 (53%), Positives = 43/60 (71%), Gaps = 8/60 (13%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG--LDKKGT------GERNVLIFDL 668
           YFND +R+AT+DAG I+GLNV+ IINEPTAA +AY    D+ G       G+R +L++DL
Sbjct: 127 YFNDVRRKATQDAGRIAGLNVIDIINEPTAATLAYAWKRDELGNPDAMPDGDRTILVYDL 186


>UniRef50_UPI00006CA81B Cluster: dnaK protein; n=1; Tetrahymena
           thermophila SB210|Rep: dnaK protein - Tetrahymena
           thermophila SB210
          Length = 811

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 53/200 (26%), Positives = 85/200 (42%), Gaps = 6/200 (3%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           A+GID G++ S + V + G V++IAN+   R T + V +   +R  G+AA  Q       
Sbjct: 11  AIGIDFGSSRSVIAVAKRGGVDVIANEASLRETRNIVGYGPAQRFTGEAANAQAKSNFKN 70

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
             S  N    + +     K       S++S  E        ++ K +             
Sbjct: 71  TVSFFNRLLGIPANYPNLKNETKWISSKVSTNEEGKLVH-DVQYKGQNVKLLPEQVTAAM 129

Query: 447 XXXXXXXXILANCA--ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 620
                    L N    E      +Y+ + +R+A +DA  I+GLN LR+ NE +A  ++YG
Sbjct: 130 LGDIRKIITLNNLPNHEAVISVPSYYTEQERKALRDACRIAGLNPLRLFNESSAICLSYG 189

Query: 621 LDKK----GTGERNVLIFDL 668
           L +K     T  R+V   DL
Sbjct: 190 LFRKAELDATTPRHVAFVDL 209


>UniRef50_Q4RM18 Cluster: Chromosome 10 SCAF15019, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10
           SCAF15019, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 892

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 47/182 (25%), Positives = 80/182 (43%), Gaps = 4/182 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT-PTT 266
           VGID+G     + V + G +E IAN+  +R TP+ V+     R+IG+AAK+Q+      T
Sbjct: 4   VGIDVGFQSCYIAVARSGGIETIANEYSDRCTPACVSLATKNRIIGNAAKSQIITNFKNT 63

Query: 267 QYSMPNVSSDVSSKMLLC--KPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWC 440
            +              +   KP     L +++     ++ R       K F+  +     
Sbjct: 64  VHGFKKFHGRTFDDPFVQAEKPKLPYSLHKMANGSTGIKVR--YLDDNKMFTVEQITGML 121

Query: 441 XXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
                      L     +C     ++F D++R++  DA  I+GLN LR+IN+ TA    +
Sbjct: 122 LSKLKETSEAALKKPVVDCVISVPSFFTDAERRSVFDATQIAGLNCLRLINDTTAGECLF 181

Query: 618 GL 623
           G+
Sbjct: 182 GV 183



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   K+  GR F+D  VQA+    P+ +     G   IKV Y  ++K F  E+++ M+
Sbjct: 62  NTVHGFKKFHGRTFDDPFVQAEKPKLPYSLHKMANGSTGIKVRYLDDNKMFTVEQITGML 121

Query: 440 LTKMKETAEAYLGK 481
           L+K+KET+EA L K
Sbjct: 122 LSKLKETSEAALKK 135


>UniRef50_Q97LT2 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=2; Bacteria|Rep: DnaK protein (Heat
           shock protein), HSP70/DnaK family - Clostridium
           acetobutylicum
          Length = 551

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 31/53 (58%), Positives = 41/53 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF  ++R+ATK AG I+GLNV  IINEPTAAA+AYG+D     ++ VL++DL
Sbjct: 121 AYFGINEREATKLAGEIAGLNVKAIINEPTAAAVAYGVDY--DKDKVVLVYDL 171



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +3

Query: 93  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           GIDLGTTYSC+  V ++G+  ++ N +  R TPS V F     ++GD AK    M P
Sbjct: 6   GIDLGTTYSCISYVDEYGRPVVVPNAENERITPSVVFFDGDNVIVGDVAKENSKMYP 62


>UniRef50_Q3YS56 Cluster: Heat shock protein Hsp70; n=13;
           Rickettsiales|Rep: Heat shock protein Hsp70 - Ehrlichia
           canis (strain Jake)
          Length = 618

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 26/53 (49%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+++ R+ATKDA  ++ L VLR++NEPTAAA+AYG++K        +++DL
Sbjct: 150 AYFDEAARKATKDAAHLANLEVLRLLNEPTAAALAYGIEKPEYENNIYMVYDL 202



 Score = 39.5 bits (88), Expect = 0.085
 Identities = 16/25 (64%), Positives = 20/25 (80%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL +  G+F+V +T GDT
Sbjct: 204 GGTFDVSILKLHQGVFQVLATGGDT 228



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 3/79 (3%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           A GIDLGTT S + +  + GK  I +++ G    PS V++ + +  +G    N   ++  
Sbjct: 17  AFGIDLGTTNSLISMIDNEGKTIIFSDENGRFLIPSTVSYINNQVEVGKNYSNDNTISSI 76

Query: 264 TQYSMPNVS--SDVSSKML 314
            +    ++   +++SS++L
Sbjct: 77  KRLMGKSIKDINELSSELL 95


>UniRef50_Q86JV8 Cluster: Similar to heat shock protein; n=2;
           Dictyostelium discoideum|Rep: Similar to heat shock
           protein - Dictyostelium discoideum (Slime mold)
          Length = 926

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 52/204 (25%), Positives = 88/204 (43%), Gaps = 4/204 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A +  +GIDLG+    V + + G  E + N+Q  R T S V +   ERL    + +  A 
Sbjct: 24  ANSMVIGIDLGSQTFKVSLIKPGAFETVLNEQSGRKTISSVGWFKDERLFSSDSFSVWAR 83

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSR-LSVMEANLRSR*HIRVKTKPFSPRKSV 431
            P   Y++      +  K  L +   S GL     V    +R+   I          + +
Sbjct: 84  NPKQNYNLIQAFLGIKYKEGLVEEI-SNGLPLGFKVKNDTVRNTVSIVYDDDTNYSAEEL 142

Query: 432 PWCXXXXXXXXXXILANCA--ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          A  +  +C+     YF   QRQA  DA  ++GLNVL +I++  AA
Sbjct: 143 TGMLLRRVKDMASSYAGSSIKDCAITIPPYFTQQQRQALLDAAQLAGLNVLSLIHDVNAA 202

Query: 606 AIAYGLDKKGTGE-RNVLIFDLAA 674
           A+++ +D+    +  +V+ +D+ A
Sbjct: 203 ALSFAMDRTFLEKNESVIFYDMGA 226


>UniRef50_Q9Y4L1 Cluster: Hypoxia up-regulated protein 1 precursor;
           n=39; Deuterostomia|Rep: Hypoxia up-regulated protein 1
           precursor - Homo sapiens (Human)
          Length = 999

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 11/222 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-- 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P  
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKA 95

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANL---RSR*HIRVKTK-PFSPRKS 428
           T +Y    +     +      P  +   +R    E      R   H ++ ++  FSP + 
Sbjct: 96  TLRYFQHLLGKQADN------PHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEV 149

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
           +                    +       +FN ++R+A   A  ++GL VL++IN+ TA 
Sbjct: 150 LGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTAT 209

Query: 606 AIAYGLDKK---GTGERNVLIFDLAAVPSTCPSLPSRMVSSR 722
           A++YG+ ++    T  +N++ +D+ +  + C  +  +MV ++
Sbjct: 210 ALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTK 251


>UniRef50_A7HBX9 Cluster: 2-alkenal reductase precursor; n=7;
           Cystobacterineae|Rep: 2-alkenal reductase precursor -
           Anaeromyxobacter sp. Fw109-5
          Length = 542

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 26/53 (49%), Positives = 41/53 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AY++D+QRQA ++AG ++G  V RI+NEPTAAA+AYG  +    ++ +L++DL
Sbjct: 149 AYYSDAQRQAVREAGKLAGFEVRRIVNEPTAAALAYGFGR--ALDQKILVYDL 199



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           P +GIDLGTT +CV   +    +++  D+GN   P+ VA +D  + L+G+ AK+Q+   P
Sbjct: 8   PVLGIDLGTTNACVAHVRSRIPKVVPTDRGNLILPTVVALSDRGDLLVGNVAKDQLVTNP 67



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 28/76 (36%), Positives = 44/76 (57%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTI+ AKRLIGRK+    VQ    ++ +++V +G      V   GE +T    E+S+
Sbjct: 66  NPKNTIYGAKRLIGRKWSSRVVQELRNYYSYDIV-EGPNGDAAVMLGGEVRTL--PEISA 122

Query: 434 MVLTKMKETAEAYLGK 481
           MVL  +++ A  +L K
Sbjct: 123 MVLAHVRKIAGQFLQK 138



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 15/25 (60%), Positives = 20/25 (80%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L ++  +FEV +T GDT
Sbjct: 201 GGTFDVSVLQLQGNVFEVLATGGDT 225


>UniRef50_Q89A16 Cluster: Chaperone protein hscA; n=1; Buchnera
           aphidicola (Baizongia pistaciae)|Rep: Chaperone protein
           hscA - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 511

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 64/202 (31%), Positives = 95/202 (47%), Gaps = 8/202 (3%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTT-PSYVAFTDTERLIG-DAAKNQVAMTP 260
           ++GID GTTYS V       + II  DQ NR   PS + +T  + ++G +A K  +    
Sbjct: 21  SIGIDFGTTYSLVASALEDNIYIIL-DQNNRALLPSIINYTSKKPIVGWEAQKQAINDPK 79

Query: 261 TTQYSMPNV---SSDVSSKMLLCKPT*STGLSR--LS-VMEANLRSR*HIRVKTKPFSPR 422
            T  S+  +   S D  +K+    P   T      LS +++ NL +   I V ++ F   
Sbjct: 80  NTIISIKRLIGHSYDEINKLYPNLPYHLTYDKNGILSFIVQDNLINT--INVSSEIFKTL 137

Query: 423 KSVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
           K+              IL        H    FND QRQ  K +  ++ LN++R++NEPT+
Sbjct: 138 KN-----RVNTIFNQKILGAVITVPAH----FNDLQRQEIKKSAELANLNIIRLLNEPTS 188

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGL       + V I+DL
Sbjct: 189 AAIAYGLHL--NKNKIVAIYDL 208



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 16/25 (64%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL +  GIFEV +T+G+T
Sbjct: 210 GGTFDISILKLNQGIFEVLATSGNT 234


>UniRef50_A0AFF5 Cluster: Complete genome; n=1; Listeria welshimeri
           serovar 6b str. SLCC5334|Rep: Complete genome - Listeria
           welshimeri serovar 6b (strain ATCC 35897 / DSM 20650
           /SLCC5334)
          Length = 561

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 29/62 (46%), Positives = 43/62 (69%)
 Frame = +3

Query: 483 CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIF 662
           C E      AYFN+SQR+AT DA  ++GL V R+I+EPTAAAIAYG+ ++   +  +++ 
Sbjct: 110 CTEAVISVPAYFNNSQRKATIDAAFLAGLKVERLISEPTAAAIAYGIHQQ--NDTTLMVI 167

Query: 663 DL 668
           D+
Sbjct: 168 DI 169



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           +GIDLGT+ S V  ++  K  +I N  G+  TPS V   +  E LIG  A+ ++   P
Sbjct: 4   LGIDLGTSNSLVAYWKEDKAVLIPNVFGDVLTPSVVGIDENDELLIGKIARERLTSHP 61


>UniRef50_A7QL81 Cluster: Chromosome chr3 scaffold_117, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr3 scaffold_117, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 103

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 27/34 (79%), Positives = 30/34 (88%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
           AYFNDSQRQATKDAG I+GLN++ IINEPT A I
Sbjct: 21  AYFNDSQRQATKDAGVITGLNLMHIINEPTTAEI 54


>UniRef50_Q4UKL3 Cluster: Chaperone protein hscA homolog; n=14;
           Rickettsia|Rep: Chaperone protein hscA homolog -
           Rickettsia felis (Rickettsia azadi)
          Length = 637

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 56/201 (27%), Positives = 90/201 (44%)
 Frame = +3

Query: 66  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           +K  +  AVGID GTT S + +  + KV++I +       P+ + FT+   +IG+  K  
Sbjct: 14  FKQERQIAVGIDFGTTNSLIAIATNRKVKVIKSRDDKELIPTTIDFTNENFIIGNN-KGL 72

Query: 246 VAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK 425
            ++      ++  + +   +   L K       S L +  AN + R    +  + F   K
Sbjct: 73  RSIKRLFGKTLKEILN-TPALFSLIKDYLEANSSELKLNFANKQLRIS-EIAAEVFIYLK 130

Query: 426 SVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
           +              +  N  +      A+FND+ R     A  I+G  VLR+I EPTAA
Sbjct: 131 N---------QAEEQLKTNITKAVITVPAHFNDAARGEVMLAAKIAGFEVLRLIAEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           A AYGL+K   G    L++DL
Sbjct: 182 AYAYGLNKNQKG--CYLVYDL 200



 Score = 39.5 bits (88), Expect = 0.085
 Identities = 17/24 (70%), Positives = 21/24 (87%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVSIL I++GIF+V +T GD
Sbjct: 202 GGTFDVSILNIQEGIFQVIATNGD 225


>UniRef50_A6NJU0 Cluster: Uncharacterized protein HSPA14; n=2;
           Eutheria|Rep: Uncharacterized protein HSPA14 - Homo
           sapiens (Human)
          Length = 143

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53


>UniRef50_Q0AWZ5 Cluster: Molecular chaperone DnaK; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           Molecular chaperone DnaK - Syntrophomonas wolfei subsp.
           wolfei (strain Goettingen)
          Length = 498

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 26/53 (49%), Positives = 41/53 (77%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFND+QRQAT  AG ++GL +L+++NEPTAAA+AY  ++    + ++L+ D+
Sbjct: 119 AYFNDNQRQATYMAGELAGLKILQLLNEPTAAALAYASEQ--AEKEHILVLDI 169



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 28/57 (49%), Positives = 38/57 (66%), Gaps = 2/57 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAM 254
           VGIDLGTT S V  + + GK EII N++G R TPS + F  + E L+G+ A+NQ  +
Sbjct: 3   VGIDLGTTNSLVAFINREGKAEIIINERGGRLTPSVIYFKNEQEVLVGEVARNQALL 59


>UniRef50_A5B0E9 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 318

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 1/39 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEP-TAAAIAYGL 623
           AYFND+QRQATKD G ISGL+V RIINEP TAAA  +GL
Sbjct: 97  AYFNDAQRQATKDVGRISGLDVQRIINEPTTAAARGHGL 135


>UniRef50_A2ECV1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 650

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 53/196 (27%), Positives = 86/196 (43%), Gaps = 4/196 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEI-IANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT- 263
           VGIDLGTT+  V V++    E  +   +G++T PS V +  T    G  AK+Q+ +TPT 
Sbjct: 7   VGIDLGTTFCSVAVYRPSTQETEVLEIEGSKTIPSQV-YYGTPTYFGQKAKDQLQITPTL 65

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCX 443
             Y    +      ++     T    +   S  E ++      + KT+  SP +      
Sbjct: 66  VAYDSKRMIGRTYDEVKAQNMTWPFRIEGTSDNEVDIIL--ENKGKTQVVSPVQVSAEIL 123

Query: 444 XXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGL--NVLRIINEPTAAAIAY 617
                    I+             F+D+QR+ATK+A  I+G   N +  + EPT+AAI +
Sbjct: 124 KYLKTHAEKIIGKFDGAVITIPQAFSDAQRKATKNAAIIAGFDPNKIHFLPEPTSAAIKF 183

Query: 618 GLDKKGTGERNVLIFD 665
                     ++LI+D
Sbjct: 184 AHKASADHRHHILIYD 199



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 40/166 (24%), Positives = 73/166 (43%), Gaps = 3/166 (1%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSS 433
           P    +D+KR+IGR +++  V+A    WPF +  +   +  I +  KG+ +   P +VS+
Sbjct: 63  PTLVAYDSKRMIGRTYDE--VKAQNMTWPFRIEGTSDNEVDIILENKGKTQVVSPVQVSA 120

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TDCCCDC 613
            +L  +K  AE  +GK     ++  +      + + K        + +  H   +     
Sbjct: 121 EILKYLKTHAEKIIGKFDGAVITIPQAFSDAQRKATKNAAIIAGFDPNKIHFLPEPTSAA 180

Query: 614 LRS*QKGY--WRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
           ++   K     R         GGTFD+S  TI +   ++ ST GD+
Sbjct: 181 IKFAHKASADHRHHILIYDFGGGTFDISRATINNRKIKINSTGGDS 226


>UniRef50_A0ZJB1 Cluster: DnaK protein; n=1; Nodularia spumigena CCY
           9414|Rep: DnaK protein - Nodularia spumigena CCY 9414
          Length = 578

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/52 (53%), Positives = 40/52 (76%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           A F D+ R+AT +AG I+GLNVLR++NEPTAAA+A+G+ K    E  +++FD
Sbjct: 122 ANFPDAARKATFNAGEIAGLNVLRLLNEPTAAALAFGI-KNIASEEQLVVFD 172



 Score = 32.7 bits (71), Expect = 9.8
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGT D+S+L + +G+ +VKS+ GD
Sbjct: 175 GGTLDISVLEMFEGVLDVKSSFGD 198


>UniRef50_A2EPF1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 657

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 34/75 (45%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGK-PKIKVAYKGEDKTFFPEEVS 430
           +PN  I+D+KRLIG K++D  VQ   K  PFE+  +    P+I V YKG  K   P EVS
Sbjct: 65  EPNLVIYDSKRLIGCKYQD--VQEICKTMPFEIQPNADDDPEIIVNYKGNQKVLKPVEVS 122

Query: 431 SMVLTKMKETAEAYL 475
           S +L  +K  AE  L
Sbjct: 123 SQILAYLKSQAERRL 137



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTT+S +  +   +  V +I  D GN++ PS V + D  +L+G+ A  +  + P
Sbjct: 10  LGIDLGTTFSSIAYYDKNRQMVHLIEID-GNKSIPSVVYYGD-PKLVGNQAYERAKIEP 66


>UniRef50_O51279 Cluster: Heat shock protein 70; n=3; Borrelia
           burgdorferi group|Rep: Heat shock protein 70 - Borrelia
           burgdorferi (Lyme disease spirochete)
          Length = 491

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GIDLGTT +    F     +II N++G R TPS V+F+D + L+G AAKNQ+ + P  Q
Sbjct: 7   IGIDLGTTNTVASYFDVSS-KIILNERGERITPSIVSFSDKDVLVGSAAKNQILVNP--Q 63

Query: 270 YSMPNVSSDVSS 305
            +  N  +++ S
Sbjct: 64  KTFYNFKTNIGS 75



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/53 (47%), Positives = 35/53 (66%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF++ QR+   +A   +GLN   I+NEPTAAAIAY  +++  G    LI+DL
Sbjct: 120 AYFSEIQRRCVVEAANFAGLNCKAILNEPTAAAIAYAFERQIDG--IFLIYDL 170


>UniRef50_A6C7U7 Cluster: DnaK protein (Heat shock protein),
           HSP70/DnaK family; n=1; Planctomyces maris DSM 8797|Rep:
           DnaK protein (Heat shock protein), HSP70/DnaK family -
           Planctomyces maris DSM 8797
          Length = 557

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 29/53 (54%), Positives = 39/53 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF   Q++ATK AG I+GLNV  +I EPTAAAIAYG +++   +  VL++DL
Sbjct: 124 AYFGSRQKEATKKAGEIAGLNVRYVIPEPTAAAIAYGEEQE--NDDTVLVYDL 174



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 2/54 (3%)
 Frame = +3

Query: 93  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQV 248
           GIDLGTTYSC+  + +HG+  ++ N++G+ TTPS V F D E  ++G AAK+ +
Sbjct: 8   GIDLGTTYSCISYIDEHGQPVVVQNNEGDLTTPSVVFFEDMENVVVGKAAKDAI 61


>UniRef50_A4QNX8 Cluster: Zgc:162281 protein; n=6; Eumetazoa|Rep:
           Zgc:162281 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 438

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/81 (37%), Positives = 46/81 (56%)
 Frame = +2

Query: 236 QEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFF 415
           QE    +P NTI+DAKR IG+ F++ T++ +   +PF+V+ + G     V       T  
Sbjct: 85  QELSDVNPQNTIYDAKRFIGKIFDEETLEKESARYPFKVIFNNGSADFLV-NTNSTFTVT 143

Query: 416 PEEVSSMVLTKMKETAEAYLG 478
           PE + S +L KM++ AE  LG
Sbjct: 144 PEFIGSRLLLKMRKMAEKQLG 164



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 29/53 (54%), Positives = 37/53 (69%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A F++ QR  T  A  ++GL+VLR+INEPTAAA+AYGL K      NVL+ DL
Sbjct: 176 AEFDERQRNYTIRAANLAGLDVLRVINEPTAAAMAYGLHKAEV--FNVLVVDL 226



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           K   +G+DLGTT+  VGVFQ   G++EII +D+G ++ PS V+FT T    G   +    
Sbjct: 30  KPRVIGLDLGTTFCSVGVFQPGTGEIEIIEDDKGRKSIPSVVSFTLTGVFAGHEGQELSD 89

Query: 252 MTP 260
           + P
Sbjct: 90  VNP 92


>UniRef50_P32590 Cluster: Heat shock protein homolog SSE2; n=20;
           Saccharomycetales|Rep: Heat shock protein homolog SSE2 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 693

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 44/183 (24%), Positives = 84/183 (45%), Gaps = 4/183 (2%)
 Frame = +3

Query: 93  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQY 272
           G+DLG   S + V ++  ++++ N+  NR+TPS V F    R +G++ K +   T   + 
Sbjct: 6   GLDLGNNNSVLAVARNRGIDVVVNEVSNRSTPSLVGFGPRNRYLGESGKTK--QTSNVKN 63

Query: 273 SMPNVSSDVSSKMLLCKPT*STGL--SRL-SVMEANLRSR*HIRVKTKPFSPRK-SVPWC 440
           ++ N+   +  K    +         S+L  +    +        KT  FS  + +  + 
Sbjct: 64  TVENLKRIIGLKFKDPEFDIENKFFTSKLVQLKNGKVGVEVEFGGKTHVFSATQLTAMFI 123

Query: 441 XXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 620
                       ++  +       ++++ QR    DA  I+GLN +RI+N+ TAAA++YG
Sbjct: 124 DKVKHTVQEETKSSITDVCLAVPVWYSEEQRYNIADAARIAGLNPVRIVNDVTAAAVSYG 183

Query: 621 LDK 629
           + K
Sbjct: 184 VFK 186



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 20/69 (28%), Positives = 39/69 (56%), Gaps = 1/69 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+ + KR+IG KF+D     + K +  ++V    GK  ++V + G+   F   ++++M 
Sbjct: 63  NTVENLKRIIGLKFKDPEFDIENKFFTSKLVQLKNGKVGVEVEFGGKTHVFSATQLTAMF 122

Query: 440 LTKMKETAE 466
           + K+K T +
Sbjct: 123 IDKVKHTVQ 131


>UniRef50_UPI0000D566E6 Cluster: PREDICTED: similar to CG31366-PA;
           n=2; Tribolium castaneum|Rep: PREDICTED: similar to
           CG31366-PA - Tribolium castaneum
          Length = 614

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 27/71 (38%), Positives = 44/71 (61%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTK 448
           +F  KR IG++F+D  ++ D++H PF + S   KP + + +K       PEEVS++VL K
Sbjct: 67  VFGIKRFIGKQFDDPDLRNDLRHVPFTIESIENKPIVTINHKSGVCKKTPEEVSALVLQK 126

Query: 449 MKETAEAYLGK 481
           +K   E+ LG+
Sbjct: 127 VKTDVESKLGE 137



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 26/53 (49%), Positives = 36/53 (67%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFN SQR+AT +A   +G  VL+++NEPTAAA  Y +D+    E   L++DL
Sbjct: 148 AYFNVSQREATLEAAQKAGFTVLKLLNEPTAAAFCYYVDQNWGEESYSLVYDL 200



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI 224
           +GIDLGTT S    +   KV ++ N +G+R TPS V F D   +I
Sbjct: 6   IGIDLGTTNSSAAYYFKEKVRVVENKEGDRITPSCVYFRDQNTVI 50


>UniRef50_Q1CY00 Cluster: DnaK family protein; n=2;
            Cystobacterineae|Rep: DnaK family protein - Myxococcus
            xanthus (strain DK 1622)
          Length = 1146

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 58/211 (27%), Positives = 99/211 (46%), Gaps = 16/211 (7%)
 Frame = +3

Query: 84   PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTP 260
            P +GIDLGTT SCV +  +G+  ++ + +G  T PS ++     + L+   AKNQ+ + P
Sbjct: 604  PVIGIDLGTTNSCVALLSNGRPLVLRSREGYNTIPSVISLNAQNKLLVSHRAKNQLVLRP 663

Query: 261  TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWC 440
              Q+++        +K L+ +P  S  +++       +R R H  +     + R +V   
Sbjct: 664  --QHTI------YGAKRLVGRPYDSAVVNQ-------VRERFHYDI-VPDSAGRAAVRLA 707

Query: 441  XXXXXXXXXXILANCAECSYHGSAYFNDSQRQAT-----------KDAGTISGL----NV 575
                       L    EC     A+ N    +A            ++A   SG+     V
Sbjct: 708  DTALSLEEVQALI-LRECKEMAEAHLNQKVERAVVTVPAYYSEPQREAVRKSGILAGLKV 766

Query: 576  LRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
             RI+NEPT+AA+AYGL+++    + VL++DL
Sbjct: 767  ERILNEPTSAALAYGLNRE--LNKKVLVYDL 795



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 50/168 (29%), Positives = 80/168 (47%), Gaps = 6/168 (3%)
 Frame = +2

Query: 257  PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSS 433
            P +TI+ AKRL+GR ++ A V    + + +++V D  G+  +++A    D     EEV +
Sbjct: 663  PQHTIYGAKRLVGRPYDSAVVNQVRERFHYDIVPDSAGRAAVRLA----DTALSLEEVQA 718

Query: 434  MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH-----LWLERSPNHQ*TD 598
            ++L + KE AEA+L +  +++ +   V    S+   +  R       L +ER  N   + 
Sbjct: 719  LILRECKEMAEAHLNQ--KVERAVVTVPAYYSEPQREAVRKSGILAGLKVERILNEPTSA 776

Query: 599  CCCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGD 742
                 L          K       GGTFD +IL IE  +FEV  T GD
Sbjct: 777  ALAYGLNR----ELNKKVLVYDLGGGTFDATILKIEKNVFEVLGTGGD 820


>UniRef50_Q010Y3 Cluster: DNAK_GLOVI Chaperone protein dnaK; n=1;
           Ostreococcus tauri|Rep: DNAK_GLOVI Chaperone protein
           dnaK - Ostreococcus tauri
          Length = 412

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 56/203 (27%), Positives = 92/203 (45%), Gaps = 5/203 (2%)
 Frame = +3

Query: 75  AKAPAV-GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIG-DAAKNQ 245
           A+A  + GIDLGTT S V + + GK EI+A  QG+RT PS V F +D    +G +A + Q
Sbjct: 41  ARASGICGIDLGTTNSAVAIVRDGKAEIVA-CQGHRTIPSVVCFASDGSFSVGREARRMQ 99

Query: 246 VAMTPTTQYSMPN-VSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPR 422
                 T +S    +         + K      ++      A++        +T+  +P 
Sbjct: 100 RTDARNTVHSAKRFIGKKYKKTKKIAKDFPYRVVNHPETKYASIAIEGE-NGETRLVAPE 158

Query: 423 KSVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQ-ATKDAGTISGLNVLRIINEPT 599
           +                L    + +      + D  +Q AT  AG ++GL  ++++ EP 
Sbjct: 159 EVSACVLRTLLDAAEKELGTSIDKAVITIPAYFDDAQQEATIRAGQLAGLTTVKLLKEPV 218

Query: 600 AAAIAYGLDKKGTGERNVLIFDL 668
           AAA+AYG+D +   +  V +FDL
Sbjct: 219 AAALAYGIDVE--EDETVFVFDL 239



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 3/101 (2%)
 Frame = +2

Query: 185 SVLCCVHRHRASHRRCRQEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG 364
           SV+C       S  R  +     D  NT+  AKR IG+K++     A  K +P+ VV+  
Sbjct: 79  SVVCFASDGSFSVGREARRMQRTDARNTVHSAKRFIGKKYKKTKKIA--KDFPYRVVNHP 136

Query: 365 GKPKIKVAYKGED---KTFFPEEVSSMVLTKMKETAEAYLG 478
                 +A +GE+   +   PEEVS+ VL  + + AE  LG
Sbjct: 137 ETKYASIAIEGENGETRLVAPEEVSACVLRTLLDAAEKELG 177



 Score = 33.1 bits (72), Expect = 7.4
 Identities = 14/24 (58%), Positives = 17/24 (70%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVS+L +  G  EV +T GD
Sbjct: 241 GGTFDVSVLEVGGGTVEVLATGGD 264


>UniRef50_A2EAK8 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 615

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG---LDKKGTGERNVLIFDLAA 674
           A FN +QR+AT +A T +GLN LR++NEPTAAA  Y    L K  T ++ V++FD  A
Sbjct: 163 AKFNTNQRKATLNAATKAGLNCLRLVNEPTAAAFCYKVHCLGKDDTSKKTVIVFDFGA 220



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 48/178 (26%), Positives = 76/178 (42%), Gaps = 15/178 (8%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQ--ADMKHWPFEVVSDGGKPKIKVAY-------KGEDKT 409
           P   ++ +KRLIG +F   TVQ   +M      ++   GKP  KV Y       K +++ 
Sbjct: 68  PRQLLYGSKRLIGHEFYSDTVQNFIEMNEDTLNILEVRGKPVYKVDYYDDQNNNKIKEEI 127

Query: 410 FFPEEVSSMVLTKMKETAEAYLG----KLCRMQL-SRFRVLQ*LSKTSHKRCRYHLWLER 574
           F PE++S+ +L K+  T +   G    K C + + ++F   Q    T +   +  L   R
Sbjct: 128 FTPEDISAEILKKVASTYKDASGGEQLKSCVITVPAKFNTNQ-RKATLNAATKAGLNCLR 186

Query: 575 SPNHQ*TDCCCDCLRS*QKGYWRTKCTYL*PRG-GTFDVSILTIEDGIFEVKSTAGDT 745
             N       C  +    K     K   +   G GT DVSI+  +   F V  T G++
Sbjct: 187 LVNEPTAAAFCYKVHCLGKDDTSKKTVIVFDFGAGTLDVSIVEFDGNSFNVIHTEGNS 244


>UniRef50_A7BR82 Cluster: Heat shock protein Hsp70; n=1; Beggiatoa
           sp. PS|Rep: Heat shock protein Hsp70 - Beggiatoa sp. PS
          Length = 516

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 30/53 (56%), Positives = 38/53 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF++ +R+AT DA   +GL VLRIINEPTAAA+ Y   K G  +  VLI+DL
Sbjct: 121 AYFDEYRRKATMDAAEKAGLKVLRIINEPTAAALTYA--KTGQCKGKVLIYDL 171



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/62 (43%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           K  A+GIDLGTTYS +      GK EI+ N  G R T S V F     L+G  A +  A 
Sbjct: 2   KRHAIGIDLGTTYSALATLNSSGKPEIVPNLDGERVTASAVYFQGGSILVGQLAADAAAG 61

Query: 255 TP 260
            P
Sbjct: 62  DP 63


>UniRef50_A4AEG2 Cluster: Putative uncharacterized protein; n=1;
           marine actinobacterium PHSC20C1|Rep: Putative
           uncharacterized protein - marine actinobacterium
           PHSC20C1
          Length = 98

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = -1

Query: 256 VIATWFLAASPMRRSVS-VNAT*DGVVLLPWSLAMISTFPCWKTPTQEYVVPRSIPTAGA 80
           ++  W  A SP R S S VNAT DGVV +P + AM    P  +T T E+VVPRSIPTA A
Sbjct: 10  LVTAWRFAVSPTRTSPSLVNATTDGVVRIPSAFAMTVGSPPSRTATTEFVVPRSIPTARA 69


>UniRef50_A2E407 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 693

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +2

Query: 266 TIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKP-KIKVAYKGEDKTFFPEEVSSMVL 442
           T++D+KR+IG+KF++   Q D K+W FE V        I + YKG+     PEE+S  +L
Sbjct: 66  TVYDSKRMIGKKFDNKDFQIDRKNWMFETVRGANNSININIEYKGKIIPLAPEEISGHIL 125

Query: 443 TKMKETAEAYL 475
             +K   E  L
Sbjct: 126 RYLKNITEKTL 136



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 57/201 (28%), Positives = 88/201 (43%), Gaps = 9/201 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           VGIDLGTTY CV ++   K  I++   D      PSYV++     L G  A NQ+     
Sbjct: 6   VGIDLGTTYCCVHIYDE-KRHIVSPILDGSTSQIPSYVSYCGDNILYGAVAMNQI--LNN 62

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRL--SVMEANLRSR*HIRVKTK--PFSPRKSV 431
           T+Y++ + S  +  K    K       + +  +V  AN     +I  K K  P +P +  
Sbjct: 63  TKYTVYD-SKRMIGKKFDNKDFQIDRKNWMFETVRGANNSININIEYKGKIIPLAPEEIS 121

Query: 432 PWCXXXXXXXXXXILAN--CAECSYHGSAYFNDSQRQAT-KDAGTISGLNVLRIINEPTA 602
                         L +  C++      A F+  QR+ T   A  I+G   + +++EP+A
Sbjct: 122 GHILRYLKNITEKTLTSGECSDVVVTVPAAFDSIQREKTILAAKEIAGFKHVALLDEPSA 181

Query: 603 AAIAYGLDKKGTGERNVLIFD 665
           AA+ Y        +  VLIFD
Sbjct: 182 AALEYAQGLPKHTQEKVLIFD 202


>UniRef50_A7HAI3 Cluster: 2-alkenal reductase; n=4;
           Cystobacterineae|Rep: 2-alkenal reductase -
           Anaeromyxobacter sp. Fw109-5
          Length = 759

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 56/211 (26%), Positives = 97/211 (45%), Gaps = 4/211 (1%)
 Frame = +2

Query: 125 WCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCRQEPGGDDPNNTIFDAKRLIGRKF 304
           + +P+REG  H   P     S++    RHR       +     +P  T+  AKRLIGR +
Sbjct: 214 YVIPSREG--HNTVP-----SIVALNARHRVVVGHLAKAQLLTNPKATVSGAKRLIGRAW 266

Query: 305 EDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGK 481
           +   VQ     +P+E+V  D G   +++   GE+ T   E++S++VL ++++ A+ +L +
Sbjct: 267 DTPVVQEIRAKFPYEIVPGDDGVAAVRL---GEE-TVTLEQISALVLREVRDVAQNHLRE 322

Query: 482 LCR---MQLSRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TDCCCDCLRS*QKGYWRTKC 652
                 + +  +   +  +   H      L +ER  N    +     L      +   + 
Sbjct: 323 EVNRAVITVPAYYNERQRAAVRHAAALAGLQVERILN----EPTAAALAYAYGRHLNQRV 378

Query: 653 TYL*PRGGTFDVSILTIEDGIFEVKSTAGDT 745
                 GGTFD S+L + D ++EV ST GDT
Sbjct: 379 LVYDLGGGTFDASVLELSDNVYEVVSTGGDT 409



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/53 (47%), Positives = 36/53 (67%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AY+N+ QR A + A  ++GL V RI+NEPTAAA+AY   +     + VL++DL
Sbjct: 333 AYYNERQRAAVRHAAALAGLQVERILNEPTAAALAYAYGRH--LNQRVLVYDL 383



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMTPTT 266
           VGIDLGTT SC  V + G+  +I + +G+ T PS VA     R ++G  AK Q+   P  
Sbjct: 194 VGIDLGTTNSCAAVVKDGRPYVIPSREGHNTVPSIVALNARHRVVVGHLAKAQLLTNPKA 253

Query: 267 QYS 275
             S
Sbjct: 254 TVS 256


>UniRef50_P77319 Cluster: Chaperone protein hscC; n=19;
           Gammaproteobacteria|Rep: Chaperone protein hscC -
           Escherichia coli (strain K12)
          Length = 556

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 28/53 (52%), Positives = 38/53 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+D QR+ T+ A  ++GLN +R+INEPTAAA+AYGL  +       L+FDL
Sbjct: 123 AYFSDEQRKHTRLAAELAGLNAVRLINEPTAAAMAYGLHTQ--QNTRSLVFDL 173



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMTP 260
           A+GIDLGTT S + V++ G  ++I N  G   TPS ++  +    L+G  A ++    P
Sbjct: 7   AIGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISMDENNHILVGKPAVSRRTSHP 65


>UniRef50_Q3W504 Cluster: Heat shock protein Hsp70; n=3;
           Actinomycetales|Rep: Heat shock protein Hsp70 - Frankia
           sp. EAN1pec
          Length = 586

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 26/49 (53%), Positives = 34/49 (69%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL 656
           AYF D +R+AT  AG  +GLNV+ +INEPTAAA++YG  +   G R  L
Sbjct: 92  AYFGDEERRATVLAGEYAGLNVVDVINEPTAAALSYGFARFEVGSRRTL 140


>UniRef50_A5MZQ7 Cluster: DnaK9; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK9 - Clostridium kluyveri DSM 555
          Length = 540

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 26/53 (49%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF   QR+ATK A   +GLNVLR++ EPTAAA+ YG+D++   ++ ++++DL
Sbjct: 118 AYFTSEQREATKRAAERAGLNVLRLMPEPTAAALDYGIDQQ--RDQIIMVYDL 168



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/59 (40%), Positives = 35/59 (59%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           VGIDLGTT S V   + G+ E+I  D G    PS ++  D E ++G  AK ++ ++P T
Sbjct: 5   VGIDLGTTNSVVSYLKRGRAEVIPID-GKNIFPSVLSIRDGEIIVGSQAKARMMLSPET 62


>UniRef50_Q22CW2 Cluster: Heat shock protein 70 homolog; n=1;
           Tetrahymena thermophila SB210|Rep: Heat shock protein 70
           homolog - Tetrahymena thermophila SB210
          Length = 146

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVA-FTDTERLIGDAAKNQVA 251
           +GIDLGTT SCV + +    +II N +G RTTPS VA   D  RL+G  AK QV+
Sbjct: 27  IGIDLGTTNSCVAIMEGSAPKIIENAEGFRTTPSVVAILPDGSRLVGAPAKRQVS 81


>UniRef50_Q20752 Cluster: Putative uncharacterized protein stc-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein stc-1 - Caenorhabditis elegans
          Length = 450

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 3/78 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFE--DATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEE 424
           +P  TI+DAKR IGR FE  +    +D K +PF++  D  GK   ++      K  +PEE
Sbjct: 94  NPKRTIYDAKRFIGRNFEKNNKDFLSDQKRYPFKINLDSEGKAFFEIPLDSGTKNVYPEE 153

Query: 425 VSSMVLTKMKETAEAYLG 478
           + S+++  +K  A  +LG
Sbjct: 154 IGSLIIGYLKSAAAKHLG 171



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/53 (52%), Positives = 36/53 (67%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A FN+ QR  T  A  I+ + V R+I+EPTAAA+AYGL KK  G  NV++ DL
Sbjct: 183 AEFNEKQRNFTAKAAEIAEMEVRRVISEPTAAALAYGLHKK-QGVENVVVVDL 234



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 5/71 (7%)
 Frame = +3

Query: 63  KYKMAKAPA--VGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTER-LIG 227
           KY +   P    GIDLGTTYS +G++    G+  I+ +D G ++ PS VAF      LIG
Sbjct: 25  KYGLPPPPPKIAGIDLGTTYSSIGIYHAVTGETIILPDDLGKKSVPSVVAFLPNGTVLIG 84

Query: 228 DAAKNQVAMTP 260
             A  Q    P
Sbjct: 85  TRATEQQEHNP 95


>UniRef50_Q2IKD7 Cluster: Conserved region 2266; n=2;
           Anaeromyxobacter dehalogenans 2CP-C|Rep: Conserved
           region 2266 - Anaeromyxobacter dehalogenans (strain
           2CP-C)
          Length = 782

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AY+N+ QR A + AG ++GL V RI+NEPTAAA+AY   +    ++ VL++DL
Sbjct: 368 AYYNERQRAAVRHAGALAGLKVERILNEPTAAALAYAFGRH--LDQRVLVYDL 418



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 47/168 (27%), Positives = 78/168 (46%), Gaps = 4/168 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  T++ AKRL+GR F+   VQ     + +E+V+    P    A +   +T   E+VS+
Sbjct: 285 NPRATVWGAKRLVGRAFDSPVVQEIKGKFAYEIVAG---PDGLAAVRLGPETLTLEQVSA 341

Query: 434 MVLTKMKETAEAYLGKLCR---MQLSRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TDCC 604
           +VL ++KE A+ +LG+      + +  +   +  +   H      L +ER  N       
Sbjct: 342 LVLAEVKEVAQNHLGEEVNRAVITVPAYYNERQRAAVRHAGALAGLKVERILNEPTAAAL 401

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDGIFEVKSTAGDT 745
                    G    +   +   GG TFD S+L + D ++EV ST GDT
Sbjct: 402 AYAF-----GRHLDQRVLVYDLGGGTFDASVLELNDNVYEVVSTGGDT 444



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMTP 260
           +GIDLGT+ SC  V + G+  +I + +G  T PS VA     R+ +G  A+ Q+   P
Sbjct: 229 IGIDLGTSNSCAAVVRDGRPYVIPSREGYNTVPSIVALNARNRIVVGHLARAQLLTNP 286


>UniRef50_A2G573 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 621

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 29/58 (50%), Positives = 41/58 (70%), Gaps = 3/58 (5%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG---LDKKGTGERNVLIFDLAA 674
           A F+ +QR+ TK A  ++GL+V++ I+EPTAAAIAY     D+  TG++ VLIFD  A
Sbjct: 145 ALFSPNQRECTKTAAELAGLDVIQFISEPTAAAIAYKDTIKDQGVTGKQTVLIFDFGA 202



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 25/66 (37%), Positives = 39/66 (59%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 436
           P    + +KRLIGRKF D  VQ  +K  P+E+++   +P    AY  E  T+ PE +S+ 
Sbjct: 64  PERVAYGSKRLIGRKFNDPYVQNFIKTCPYEIINKNDRP----AYVIEGNTYDPETISAQ 119

Query: 437 VLTKMK 454
           +L ++K
Sbjct: 120 ILLEIK 125


>UniRef50_A6CBP2 Cluster: Dnak protein, truncation; n=1;
           Planctomyces maris DSM 8797|Rep: Dnak protein,
           truncation - Planctomyces maris DSM 8797
          Length = 671

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           M K  AVGIDLGTTYSC+  + +HG+   I N +G  +TPS   F   E ++G  A    
Sbjct: 1   MQKIQAVGIDLGTTYSCIAHLNEHGEPVTIPNQEGELSTPSVAMFDGAEVIVGTEALRHA 60

Query: 249 AMTP 260
            + P
Sbjct: 61  IVNP 64



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 6/59 (10%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG------TGERNVLIFDL 668
           A F+D QRQ T  AG  +GL  + +INEP AAA+ Y L  +G        E+ +L++DL
Sbjct: 122 AQFSDLQRQETIAAGKQAGLKQVDLINEPVAAALCYVLGAEGMWFAELAEEQRILVYDL 180


>UniRef50_A3BBU4 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 340

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 24/37 (64%), Positives = 30/37 (81%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTP 188
           +   +GI+LGTTYS VGV+++G VEIIANDQGN  TP
Sbjct: 40  RCTVIGINLGTTYSWVGVYRNGIVEIIANDQGNHITP 76



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/37 (72%), Positives = 32/37 (86%)
 Frame = +3

Query: 558 ISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           I+GL + RIINEPTA AIAY +DKKGT E++VLIFDL
Sbjct: 99  IAGLTIDRIINEPTAGAIAYDIDKKGT-EKSVLIFDL 134


>UniRef50_A2DHP3 Cluster: Heat shock protein, putative; n=1;
           Trichomonas vaginalis G3|Rep: Heat shock protein,
           putative - Trichomonas vaginalis G3
          Length = 266

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 52/186 (27%), Positives = 75/186 (40%), Gaps = 11/186 (5%)
 Frame = +3

Query: 87  AVGIDLGTT-----YSCVGVFQHGKVEIIANDQ-GNRTTPSYVAFTDTERLIGDAAKNQV 248
           A+GIDLGT      Y+  G  +    E++ NDQ G  TTP+ V+FTD   LIG+ A+   
Sbjct: 3   AIGIDLGTNNSRIAYNTSGPNEIPSFELLLNDQTGKSTTPTLVSFTDDSILIGEEARKVY 62

Query: 249 AMTPTTQ-YSMPNVSS----DVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
           A  P    Y +  +      ++      C    S       ++E           K + +
Sbjct: 63  ADKPENAIYGIKPMLGRRYYEIEKLFRNCPFKISYDSDGWPIVEITQNG------KVEMY 116

Query: 414 SPRKSVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           SP + + +                  C     A    SQR A K    ISG NVL++I E
Sbjct: 117 SPEEMMSFIFGELNNMVTSRAGKEKSCVITVPAKSTSSQRAAMKRVAEISGFNVLKVITE 176

Query: 594 PTAAAI 611
           P AA +
Sbjct: 177 PVAATV 182



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 19/78 (24%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEV 427
           D P N I+  K ++GR++ +  ++   ++ PF++  D  G P +++   G+ + + PEE+
Sbjct: 64  DKPENAIYGIKPMLGRRYYE--IEKLFRNCPFKISYDSDGWPIVEITQNGKVEMYSPEEM 121

Query: 428 SSMVLTKMKETAEAYLGK 481
            S +  ++     +  GK
Sbjct: 122 MSFIFGELNNMVTSRAGK 139


>UniRef50_UPI00006CB7AD Cluster: dnaK protein; n=1; Tetrahymena
           thermophila SB210|Rep: dnaK protein - Tetrahymena
           thermophila SB210
          Length = 1213

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/58 (41%), Positives = 36/58 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           +GID G TYS V + Q G++ II N+ GN  TPS V+F + +  +G+ A +Q    P+
Sbjct: 28  IGIDFGNTYSSVAIVQEGQLIIIPNEYGNTETPSVVSFAEDKIFVGEQAIHQYQNNPS 85


>UniRef50_Q056V9 Cluster: Molecular chaperone; n=1; Buchnera
           aphidicola str. Cc (Cinara cedri)|Rep: Molecular
           chaperone - Buchnera aphidicola subsp. Cinara cedri
          Length = 499

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/53 (49%), Positives = 36/53 (67%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFN+ Q+   + A     L +LR++NEPTAAAIAYGL+KK  G   + ++DL
Sbjct: 142 AYFNNIQKNIVRKAAETVNLKILRLLNEPTAAAIAYGLEKKKKG--IICVYDL 192



 Score = 37.9 bits (84), Expect = 0.26
 Identities = 18/24 (75%), Positives = 19/24 (79%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDVSIL I  GIFEV ST G+
Sbjct: 194 GGTFDVSILKISKGIFEVLSTNGN 217



 Score = 33.9 bits (74), Expect = 4.2
 Identities = 18/52 (34%), Positives = 26/52 (50%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           M K   +GID GTT S V      K++II N    +  PS +  ++ +  IG
Sbjct: 1   MKKKTIIGIDFGTTNSLVSTILEKKIKIINNFNKKKFFPSIIHISNKKISIG 52


>UniRef50_A6G1M6 Cluster: Chaperone DnaK; n=1; Plesiocystis pacifica
           SIR-1|Rep: Chaperone DnaK - Plesiocystis pacifica SIR-1
          Length = 539

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/52 (50%), Positives = 38/52 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           A F DSQR AT+ A  ++GL+V+R+INEPTAAA+AYG  +    +R + ++D
Sbjct: 146 ANFTDSQRSATRIAARLAGLDVIRVINEPTAAALAYGYIE--DMDRRIAVYD 195



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 25/76 (32%), Positives = 40/76 (52%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           DP   ++ AKRLIGR+F    VQ   +  P+ +V +G    + +   G   +    E+SS
Sbjct: 63  DPTQVVYSAKRLIGRRFSSPEVQRHRETVPYRIV-EGPNESVMIELGGRRLSIV--EISS 119

Query: 434 MVLTKMKETAEAYLGK 481
            +L  +K+ AE  LG+
Sbjct: 120 QILRYLKDMAEEALGQ 135



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV-AFTDTERLIGDAAKNQVAMTPT 263
           +GIDLGTT S   V + G+  ++     +R  PS V A ++ +  +G+ AK   ++ PT
Sbjct: 8   LGIDLGTTNSACAVVRDGRASVVRRGD-DRIVPSVVAALSNGQFAVGNEAKQLRSVDPT 65



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 15/24 (62%), Positives = 19/24 (79%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFDV+IL I   +FEV ST+G+
Sbjct: 198 GGTFDVTILQITRNVFEVLSTSGE 221


>UniRef50_Q54GD7 Cluster: Heat shock protein Hsp70 family protein;
           n=2; Dictyostelium discoideum|Rep: Heat shock protein
           Hsp70 family protein - Dictyostelium discoideum AX4
          Length = 772

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/54 (48%), Positives = 40/54 (74%), Gaps = 2/54 (3%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--GTGERNVLIFDL 668
           ++ND QR+A  +AG+I+GLN++R+INE TA A++YG+ K+   T   NVL  D+
Sbjct: 148 FWNDYQRRAILNAGSIAGLNIIRLINETTATALSYGIYKEWSETDPTNVLFVDV 201



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 1/77 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NTI + KR IG++F+  TVQ ++KH  F+    D G     V Y GE  +F  E +  M+
Sbjct: 63  NTITNIKRFIGQEFKTDTVQEELKHEMFQSYEMDNGFVGYNVTYAGEQCSFSSEAILGML 122

Query: 440 LTKMKETAEAYLGKLCR 490
             K+K+T EA++    R
Sbjct: 123 FGKLKKTTEAFVNNPVR 139



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           VG D GT    + V Q G V++IAN+  NR TPS V+F + ER +G++A
Sbjct: 5   VGFDFGTKNCTIAVAQKGGVDVIANEVSNRLTPSMVSFGEKERYLGESA 53


>UniRef50_Q8YNT4 Cluster: DnaK-type molecular chaperone; n=2;
           Nostocaceae|Rep: DnaK-type molecular chaperone -
           Anabaena sp. (strain PCC 7120)
          Length = 712

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 24/52 (46%), Positives = 33/52 (63%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           AYFND QR AT+ A   +GL  L ++ EPTAAAI+YG        + +L++D
Sbjct: 130 AYFNDQQRYATRTAALKAGLTPLELLPEPTAAAISYGFSPDSEDVKTILVYD 181



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 2/75 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV--SDGGKPKIKVAYKGEDKTFFPEEV 427
           DP N I   KRLIGR F D  V+       +++   S G    I V   G++  + PE++
Sbjct: 38  DPENVIASIKRLIGRGFSDQAVKKQRLEVGYKITEPSYGTDNSIAVWLGGQE--YSPEDI 95

Query: 428 SSMVLTKMKETAEAY 472
           S+ +L K+   A+AY
Sbjct: 96  SAEILKKVVSNAQAY 110


>UniRef50_A2F0R7 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 995

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 43/179 (24%), Positives = 77/179 (43%), Gaps = 3/179 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GID G     +    +G V++IAN   +R TP+ V +T+  R +GD AK Q       +
Sbjct: 5   IGIDFGNKNCIISAEVNGSVDVIANQNASRATPAIVTYTNKRRFVGDLAKMQ--QMEFYK 62

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLR-SR*HIRVKTKP--FSPRKSVPWC 440
            ++  + S +  K    +      LS + ++E   + +   I+         P + V + 
Sbjct: 63  ATITKIKSLIGMKFDSVEKKQIEPLSTVKLVELEDKYTGVSIQYNDTEIVMRPEQIVAYL 122

Query: 441 XXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
                      + N  +       ++   QRQ   ++  IS +N+L +IN  TAAA +Y
Sbjct: 123 LKELVKIAKAQVPNADKAVIAIPPWWTHEQRQILLNSAKISDINILGLINSTTAAAASY 181


>UniRef50_UPI000038E267 Cluster: hypothetical protein Faci_03001788;
           n=1; Ferroplasma acidarmanus fer1|Rep: hypothetical
           protein Faci_03001788 - Ferroplasma acidarmanus fer1
          Length = 565

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 22/55 (40%), Positives = 37/55 (67%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLAA 674
           AYFN++QR AT++A  I+G+ V + ++EP A AI+Y         +N+L+FD+ +
Sbjct: 125 AYFNNNQRNATREAAAIAGIKVKQFVSEPAAVAISYWNRASKAEAKNILVFDMGS 179


>UniRef50_A5N5I5 Cluster: DnaK1; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK1 - Clostridium kluyveri DSM 555
          Length = 521

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 23/53 (43%), Positives = 40/53 (75%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF   QR+ATK+A   +G NVLR++ EP+AAA++YG+++    ++ ++++DL
Sbjct: 118 AYFTSEQRKATKNAARKAGFNVLRLMAEPSAAAVSYGINQ--NKDQIIMVYDL 168



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/58 (43%), Positives = 35/58 (60%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           VGIDLGTT S +   + GKVE I  D G  T PS V+ ++ + + G  AK ++ M P+
Sbjct: 5   VGIDLGTTNSVISCVKRGKVETILLD-GKNTFPSVVSISNGKIITGYPAKAKLIMDPS 61


>UniRef50_A3FQM0 Cluster: Heat shock 105kD; heat shock 105kD alpha;
           heat shock 105kD beta; heat shock 105kDa protein 1; n=2;
           Cryptosporidium|Rep: Heat shock 105kD; heat shock 105kD
           alpha; heat shock 105kD beta; heat shock 105kDa protein
           1 - Cryptosporidium parvum Iowa II
          Length = 806

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 23/49 (46%), Positives = 31/49 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           +G+D+GT  + V     G V I+ N+   RTTP  V +TDTERLIG+ A
Sbjct: 4   IGLDIGTINAVVATINRGAVTIVRNELSERTTPILVGYTDTERLIGEPA 52



 Score = 37.9 bits (84), Expect = 0.26
 Identities = 17/46 (36%), Positives = 28/46 (60%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERN 650
           Y+++  RQ   DA  I+G+N LR++NE +A A+ YG+ +      N
Sbjct: 146 YYDNVARQNVLDALHIAGINCLRLMNEESAVALDYGIFRSNNFAEN 191


>UniRef50_A2F432 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 629

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 28/58 (48%), Positives = 40/58 (68%), Gaps = 3/58 (5%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY--GLDKKGTGE-RNVLIFDLAA 674
           A FN +QR+AT++A   +GLN LR++NEPTAAA AY   LD+    E + +++FD  A
Sbjct: 158 ANFNTNQRRATQNAAQKAGLNCLRLVNEPTAAAFAYKQSLDEVTLRENQTIIVFDFGA 215



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 4/68 (5%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADMK-HW-PFEVVSDGGKPKIKVAYKGEDKTFF--PEEVSSM 436
           +F AKRL+GR F+   VQ  +K H    ++V+   KP  K+ ++  +KT++  PE+VSS 
Sbjct: 73  LFGAKRLLGRNFDHEKVQEFIKIHKDKVDIVNQDNKPLYKITFEDYNKTYYKKPEDVSSD 132

Query: 437 VLTKMKET 460
           +L  ++ET
Sbjct: 133 LLGFVRET 140


>UniRef50_P41755 Cluster: NAD-specific glutamate dehydrogenase; n=2;
            Eukaryota|Rep: NAD-specific glutamate dehydrogenase -
            Achlya klebsiana
          Length = 1063

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 24/54 (44%), Positives = 37/54 (68%)
 Frame = -3

Query: 254  HRHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDS 93
            H +LVL GI+++T  V E N+R  G V L+VG++ +  VL DT+ R+  T+ID+
Sbjct: 981  HGNLVLSGITNKTFAVSESNVRWGGTVTLIVGNNFNTIVLPDTDTRISRTEIDT 1034



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = -1

Query: 466  FGSFLHFRKHHGTDFLGEKGFVFTLICYLDLRFASIT-DNLERPVLHVGLHSSIFELTSD 290
            F +FLH  ++H  +F   +   FTL    DL   + T  NLE PVL++GL S + E T+D
Sbjct: 909  FSNFLHLDQNHRGNFFRLESLSFTLEFDGDLWLVTSTRGNLEWPVLNIGLSSWVVEFTTD 968

Query: 289  ETFGIEYCV 263
            +T  IE+ V
Sbjct: 969  QTLSIEHSV 977



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/52 (42%), Positives = 40/52 (76%)
 Frame = -3

Query: 668 EVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEV 513
           +++++ I+F+ TL VKTV N  +SRF++D+++V+  +GT I   L+LRV+E+
Sbjct: 842 KIENENIAFT-TLLVKTVGNGGTSRFVNDTKDVKTSNGTSILGSLTLRVVEI 892


>UniRef50_Q7M2S5 Cluster: DnaK-type molecular chaperone; n=1; Sus
           scrofa domestica|Rep: DnaK-type molecular chaperone -
           Sus scrofa domestica (domestic pig)
          Length = 167

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 27/36 (75%), Positives = 30/36 (83%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
           AYFND      +DAGTI+GLNV+RIINEPTAAAIAY
Sbjct: 52  AYFND------RDAGTIAGLNVMRIINEPTAAAIAY 81


>UniRef50_A7AN53 Cluster: DnaK family protein; n=1; Babesia
           bovis|Rep: DnaK family protein - Babesia bovis
          Length = 755

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 41/185 (22%), Positives = 79/185 (42%), Gaps = 5/185 (2%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM--- 254
           P +GID+G   + V     G ++++ N+   R TP   +FT   RL GD A  Q+     
Sbjct: 2   PVLGIDIGDANATVATIAKGSIDVVLNEVSQRYTPVCASFTQKRRLFGDQATPQMISNYR 61

Query: 255 -TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
            +  +  S+   +   +S++ + +       + LS+         +  +  +P+   K +
Sbjct: 62  NSCRSMMSLLGRTIGTNSELDIDELDDFFSTNGLSLCPNGFVGY-NCAMSPEPYDVMKVL 120

Query: 432 P-WCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
             +               C +       ++ + Q++A K A T +GL  L +I+E TA A
Sbjct: 121 SGYLGFLNSMAEKYTKGLCKQVVISCPGWYTEMQKEAVKIAATAAGLTCLNVIDECTAMA 180

Query: 609 IAYGL 623
           + YG+
Sbjct: 181 LDYGV 185


>UniRef50_A2DR00 Cluster: DnaK protein; n=7; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 615

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEV 427
           ++P+  IF AKRLIG K+ D  VQ   ++  FE+  D    P I V    + K + PEE+
Sbjct: 69  NNPSRVIFGAKRLIGHKYHDRPVQELFENVGFEIQPDEDDNPLIVV----DGKKYMPEEI 124

Query: 428 SSMVLTKMKETAEAYLGK 481
           SS +L  +KET ++  GK
Sbjct: 125 SSFLLEHVKETYKSATGK 142



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 28/62 (45%), Positives = 40/62 (64%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           +C     A FND+QR ATK A  I+ LNV + ++EPTAAAIAY  + +   + ++L+FD 
Sbjct: 146 DCVITVPANFNDAQRNATKTAARIANLNVRKFLSEPTAAAIAY-YNIEPKDKIHLLVFDF 204

Query: 669 AA 674
            A
Sbjct: 205 GA 206


>UniRef50_A0DJC4 Cluster: Chromosome undetermined scaffold_53, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_53,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 817

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 55/197 (27%), Positives = 86/197 (43%), Gaps = 10/197 (5%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA----- 236
           M++  ++GID G+  S +     G V+++ N+  +R T + V FT  ER IG+       
Sbjct: 1   MSQLASIGIDFGSQRSVIAAALKGGVKVLDNEGSHRETQNVVGFTVEERFIGEQGALQQK 60

Query: 237 ---KNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTK 407
              KN VA            +        L  PT ST  S  +  E N     ++  KT 
Sbjct: 61  SNFKNSVAFFNRFLGLHGEPAFRAEETKWLTVPT-STNDSGKTQFEVN-----YLGQKT- 113

Query: 408 PFSPRKSVPWCXXXXXXXXXXILANCAECSYHGS--AYFNDSQRQATKDAGTISGLNVLR 581
            F+P +                  N    ++  S  AY+ +S+R+A  DA  I+ + + R
Sbjct: 114 TFTPEQLTGSMLNKLKHVIAHNDINSQASNFCISVPAYYTESERKALIDACKIADIPLER 173

Query: 582 IINEPTAAAIAYGLDKK 632
           ++NE TA AI YGL +K
Sbjct: 174 LLNETTAIAINYGLFRK 190



 Score = 33.9 bits (74), Expect = 4.2
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS--DGGKPKIKVAYKGEDKTFFPEEVSSM 436
           N++    R +G   E A  +A+   W     S  D GK + +V Y G+  TF PE+++  
Sbjct: 65  NSVAFFNRFLGLHGEPA-FRAEETKWLTVPTSTNDSGKTQFEVNYLGQKTTFTPEQLTGS 123

Query: 437 VLTKMK 454
           +L K+K
Sbjct: 124 MLNKLK 129


>UniRef50_A6UND5 Cluster: 2-alkenal reductase; n=1; Methanococcus
           vannielii SB|Rep: 2-alkenal reductase - Methanococcus
           vannielii SB
          Length = 573

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 25/52 (48%), Positives = 37/52 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           A F +  R+AT + G ++GLNVL +INEPTAAA+A+G+    + E N+ +FD
Sbjct: 116 ANFAEPARKATYNIGKLAGLNVLGLINEPTAAALAFGIRNLSSNE-NIAVFD 166



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGK-VEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           P +GIDLGT+ S + VF+ GK + I   +  +   PS +A  ++E ++G  AK
Sbjct: 4   PIIGIDLGTSTSEIFVFKDGKQMPINDPESDSSVVPSIIAMQNSEIIVGSQAK 56


>UniRef50_A4ZY06 Cluster: Putative uncharacterized protein; n=1;
           Rhodococcus sp. DK17|Rep: Putative uncharacterized
           protein - Rhodococcus sp. DK17
          Length = 316

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 26/51 (50%), Positives = 35/51 (68%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           AVGIDLGTT S +  +Q  +  +IAN +G RTTPS VAFT++    G +A+
Sbjct: 4   AVGIDLGTTNSAIACWQGSEPVVIANAEGARTTPSVVAFTESGEPPGRSAR 54


>UniRef50_Q4Q9A4 Cluster: Heat shock 70 protein-like protein; n=3;
           Leishmania|Rep: Heat shock 70 protein-like protein -
           Leishmania major
          Length = 944

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 49/206 (23%), Positives = 88/206 (42%), Gaps = 6/206 (2%)
 Frame = +3

Query: 51  KTD*KYKMAKAPAVGIDLGTTYSCVGVFQHG--KVEIIANDQGNRTTPSYVAFTDTE--R 218
           K D + K  +   +GIDLGTT SC+        + +II +  G+   P+ + F      R
Sbjct: 81  KEDTREKRGRGRVIGIDLGTTNSCICYIDAATRRPKIIPSPTGSWVYPTAITFDKNHQIR 140

Query: 219 LIGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV 398
           + G+ A+   A   T+  +       +  +         + LS+ +++  N +    + +
Sbjct: 141 MFGEEAR---ACARTSASATLCSGKRLIGRGFGELGRVQSNLSKTNILTVNEKGEVAVEI 197

Query: 399 KTKPFSPRKSVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNV 575
             + ++    +              L     +      AYF   Q+ AT+DA   +G +V
Sbjct: 198 MGRTYTVVHIIAMFLRYLKSEAEKFLDEEVQQAVVSVPAYFTPQQKVATEDAALCAGFDV 257

Query: 576 LRIINEPTAAAIAYG-LDKKGTGERN 650
           L II+EP+AA +AY  L+K    ER+
Sbjct: 258 LEIIDEPSAACLAYTVLEKLKREERD 283


>UniRef50_UPI0000E474BD Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 488

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/36 (58%), Positives = 29/36 (80%)
 Frame = +3

Query: 132 FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           F  GK E++AND G+RTTP+ VAFTD E+++G +AK
Sbjct: 15  FSDGKTEVVANDAGDRTTPTAVAFTDNEKIVGLSAK 50



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 26/76 (34%), Positives = 39/76 (51%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+   K ++GRKFED  +Q   +  PF+VV   G    ++    +       EV+ 
Sbjct: 56  NPVNTVMQVKHIVGRKFEDQVIQDLKRQSPFKVVESKGLAGFEIEANNKKNIVSSLEVAG 115

Query: 434 MVLTKMKETAEAYLGK 481
           +V  K+KE AE   GK
Sbjct: 116 LVFRKLKEIAEHQGGK 131



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLD-KKGTGERNVLIFDL 668
           F+D QR A + A   +G  +LR+I++P+AA +AY +   K     NVL++ L
Sbjct: 144 FSDGQRAAVRKAAEAAGFKILRLISDPSAAVLAYEIGVTKPHDPCNVLVYRL 195


>UniRef50_UPI0000499107 Cluster: 70 kDa heat shock protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 70 kDa heat shock
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 559

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 28/72 (38%), Positives = 46/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKV--AYKGEDKTFFPEEVSSMV 439
           ++D+KR+IG    D + + D KHWPF V+ ++ GK  ++V   +K +D+ F PEE+S MV
Sbjct: 72  LYDSKRIIGSDISDISDE-DKKHWPFTVIGNNNGKACMEVYNPFKQKDEIFEPEEISGMV 130

Query: 440 LTKMKETAEAYL 475
           L  +   A++ L
Sbjct: 131 LKNLILMAKSKL 142



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 47/183 (25%), Positives = 77/183 (42%), Gaps = 7/183 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQH-GKVEIIANDQ-GNRTTPSYVAFTDTER---LIGDAAKNQVAM 254
           VGID GTT+S +  +    K +   ND+ GN+  PS+V+F   E    +IG+ AKN++  
Sbjct: 9   VGIDFGTTFSSIAYYNPLNKTDCTINDEGGNKQIPSWVSFAQMENSGVIIGNGAKNEIFG 68

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVP 434
                 S   + SD+S      K      +   +  +A +      + K + F P +   
Sbjct: 69  ECVLYDSKRIIGSDISDISDEDKKHWPFTVIGNNNGKACMEVYNPFKQKDEIFEPEEISG 128

Query: 435 WCXXXXXXXXXXILAN--CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                        L N             F+D +R AT  A  ++G+  + ++NEP AA 
Sbjct: 129 MVLKNLILMAKSKLDNTEIGNIVVTVPTEFDDKKRNATLAACKLAGIENVTLVNEPVAAL 188

Query: 609 IAY 617
           + Y
Sbjct: 189 VEY 191


>UniRef50_UPI0000499E28 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 480

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/53 (47%), Positives = 38/53 (71%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+DSQ+  TK A  ++G +++R++ EP+AAA AYGL+   T ++  L FDL
Sbjct: 149 AYFDDSQKDRTKKAVLMAGFSLIRLLAEPSAAAYAYGLE--STKDQMYLAFDL 199



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 4/66 (6%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADM--KHWPFEVV-SDGGKPKIKVAYKG-EDKTFFPEEVSSM 436
           I + KR IG+KF+D  VQ D+   ++P+++V  D G   + V Y   E++   PE VS++
Sbjct: 61  ICEVKRFIGKKFDDEQVQEDINKNYFPYQIVKGDDGYCLVVVDYPDKEEERVEPEVVSAI 120

Query: 437 VLTKMK 454
           VL  +K
Sbjct: 121 VLKAIK 126



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 22/46 (47%), Positives = 24/46 (52%), Gaps = 2/46 (4%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAF 203
           M +   VGIDLGTT+ C   F  Q  K E I    GN T PS V F
Sbjct: 1   MQQETVVGIDLGTTFCCCHFFNTQTNKYECINYLNGNSTIPSTVDF 46


>UniRef50_Q4CS27 Cluster: Putative uncharacterized protein; n=3;
           Trypanosoma|Rep: Putative uncharacterized protein -
           Trypanosoma cruzi
          Length = 722

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTY-SCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           A A  +GID G+ Y    G      V+I+ N+Q +R T +Y+ F + ER IGD AK   A
Sbjct: 17  ASANVLGIDFGSEYIEVAGPHNGNNVDIVLNEQSHRKTDNYIGFKNGERYIGDQAKALAA 76

Query: 252 MTPTTQYSMPN 284
             P    +M N
Sbjct: 77  RFPLNMVTMIN 87



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/51 (37%), Positives = 35/51 (68%), Gaps = 2/51 (3%)
 Frame = +3

Query: 528 QRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER--NVLIFDLAA 674
           +RQA  +A  + G+NVL +++  TAAA  YG+ ++G G +  N+L++D+ +
Sbjct: 169 KRQAILEAARLVGMNVLGLMHSTTAAAFYYGIRRRGLGNKTMNLLVYDIGS 219


>UniRef50_O15797 Cluster: CG4; n=10; Plasmodium|Rep: CG4 -
           Plasmodium falciparum
          Length = 855

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           +GID+G   S V     G + ++ ND   R TP+ V FT+ ERLIGD+A +++
Sbjct: 4   LGIDIGNDNSVVATINKGAINVVRNDISERLTPTLVGFTEKERLIGDSALSKL 56



 Score = 33.1 bits (72), Expect = 7.4
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 3/72 (4%)
 Frame = +3

Query: 483 CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK-KGTGERN--V 653
           C E        F + Q++    A  I   NVLRII++ TA A+ YG+ + K   E N  +
Sbjct: 137 CKEIVLSYPPTFTNCQKECLLAATKIINANVLRIISDNTAVALDYGMYRMKEFKEDNGSL 196

Query: 654 LIFDLAAVPSTC 689
           L+F      +TC
Sbjct: 197 LVFVNIGYANTC 208


>UniRef50_UPI0000499681 Cluster: heat shock protein 70; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 527

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 24/53 (45%), Positives = 39/53 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF++SQ+  TK A  ++G +++R++ EP+AAA AYGL+   T ++  L+FDL
Sbjct: 154 AYFDNSQKDRTKKAVLMAGFSLIRLLAEPSAAAYAYGLE--STKDQMYLVFDL 204



 Score = 39.9 bits (89), Expect = 0.065
 Identities = 25/64 (39%), Positives = 40/64 (62%), Gaps = 6/64 (9%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADM--KHWPFEVV-SDGGKPKIKVAY---KGEDKTFFPEEVS 430
           I + KR IG+KF+D  VQ D+   ++P+++V  D G  +I V Y   + E++   PE VS
Sbjct: 64  ICEVKRFIGKKFDDEQVQEDINKNYFPYQIVKGDDGYCQIVVDYPDKEEEEEQVEPEVVS 123

Query: 431 SMVL 442
           ++VL
Sbjct: 124 AIVL 127



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 21/40 (52%), Positives = 22/40 (55%), Gaps = 2/40 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAF 203
           VGIDLGTT+ C   F  Q  K E I    GN T PS V F
Sbjct: 10  VGIDLGTTFCCCHFFNTQTNKYECIYYLNGNSTIPSTVDF 49


>UniRef50_UPI00015B4F76 Cluster: PREDICTED: similar to putative gdh;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           putative gdh - Nasonia vitripennis
          Length = 486

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/74 (35%), Positives = 41/74 (55%)
 Frame = -1

Query: 475 KISFGSFLHFRKHHGTDFLGEKGFVFTLICYLDLRFASITDNLERPVLHVGLHSSIFELT 296
           ++S   FLH  K+H  DFL  + FV      LD+  A + D+ ER  L + L+ S+    
Sbjct: 391 EVSLRGFLHLSKNHSRDFLRSEDFVALAGGDLDMGLAVLLDDFEREELDIVLNGSVGPFA 450

Query: 295 SDETFGIEYCVVGV 254
           ++ET G+E+ V+ V
Sbjct: 451 TNETLGVEHGVLRV 464



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = -3

Query: 668 EVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEV 513
           +V+D+ +  S  L VKTVS+      +DD  +++  D + I  GL L V+EV
Sbjct: 327 QVEDENVLLS-VLLVKTVSDGGGGGLVDDPHHLETGDDSGILGGLPLSVVEV 377


>UniRef50_UPI0000DC15CB Cluster: UPI0000DC15CB related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC15CB UniRef100 entry -
           Rattus norvegicus
          Length = 490

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/41 (58%), Positives = 31/41 (75%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV 385
           + +FDAKRLI  KF +ATVQ + +H+ F VVSDGGK K +V
Sbjct: 51  HAVFDAKRLISSKFTEATVQPEKEHF-FRVVSDGGKSKAQV 90



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/37 (64%), Positives = 26/37 (70%)
 Frame = +3

Query: 507 SAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
           +AYF+D Q QATKD G    LNVLRII E T A IAY
Sbjct: 98  AAYFSDLQCQATKDRGATK-LNVLRIIKETTTATIAY 133


>UniRef50_Q4QDQ2 Cluster: Heat shock protein, putative; n=5;
           Trypanosomatidae|Rep: Heat shock protein, putative -
           Leishmania major
          Length = 823

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 22/65 (33%), Positives = 40/65 (61%), Gaps = 1/65 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+F  KR IG + +D+ +  ++K     ++ D  G+    V Y GE+K F+PE+V +M+
Sbjct: 62  NTVFLLKRFIGMRMDDSQLSRELKFLTCNIIGDTSGRLMFSVNYCGEEKHFYPEQVLAMM 121

Query: 440 LTKMK 454
           L +++
Sbjct: 122 LQRLR 126



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +3

Query: 93  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD 230
           GID G   S V + ++G V+I+ N+   R T + V+F D ER IG+
Sbjct: 5   GIDFGNVNSTVAITRYGGVDIVTNEVSKRETTTIVSFVDDERFIGE 50



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
           Y+   QR+    A  ++GL+ + +INE TA+A+ YG+
Sbjct: 153 YYTAEQRRLMYQAAEVAGLHCMSLINETTASAVDYGI 189


>UniRef50_A5MZQ6 Cluster: DnaK8; n=2; Clostridium kluyveri DSM
           555|Rep: DnaK8 - Clostridium kluyveri DSM 555
          Length = 530

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 23/53 (43%), Positives = 37/53 (69%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A F D+ ++AT +A  I+GL VL ++ EP AAAI YG +   + ++N+L++DL
Sbjct: 131 ANFTDNAKRATMEAAEIAGLEVLYLLEEPVAAAIRYGFN--SSKDQNILVYDL 181



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI-GDAAKNQ 245
           +GIDLGT+ S   V+  GK  II  D G    PS V+F D+E +I G  AK +
Sbjct: 12  LGIDLGTSTSIASVYTKGKSRIIKID-GKEYIPSVVSFLDSETIIVGSQAKGR 63


>UniRef50_O46067 Cluster: CG2918-PA; n=3; Diptera|Rep: CG2918-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 923

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 50/221 (22%), Positives = 91/221 (41%), Gaps = 7/221 (3%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           A  + +DLG+ +  VGV   G  +EI  N +  R TP+ +AF D  R IG+ A+      
Sbjct: 20  AAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKD 79

Query: 258 PTTQ--YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
           P +   Y +  +   + + ++          + +   E N       +  T  FS  + V
Sbjct: 80  PNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVV--FRKSDTDEFSVEELV 137

Query: 432 PWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         +     EC      YF  ++R+A   A  ++ L VL++IN+  A A
Sbjct: 138 AQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVA 197

Query: 609 IAYGLDKKGTGERNV---LIFDLAAVPSTCPSLPSRMVSSR 722
           + YG+  +G         L +D+ A  ++   +  ++V  +
Sbjct: 198 LNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDK 238


>UniRef50_Q7QPM2 Cluster: GLP_54_20127_18205; n=2; Giardia
           intestinalis|Rep: GLP_54_20127_18205 - Giardia lamblia
           ATCC 50803
          Length = 640

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 22/51 (43%), Positives = 35/51 (68%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIF 662
           AYFN+ QR+AT+ AG ++ L+V+R+++EPTAAA+ Y  +      +   IF
Sbjct: 156 AYFNNDQRRATELAGQLANLDVIRVLSEPTAAALLYNYNSSSNKIKENEIF 206



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 25/72 (34%), Positives = 37/72 (51%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           NTI  +KRLIGR+F DA V+   KH  +++V  G   +  +      K+  P EV S +L
Sbjct: 71  NTINASKRLIGRRFTDAEVKRAAKHVSYDIV-QGPNGEAMINVPNLHKSVSPIEVGSEIL 129

Query: 443 TKMKETAEAYLG 478
             +K   +   G
Sbjct: 130 KYIKSQVQQRSG 141



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 4/56 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER----LIGDAAKNQ 245
           +G DLGTT SCV     G   ++    G+RT PS V +   E     L+G  A+ Q
Sbjct: 9   LGFDLGTTNSCVSTMVSGVPTVLPMLDGSRTVPSVVGYLPLEARDTPLVGAEAERQ 64


>UniRef50_UPI00005A2730 Cluster: PREDICTED: similar to heat shock
           protein 8; n=2; Canis lupus familiaris|Rep: PREDICTED:
           similar to heat shock protein 8 - Canis familiaris
          Length = 476

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/25 (88%), Positives = 24/25 (96%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+ TIE+GIFEVKSTAGDT
Sbjct: 177 GGTFDVSVPTIENGIFEVKSTAGDT 201



 Score = 33.1 bits (72), Expect = 7.4
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +2

Query: 272 FDAKRLIGRKFEDATVQADMKHWPFEVVSDGGK 370
           F  K LIG++F  A V+ DMKH PF V ++  K
Sbjct: 130 FLMKCLIGQRFNYAVVKFDMKHRPFLVANEADK 162


>UniRef50_A6NYB9 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 437

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/53 (49%), Positives = 36/53 (67%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF+D+QRQAT  A  ++GL+V+ +INEPTAAAI     ++       L+FDL
Sbjct: 93  AYFSDNQRQATIKAAQLAGLDVVGLINEPTAAAIYASKSRQALS----LVFDL 141


>UniRef50_Q0WM51 Cluster: HSP like protein; n=11; Magnoliophyta|Rep:
           HSP like protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 701

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-GTGERNVLIFDLAA 674
           YF  ++R+    A  ++G+NVL ++NE + AA+ YG+DK    G R+V+ +D+ +
Sbjct: 6   YFGQAERRGLIQASQLAGVNVLSLVNEHSGAALQYGIDKDFANGSRHVIFYDMGS 60


>UniRef50_O23508 Cluster: Growth regulator like protein; n=6;
           Magnoliophyta|Rep: Growth regulator like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 912

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-GTGERNVLIFDLAA 674
           YF  ++R+    A  ++G+NVL ++NE + AA+ YG+DK    G R+V+ +D+ +
Sbjct: 600 YFGQAERRGLIQASQLAGVNVLSLVNEHSGAALQYGIDKDFANGSRHVIFYDMGS 654



 Score = 36.3 bits (80), Expect = 0.80
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 4/71 (5%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGV--FQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           +++  + +DLG+ +  V V   + G+  + +  N+   R +P+ VAF   +RL+G+ A  
Sbjct: 450 SESAVLSVDLGSEWVKVAVVNLKRGQSPISVAINEMSKRKSPALVAFQSGDRLLGEEAAG 509

Query: 243 QVAMTPTTQYS 275
             A  P   YS
Sbjct: 510 ITARYPNKVYS 520


>UniRef50_Q655N4 Cluster: Putative heat-shock protein; n=2; Oryza
           sativa|Rep: Putative heat-shock protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 753

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 52/194 (26%), Positives = 82/194 (42%), Gaps = 10/194 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D+G         +   ++++ N + NR +P+ VAF+   RL+G  A    A +    
Sbjct: 4   VGFDVGNDTLVAAAARQRGIDVLLNAESNRESPAAVAFSHNARLLGPHAAG-AASSHAPF 62

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSV-MEAN--------LRSR*HIRVKTKPFSPR 422
            S+  +        LL  P     LSRL   +EA+        L    HI  +    SP 
Sbjct: 63  SSIKRLLLLAGRPTLL--PRRGGDLSRLPFPVEASSADGGGGVLVHVDHIGRRIA-LSPT 119

Query: 423 KSVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPT 599
           + +              L A  ++C      YF  +QRQA  DA  ++GL  LR++++  
Sbjct: 120 QLLAMLLGYLRQLAEADLEAPVSDCVISVPCYFTQAQRQAYLDAAAVAGLRPLRLMHDLA 179

Query: 600 AAAIAYGLDKKGTG 641
           A A+ YGL +   G
Sbjct: 180 ATALGYGLYRSDLG 193


>UniRef50_Q9XZM1 Cluster: Heat shock protein HSP70-2; n=3; Entamoeba
           histolytica|Rep: Heat shock protein HSP70-2 - Entamoeba
           histolytica
          Length = 244

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/35 (62%), Positives = 27/35 (77%)
 Frame = +3

Query: 564 GLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           GL V+ IINEPTAAAIAYG DKK    + +L+FD+
Sbjct: 1   GLEVIGIINEPTAAAIAYGYDKKYCEGKTILVFDI 35


>UniRef50_A2DWC1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 649

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVS 430
           +P    +D+KR+IG+ ++D  V      WPF V S     P+I VA  G++++  P +VS
Sbjct: 64  EPTAVAYDSKRMIGQSYDD--VMKQKFEWPFRVESSSENDPEIVVACNGKEESVSPVQVS 121

Query: 431 SMVLTKMKETAEAYLG 478
           + +L  +K   E  +G
Sbjct: 122 AEILKYIKSKVEVKVG 137



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           +GIDLGTT+S   ++       E+I  D G +  PS VAF  +  ++G+ AK Q+ + PT
Sbjct: 8   LGIDLGTTFSSAAIYNPDTKTTEVIEID-GKKELPSMVAFNVSPHVVGEPAKGQLLIEPT 66



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNV--LRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           F+ +QR+ TK+A  ++G N+  L ++ EPTAAAI Y          ++LI+D
Sbjct: 151 FSTNQRKTTKEAAELAGFNINKLALLAEPTAAAIKYAYSADPNQRHHILIYD 202



 Score = 36.7 bits (81), Expect = 0.60
 Identities = 15/25 (60%), Positives = 20/25 (80%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+S+ TI++   EVKST GD+
Sbjct: 205 GGTFDISLATIDNKTVEVKSTGGDS 229


>UniRef50_A2DJE0 Cluster: DnaK protein; n=2; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 876

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/72 (29%), Positives = 43/72 (59%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 430
           D   N ++D+KR++G+ ++   ++ D+ +W F+V+    KP IK+     D+  FP +VS
Sbjct: 68  DKIKNVVYDSKRMLGKSYDQ--IKEDIPNWTFDVIEKDSKPVIKL---DGDREIFPYQVS 122

Query: 431 SMVLTKMKETAE 466
           + +L  +++  E
Sbjct: 123 ATILDYLRQQLE 134



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +3

Query: 63  KYKMAKAPA-VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           K K  + P  +GIDLGTTY  V  +++ K+E I    G  T PS V + +    +G  A+
Sbjct: 4   KEKPQQPPVYIGIDLGTTYCSVAKYENNKLETI-EFNGTSTIPSRVYYGEFNS-VGYQAQ 61

Query: 240 NQV 248
            Q+
Sbjct: 62  QQM 64


>UniRef50_Q2H062 Cluster: Putative uncharacterized protein; n=2;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Chaetomium globosum (Soil fungus)
          Length = 763

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/39 (53%), Positives = 30/39 (76%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK 629
           +F D+QR+A  DA  I+GL +LR+IN+ TAAA+ YG+ K
Sbjct: 146 WFTDAQRRAIIDAAEIAGLRLLRLINDTTAAALGYGITK 184



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D G+  + V V ++  V++I N+  NR TPS V F    R +G++AK Q
Sbjct: 4   VGVDFGSLNTVVAVARNRGVDVITNEVSNRATPSLVGFGPKSRYLGESAKTQ 55



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           NT+   KRLIGR  +D  VQ + K+   ++V   G+   +V Y G+ + F   ++++M  
Sbjct: 62  NTVGSLKRLIGRSLKDPDVQIEQKYVSAQLVEINGQVGAEVQYLGQKEQFTATQLAAMFF 121

Query: 443 TKMKETAEA 469
           +K+++T  A
Sbjct: 122 SKIRQTTAA 130


>UniRef50_UPI0000660D8E Cluster: Homolog of Homo sapiens "heat shock
           70kDa protein 2 (HSPA2), mRNA; n=1; Takifugu
           rubripes|Rep: Homolog of Homo sapiens "heat shock 70kDa
           protein 2 (HSPA2), mRNA - Takifugu rubripes
          Length = 180

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/53 (45%), Positives = 34/53 (64%)
 Frame = -3

Query: 668 EVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEVR 510
           +VKD+ + FS    V+TV    S R +DD ++VQ+ D   +F  LSLRV+EVR
Sbjct: 7   QVKDQDVVFSRLTIVQTVRKGCSRRLVDDPQDVQSGDDAGVFGRLSLRVVEVR 59



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 19/74 (25%), Positives = 40/74 (54%)
 Frame = -1

Query: 475 KISFGSFLHFRKHHGTDFLGEKGFVFTLICYLDLRFASITDNLERPVLHVGLHSSIFELT 296
           ++     LH  ++H  + L  +    + + +LD    SI+++LE PV +V L+  I + +
Sbjct: 72  EVGLCDLLHLHQNHRGNLLRVEALFLSFVFHLDFGLPSISNHLEWPVFYVSLNGGILQSS 131

Query: 295 SDETFGIEYCVVGV 254
            +++  I++ V GV
Sbjct: 132 PNQSLSIKHGVAGV 145



 Score = 37.5 bits (83), Expect = 0.34
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = -3

Query: 248 HLVLGGISDETLGVCERNIRRSGPVALVVGDD 153
           HLVL  + DE L V E +I   GPVALVVG+D
Sbjct: 148 HLVLCRVPDEPLRVSEGHIAGGGPVALVVGND 179


>UniRef50_A4FEB4 Cluster: Heat shock protein HSP70; n=2;
           Actinomycetales|Rep: Heat shock protein HSP70 -
           Saccharopolyspora erythraea (strain NRRL 23338)
          Length = 555

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/53 (45%), Positives = 35/53 (66%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYF   +R ATK+AG I+GL+V+ I+ EP AAA+ Y        +R +L++DL
Sbjct: 125 AYFGMLERTATKNAGQIAGLDVIGIVPEPVAAALHYEATTDAE-DRTILVYDL 176



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 93  GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMTPTT 266
           GIDLGTTYS +  V + G+  +  N     TTPS V F  ++  ++G  AKN     P  
Sbjct: 10  GIDLGTTYSAIAYVDETGRPAVCRNTDSLETTPSVVFFENESNVVVGSVAKNSAITYPDQ 69

Query: 267 QYSM 278
             S+
Sbjct: 70  VVSL 73


>UniRef50_Q22758 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 925

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/78 (30%), Positives = 48/78 (61%), Gaps = 3/78 (3%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLAAVPS 683
           YF  ++R A + A  ++GL VL++IN+ TAAA+++G+  +K  GE+   ++++D+ A  +
Sbjct: 171 YFTPAERLAVERAAQMAGLTVLQLINDGTAAALSHGIFRRKEIGEKPQRLMVYDMGAAKT 230

Query: 684 TCPSLPSRMVSSR*NPPP 737
           T   +  ++V  +    P
Sbjct: 231 TATIVEFKLVKEKYEKQP 248



 Score = 36.7 bits (81), Expect = 0.60
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           A+ IDLGT +  +G+ + G  ++I  N +  R TP+ V   D  R   DAA
Sbjct: 26  AMTIDLGTQFLKIGIVKPGIPMDIALNTESRRKTPNVVMIQDGHRTFADAA 76


>UniRef50_A4FEA6 Cluster: 70 kD heat shock protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: 70 kD heat
           shock protein - Saccharopolyspora erythraea (strain NRRL
           23338)
          Length = 538

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 30/66 (45%), Positives = 36/66 (54%), Gaps = 3/66 (4%)
 Frame = +3

Query: 72  MAKAPAV-GIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKN 242
           MA  P   GIDLGTT+SCV  V + G+  I  N     TTPS V F    R L+G +AKN
Sbjct: 1   MAAPPTTFGIDLGTTHSCVAYVDESGRPVIARNAVSEDTTPSVVYFEGPGRVLVGSSAKN 60

Query: 243 QVAMTP 260
              + P
Sbjct: 61  SALLAP 66



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/54 (44%), Positives = 39/54 (72%), Gaps = 1/54 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY-GLDKKGTGERNVLIFDL 668
           AYF  ++++AT+ AG I+GLNVL ++ EP AAA+ + GL+      R++L++DL
Sbjct: 125 AYFGVAEKEATRRAGEIAGLNVLDVLAEPVAAALHHQGLESTDRA-RHLLVYDL 177


>UniRef50_UPI0000498B17 Cluster: hsp70 family protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: hsp70 family
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 543

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 49/183 (26%), Positives = 83/183 (45%), Gaps = 7/183 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD---AAKN---QVA 251
           VGIDLGTT+S      +G+  I  ++    +  S VAFT ++ L+G    + KN   +V 
Sbjct: 10  VGIDLGTTFSSACEIINGRPFIYKSEFERDSIRSCVAFTGSQCLVGTNDKSGKNTIFEVK 69

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
                + S  ++ +    K LL          R+ V E    ++  ++ +     P +  
Sbjct: 70  RLIGKRMSSQDIKAKEFQKHLLNNIIPLRD-DRIGV-EIERPTKTRVKKQVIRLLPEQVS 127

Query: 432 PWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                        +  N    +  G  A F D +R+AT+ A  ++G+  +R++NEPTAAA
Sbjct: 128 ALILLKIKDIILKVHPNVTIKAVVGVPAAFGDEERKATEQAIKMAGIEPIRMVNEPTAAA 187

Query: 609 IAY 617
           +AY
Sbjct: 188 MAY 190


>UniRef50_UPI0000F1F58C Cluster: PREDICTED: similar to Heat shock
           protein 4, partial; n=1; Danio rerio|Rep: PREDICTED:
           similar to Heat shock protein 4, partial - Danio rerio
          Length = 298

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 19/40 (47%), Positives = 31/40 (77%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+
Sbjct: 4   FYTDAERRSVIDAAQIAGLNCLRLMNETTAVALAYGIYKQ 43


>UniRef50_Q22515 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 921

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 25/73 (34%), Positives = 48/73 (65%), Gaps = 3/73 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-DKKGTGER--NVLIFDLAAVPS 683
           + N ++R+A   A  I+GLN+L+++N+ +AAA+ YG+  +K   E+  ++LI+D+ AV +
Sbjct: 171 FLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMGAVKT 230

Query: 684 TCPSLPSRMVSSR 722
           T   +   + S+R
Sbjct: 231 TATIVQYVLESTR 243


>UniRef50_UPI0000498BE2 Cluster: chaperone protein dnaK; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: chaperone protein
           dnaK - Entamoeba histolytica HM-1:IMSS
          Length = 697

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 26/65 (40%), Positives = 32/65 (49%)
 Frame = +3

Query: 480 NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLI 659
           N  +C     A FND QR  TK A   + L V+ I+NEPTAAA      +       +LI
Sbjct: 134 NNIKCILTVPAQFNDEQRNQTKKAALSANLEVIDILNEPTAAAYYCSKTQNYNDGDKILI 193

Query: 660 FDLAA 674
           FD  A
Sbjct: 194 FDFGA 198



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 19/68 (27%), Positives = 38/68 (55%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 430
           D+    I + KRLIG  F+ + VQ + +   +E+V D      ++ Y  ++ T  P EV+
Sbjct: 58  DNETQKISNTKRLIGCSFKPSLVQQEKRMINYEIVKDPENRLCRIKY-DKEHTISPTEVA 116

Query: 431 SMVLTKMK 454
           S++ ++++
Sbjct: 117 SILYSRVR 124


>UniRef50_UPI0000498597 Cluster: chaperone protein dnaK; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: chaperone protein
           dnaK - Entamoeba histolytica HM-1:IMSS
          Length = 523

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/40 (52%), Positives = 29/40 (72%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK 629
           A F D Q+ AT  A  + GL+V++I+ EPTAAA AYG+D+
Sbjct: 144 ATFTDQQKDATLCAAQLGGLDVIQILPEPTAAAYAYGVDQ 183


>UniRef50_Q3UYY6 Cluster: 13 days embryo forelimb cDNA, RIKEN
           full-length enriched library, clone:5930424B19
           product:hypothetical protein, full insert sequence; n=3;
           Murinae|Rep: 13 days embryo forelimb cDNA, RIKEN
           full-length enriched library, clone:5930424B19
           product:hypothetical protein, full insert sequence - Mus
           musculus (Mouse)
          Length = 101

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/25 (84%), Positives = 23/25 (92%)
 Frame = -2

Query: 744 VSPAVDFTSKIPSSMVRMDTSKVPP 670
           VSPAV FTSK+PSS+VRMDTS VPP
Sbjct: 66  VSPAVAFTSKMPSSIVRMDTSNVPP 90


>UniRef50_Q2QXK2 Cluster: DnaK protein, expressed; n=2; Oryza
           sativa|Rep: DnaK protein, expressed - Oryza sativa
           subsp. japonica (Rice)
          Length = 461

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 19/37 (51%), Positives = 29/37 (78%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
           YF+D  R+A  +A  ++GL  +RII+EPTAAA+++GL
Sbjct: 187 YFSDGPREAAMNAARMAGLTTVRIIDEPTAAAVSHGL 223



 Score = 36.7 bits (81), Expect = 0.60
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 2/67 (2%)
 Frame = +2

Query: 281 KRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV--AYKGEDKTFFPEEVSSMVLTKMK 454
           KRL+G +F    V+   +H P+++V       I+V     G  ++ +  +V+SMV+ ++K
Sbjct: 104 KRLLGTRFGSPEVRRAAEHLPYKIVDWCTMAHIEVNAGAGGAARSVYASDVASMVIAELK 163

Query: 455 ETAEAYL 475
             AEA L
Sbjct: 164 ARAEARL 170



 Score = 33.1 bits (72), Expect = 7.4
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA 251
           + +DLG T SCV  +     E  A        P+ VAFT D + L+G+AAKN  A
Sbjct: 47  IAVDLGNTNSCVAGYGD---EADAPPLFRLCIPTSVAFTGDGDALVGEAAKNHPA 98


>UniRef50_Q4RRT3 Cluster: Chromosome 16 SCAF15002, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 16 SCAF15002, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 52

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/26 (80%), Positives = 21/26 (80%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIA 161
           P V I LGTTYSCVGVFQ GKVEI A
Sbjct: 1   PVVAIGLGTTYSCVGVFQRGKVEIRA 26


>UniRef50_Q7YUE0 Cluster: Hsp70 protein; n=1; Milnesium
           tardigradum|Rep: Hsp70 protein - Milnesium tardigradum
          Length = 203

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/25 (80%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILT+EDGIFEVK+  GD+
Sbjct: 37  GGTFDVSILTMEDGIFEVKAVNGDS 61


>UniRef50_A2FKE2 Cluster: DnaK protein; n=3; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 573

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSM 436
           N  I+D KR +G+ + D  +Q D K WPF++ +D  G  +  ++  G+     PE ++++
Sbjct: 49  NQVIYDTKRALGKMYNDPVIQDDKKSWPFQISADENGYVQYDISDDGKTIHKTPESIAAL 108

Query: 437 VL 442
           +L
Sbjct: 109 LL 110



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           F+  Q++  + A   +G+ V+  + E +AAAIAYGL      E+ +LIFD
Sbjct: 136 FSRIQKEKIQIAAKAAGIQVVSFLPESSAAAIAYGL--LNNTEQKLLIFD 183


>UniRef50_UPI0000499DD6 Cluster: heat shock protein 70; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: heat shock protein
           70 - Entamoeba histolytica HM-1:IMSS
          Length = 605

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/43 (53%), Positives = 29/43 (67%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT 638
           A F+  QR AT  A  I+G+ V+ ++NEPTAAAIAY  DK  T
Sbjct: 152 ANFSSEQRDATAAAAEIAGIEVIELVNEPTAAAIAY--DKSQT 192



 Score = 36.7 bits (81), Expect = 0.60
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSI+T+ D  F V +T GDT
Sbjct: 206 GGTFDVSIVTVSDKEFTVNATDGDT 230



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 20/67 (29%), Positives = 36/67 (53%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           N I++AKR IGR+ +   ++ D K    ++  + G+   ++    + K   P EVSS +L
Sbjct: 66  NIIYEAKRFIGRRVKPNEIEND-KSLLNKISVEDGELFYEIEQDNQIKKVSPVEVSSQIL 124

Query: 443 TKMKETA 463
             +K+ A
Sbjct: 125 LYLKQQA 131


>UniRef50_A6GJQ9 Cluster: Heat shock protein Hsp70; n=1;
           Plesiocystis pacifica SIR-1|Rep: Heat shock protein
           Hsp70 - Plesiocystis pacifica SIR-1
          Length = 826

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQV 248
           M KA  VG DLGTT S   VF   +  ++ N QG+  TPS V     ER+ +G  A+  +
Sbjct: 1   MEKALYVGFDLGTTNSAAAVFDGEQTRVVRNSQGSTLTPSVVRIDGRERVTVGAKARRFL 60

Query: 249 AMTP 260
              P
Sbjct: 61  ERDP 64


>UniRef50_A0NUH2 Cluster: Putative uncharacterized protein; n=1;
           Stappia aggregata IAM 12614|Rep: Putative
           uncharacterized protein - Stappia aggregata IAM 12614
          Length = 98

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 2/66 (3%)
 Frame = -1

Query: 265 VVGVIATWFLAASPMRRSVSVN-AT*DGVVLLPWSLAM-ISTFPCWKTPTQEYVVPRSIP 92
           +VG +  W LA  P RRS S   AT DGVV  P + ++ + + P   T T E+VVPRSIP
Sbjct: 2   LVGFVTAWRLAGWPTRRSPSSEKATIDGVVRAPSAFSITLESLPSM-TATHEFVVPRSIP 60

Query: 91  TAGAFA 74
              A +
Sbjct: 61  MTFAIS 66


>UniRef50_Q9GYV8 Cluster: 70-kDa heat shock protein; n=5; Entamoeba
           histolytica|Rep: 70-kDa heat shock protein - Entamoeba
           histolytica
          Length = 558

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 5/80 (6%)
 Frame = +2

Query: 251 DDPNN--TIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT---FF 415
           ++ NN   I+D+KR+IGR   D   + D  +WPFEV S          Y  + ++   F 
Sbjct: 66  NEANNECVIYDSKRIIGRGECDVNYE-DRDNWPFEVKSRNNGSAYIECYNPQTQSAEEFE 124

Query: 416 PEEVSSMVLTKMKETAEAYL 475
           PEE+S M+L  M + A+A L
Sbjct: 125 PEEISGMILKHMYDIAQASL 144



 Score = 37.5 bits (83), Expect = 0.34
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 6/59 (10%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTER----LIGDAAKNQ 245
           ++GIDLGTTYS +  +    G+  I+ ++ G     S+V+ +  ++    +IG++AKN+
Sbjct: 9   SIGIDLGTTYSSIAYYDITRGESVIVQDELGKEQVASWVSLSRLDKSGYTIIGNSAKNE 67



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
           FND QR AT  A  ++ +  + ++NEPTAA + Y
Sbjct: 160 FNDRQRDATLLACKLAEIKNVELVNEPTAAIVEY 193


>UniRef50_A2F7Z8 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 707

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 38/184 (20%), Positives = 75/184 (40%), Gaps = 4/184 (2%)
 Frame = +3

Query: 93  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM----TP 260
           G+D G  Y  VG+ Q   + ++ +   NR  P+   +++  R+ G  A+ ++      T 
Sbjct: 6   GLDFGNKYCVVGIPQSRSISVLLDQASNRLIPTMAGYSEKRRVFGTLAQQEILQNLEGTI 65

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWC 440
           T    +  +  D   +  + K   +  L +L+     ++           F P + + + 
Sbjct: 66  TQLKRLVCLKYDSEERKSIEKMV-NFELVKLNDGFTGIKLS---NNDNHVFLPAQIIAYL 121

Query: 441 XXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 620
                          A  S   S ++  + RQ   DA  I+ +N++ +IN  TAAA+ Y 
Sbjct: 122 LKSLMKITQSSQQAVAAFSIAVSPWWTQAHRQTIIDACKIAKINLITLINSTTAAAVGYA 181

Query: 621 LDKK 632
           +D +
Sbjct: 182 MDHR 185


>UniRef50_UPI0000D55C7E Cluster: PREDICTED: similar to CG2918-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG2918-PA - Tribolium castaneum
          Length = 872

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/81 (30%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK-KGTGE--RNVLI 659
           EC      YFN  +R++   A  ++GL VL++IN+ TA A+ YG+ + K   E  + V+ 
Sbjct: 159 ECVLTVPGYFNQIERKSLLQAANLAGLKVLQLINDYTAVALNYGIFRSKDFNETAQYVMF 218

Query: 660 FDLAAVPSTCPSLPSRMVSSR 722
           +D+ A  +T   +  + V ++
Sbjct: 219 YDMGATSTTATLVSYQTVKTK 239



 Score = 33.1 bits (72), Expect = 7.4
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPF-EVVSDGGKPKIKVAYKGEDKTFF-PEEVS 430
           P N       L+G+      V+   + +P+ E+V D  +  I   +K +D  F+ PEE+ 
Sbjct: 81  PKNAYMYLLDLLGKSINHPLVKLYKERFPYYEIVEDPERNTI--LFKHDDNVFYSPEELI 138

Query: 431 SMVLTKMKETAE 466
           + +L K KE AE
Sbjct: 139 AQLLGKAKEFAE 150


>UniRef50_A2G8T1 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 591

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/55 (43%), Positives = 34/55 (61%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLAA 674
           A F+ +QR+ T  A   SG+  L++INEPTAAA +Y   +  T  + +LIFD  A
Sbjct: 157 AKFDSNQRRDTISAIEKSGIKCLKLINEPTAAAFSY-FSEHQTNNQKILIFDYGA 210


>UniRef50_A2EFJ4 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 719

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMV 439
           N I + KR+IG+K  D  +Q  +  W F++V D  G    KV  K ++    PE+ ++++
Sbjct: 69  NCIHNIKRIIGKKLNDPDIQKHINKWDFKLVEDNKGMAAFKVVSKNKEIIVTPEQAATLI 128

Query: 440 LTKM 451
             K+
Sbjct: 129 FKKL 132



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           FN  Q +  K A   +G++++  I EPTAAAI+ G+      ++ ++IFD
Sbjct: 157 FNVEQCERIKLAARAAGIDIIATIYEPTAAAISSGM--MAATDKKLMIFD 204


>UniRef50_A2DZ76 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 641

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSS 433
           P N++ + KR+IG++ +D  +Q    +W F +V D  G    +V   G+     PEE +S
Sbjct: 64  PGNSLHNIKRIIGKRLDDPDIQRRKDNWDFTLVKDERGMAAFQVNDNGKKVIVKPEEAAS 123

Query: 434 MVLTKM 451
            + TK+
Sbjct: 124 KIFTKL 129



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           FN  Q +  K A  ++GL+++  I EPTAAAI+ G+      ++ ++IFD
Sbjct: 154 FNVEQCERIKTAAKVAGLDIIATIYEPTAAAISSGM--MTDKDKKLMIFD 201



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQH-GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           MAK   V ID GTT SC+ +  H G+  +     GN   P+ + F D    I     + +
Sbjct: 1   MAKKSGVAIDFGTTNSCIAIALHTGQDTMPILIDGNNYVPTNLTFVDEGPPIACFDTSSL 60

Query: 249 AMTPTTQYSMPNVSSDVSSKM 311
             TP    S+ N+   +  ++
Sbjct: 61  VYTPGN--SLHNIKRIIGKRL 79


>UniRef50_A2R006 Cluster: Contig An12c0210, complete genome; n=1;
           Aspergillus niger|Rep: Contig An12c0210, complete genome
           - Aspergillus niger
          Length = 513

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/52 (42%), Positives = 32/52 (61%)
 Frame = +3

Query: 519 NDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLAA 674
           +D++R  T+DAG   GL V R++N PTAAAIA   D   +    +L+ D+ A
Sbjct: 100 HDAERAETRDAGHQVGLKVHRLLNTPTAAAIAQWTDSPTSDAHLMLVLDIGA 151



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTP-SYVAFTDTERLIGDAAKNQV 248
           A+GIDLG +Y  + V Q GKV +I + QG +  P SY+  T     +G A +++V
Sbjct: 4   AIGIDLGISYVSIAVAQDGKVHVIPDTQGRQRIPSSYLLRTSVAPSVGPAIRDRV 58


>UniRef50_A5MZQ4 Cluster: DnaK7; n=2; Clostridium kluyveri DSM
           555|Rep: DnaK7 - Clostridium kluyveri DSM 555
          Length = 496

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 3/55 (5%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGERNVLIFDL 668
           YF   Q Q T +A   +GL +L II EP AAA+AYG    +K    E  +LIFDL
Sbjct: 131 YFKAHQFQNTSEAAKEAGLKLLGIIQEPIAAALAYGFHHSNKHLNREEKLLIFDL 185


>UniRef50_Q57VU9 Cluster: Heat shock 70 kDa protein, putative; n=4;
           Trypanosoma|Rep: Heat shock 70 kDa protein, putative -
           Trypanosoma brucei
          Length = 870

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 43/186 (23%), Positives = 78/186 (41%), Gaps = 10/186 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQH--GKVEIIANDQGNRTTPSYVAFTDTE--RLIGDAAKNQVAMT 257
           +GIDLGTT SC+        + +II +  G+   P+ + F  +   RL G+ A+  V  +
Sbjct: 71  IGIDLGTTNSCISYIDKKTNRPKIIPSPTGSWVFPTAITFDKSHKVRLYGEEARACVRTS 130

Query: 258 PTTQYSMPNVSSDVSSKMLLCKPT*STG-----LSRLSVMEANLRSR*HIRVKTKPFSPR 422
            +            S K L+ +     G     L + +++  N R    + +  + ++  
Sbjct: 131 ASATLC--------SGKRLIGRGVGELGRVQSQLHKTNMVTLNERGEVAVEIMGRTYTVT 182

Query: 423 KSVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPT 599
             +              L            A+F   Q+ AT+DA   +G +VL +I+EP+
Sbjct: 183 HIIAMFLRYLKKEAEKFLKEPVNAVVVSVPAFFTPQQKVATEDAALAAGFDVLEVIDEPS 242

Query: 600 AAAIAY 617
           AA +A+
Sbjct: 243 AACLAH 248


>UniRef50_A0C553 Cluster: Chromosome undetermined scaffold_15, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_15,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 898

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/53 (39%), Positives = 33/53 (62%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLAA 674
           +N SQR A K A  ++ L VL IINE TAAA+ Y L+++   +   L +++ +
Sbjct: 171 WNISQRSALKSAAQLAELEVLGIINENTAAALYYALERQDENKHTALFYNIGS 223


>UniRef50_A5N5I8 Cluster: DnaK4; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK4 - Clostridium kluyveri DSM 555
          Length = 604

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG--LDKKGTGERNVLIFD 665
           YF D Q    K+   ++G+ ++  I EP AAA+AYG  L      E N+L+FD
Sbjct: 129 YFQDEQCNIIKEGAKLAGIELIGTIQEPVAAALAYGMYLPLNKKREENILVFD 181



 Score = 35.9 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           P +GID GTTYS V  +   K EI     G    PS V F   +  +G+ A
Sbjct: 9   PVIGIDFGTTYSSVSKWDGKKAEIYGK-MGEYAIPSVVYFKQGKFDVGNGA 58


>UniRef50_A1FNI8 Cluster: Glutamate dehydrogenase; n=1; Pseudomonas
           putida W619|Rep: Glutamate dehydrogenase - Pseudomonas
           putida W619
          Length = 710

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/38 (52%), Positives = 26/38 (68%)
 Frame = -3

Query: 626 VKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEV 513
           V  +  RSS RF+DD+  VQ RD T +F GL+L V+EV
Sbjct: 523 VHAIGQRSSGRFVDDAFYVQTRDATGVFGGLTLAVVEV 560



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 29/76 (38%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = -1

Query: 478 AKISFGSFLHFRKHHGTDFLGEKGFVFTLICYLDLRFASIT-DNLERPVLHVGLHSSIFE 302
           A+I FG  LH  ++ G D L  + F   L   LD     ++ D+L R  L V LH   FE
Sbjct: 573 AEIVFGGLLHLFQNFGAD-LWRRHF---LAGSLDPGVTVVSLDDLVRHQLDVFLHDIFFE 628

Query: 301 LTSDETFGIEYCVVGV 254
             +DE    E CVV V
Sbjct: 629 AAADEALHCEQCVVRV 644


>UniRef50_Q9S8V5 Cluster: ATP-binding HSP70 homolog; n=4; cellular
           organisms|Rep: ATP-binding HSP70 homolog - Zea mays
           (Maize)
          Length = 33

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 18/23 (78%), Positives = 21/23 (91%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEII 158
           +GIDLGTTYSCVG++QH  VEII
Sbjct: 11  IGIDLGTTYSCVGLWQHDXVEII 33


>UniRef50_A2XF45 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 59

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 17/21 (80%), Positives = 20/21 (95%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQH 140
           + PA+GIDLGTTYSCVGV+QH
Sbjct: 7   EGPAIGIDLGTTYSCVGVWQH 27


>UniRef50_Q8RH06 Cluster: Putative uncharacterized protein FN0115;
           n=2; Bacteria|Rep: Putative uncharacterized protein
           FN0115 - Fusobacterium nucleatum subsp. nucleatum
          Length = 98

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 26/58 (44%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -1

Query: 262 VGVIATWFLAASPMRRS-VSVNAT*DGVVLLPWSLAMISTFPCWKTPTQEYVVPRSIP 92
           VG +     A SP   S +S+  T DGVVL P    +I   P   T TQE+VVP+SIP
Sbjct: 8   VGFVTACLFAISPTTTSPLSLIFTTDGVVLAPSEFGIIVALPPSITATQEFVVPKSIP 65


>UniRef50_Q4ETY1 Cluster: Putative uncharacterized protein; n=2;
           Listeria monocytogenes|Rep: Putative uncharacterized
           protein - Listeria monocytogenes str. 1/2a F6854
          Length = 79

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 25/62 (40%), Positives = 33/62 (53%)
 Frame = -1

Query: 277 IEYCVVGVIATWFLAASPMRRSVSVNAT*DGVVLLPWSLAMISTFPCWKTPTQEYVVPRS 98
           +E  V G++     A SP  RS  +  T +GVV  P  L +I   P   T T E+VVP+S
Sbjct: 1   MELIVFGLVIAARFATSPTWRSPFLKPTTEGVVRAPSGLGIILASPPSNTATAEFVVPKS 60

Query: 97  IP 92
           IP
Sbjct: 61  IP 62


>UniRef50_A6EMR6 Cluster: Heat shock protein Hsp70; n=1;
           unidentified eubacterium SCB49|Rep: Heat shock protein
           Hsp70 - unidentified eubacterium SCB49
          Length = 847

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 52/192 (27%), Positives = 79/192 (41%), Gaps = 1/192 (0%)
 Frame = +3

Query: 93  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMTPTTQ 269
           GIDLGTT S +   ++G  E I       T PS V     + + +GDAA N  A+     
Sbjct: 9   GIDLGTTNSAISKMENGNPESIRTQTLKDTMPSCVYINRKKAIQVGDAAYN--ALKDEKL 66

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXXX 449
            +M N  S   +  +  K T   G   +       RS   I +  +     KS       
Sbjct: 67  KAMKNWDSSKDNSFIEFKRT--MGSDAVYESSNAERSFSSIELSAEVLKTLKSFE----- 119

Query: 450 XXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK 629
                  ++           A F ++Q  AT++AG  +G + + II EP AAA  YG++ 
Sbjct: 120 KDENINAVIITVP-------AAFKNNQIDATREAGREAGFDQVGIITEPEAAAWVYGMNS 172

Query: 630 KGTGERNVLIFD 665
           +   +   L+FD
Sbjct: 173 ENK-DGFWLVFD 183


>UniRef50_A5MZQ3 Cluster: DnaK6; n=1; Clostridium kluyveri DSM
           555|Rep: DnaK6 - Clostridium kluyveri DSM 555
          Length = 490

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 2/54 (3%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG--LDKKGTGERNVLIFDL 668
           +F  ++   T  A  ++GLN++ II EP AAA+AYG  L      + N+L+FDL
Sbjct: 129 HFRANEISNTIKAAKMAGLNLIGIIQEPIAAALAYGLHLSSDALKDENILVFDL 182



 Score = 36.7 bits (81), Expect = 0.60
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = +3

Query: 66  YKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           Y    +P VGIDLGTT+S +  +   K E+ +  +G    PS V    ++ +IG  A  +
Sbjct: 3   YDSVHSPVVGIDLGTTFSSIARWTGTKAEVYSL-KGEYNIPSVVYNDGSQFVIGKIAFMK 61

Query: 246 VAMTP 260
             M P
Sbjct: 62  GIMNP 66


>UniRef50_A4IC10 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania infantum
          Length = 724

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A  +G+DLG+ Y  V    HG   V+I+ N+Q  R T +++ F  ++  IGD AK+  A 
Sbjct: 25  AHVIGVDLGSEYIKVAG-PHGDKGVDIVLNEQSRRKTDNFIGFRRSDLYIGDTAKSLAAR 83

Query: 255 TPTTQYSMPN 284
            P    S  N
Sbjct: 84  FPLCTASAVN 93



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 2/52 (3%)
 Frame = +3

Query: 525 SQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER--NVLIFDLAA 674
           ++R+A  DA  +SGL+VL +++  TAAA  YG+  +G G     V++FDL +
Sbjct: 175 AERRAILDAARLSGLSVLGLMHSTTAAAFYYGVRHRGFGNNTLRVVVFDLGS 226


>UniRef50_Q1D211 Cluster: DnaK family protein; n=1; Myxococcus
           xanthus DK 1622|Rep: DnaK family protein - Myxococcus
           xanthus (strain DK 1622)
          Length = 504

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 25/60 (41%), Positives = 33/60 (55%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           EC     A+ +  QR A + A   +GL V  IINEPTAAA+ Y        E+ V++FDL
Sbjct: 140 ECVLTVPAHASSRQRAAVRHAAEQAGLQVRAIINEPTAAALYYA--NLRNPEQTVMVFDL 197



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +2

Query: 251 DDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV 355
           DDP +T+F AKR +GR+F+   V      + F +V
Sbjct: 63  DDPRHTVFGAKRFLGRRFQSEYVTQHKDKYAFGLV 97


>UniRef50_Q1D082 Cluster: DnaK family protein; n=2;
            Cystobacterineae|Rep: DnaK family protein - Myxococcus
            xanthus (strain DK 1622)
          Length = 1293

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 54/201 (26%), Positives = 83/201 (41%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTT--PSYVAFTDTERLIGDAAKNQVAMTPT 263
            +GIDLGT+++ V V Q G  ++I    G  TT  P+ +A   T    GD      A T  
Sbjct: 775  LGIDLGTSHARVAVVQDGTPKLIPLP-GTTTTDLPALIAVNGT----GDLVVGATAQTEG 829

Query: 264  TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVM-----EANLRSR*HIRVKTKPFSPRKS 428
             +     +S     ++L  KP  S  L  L+ +       +      + V+ +  SP   
Sbjct: 830  QRAPRRAISG--LKRLLGLKPR-SPQLRWLAPLLPFPVTTDTNGDSAVEVRGRVISPILF 886

Query: 429  VPWCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                           L   A         +F D Q  A ++A T++GL+  RI+  P AA
Sbjct: 887  TAMLLRELKHAAATHLGRKATRAVICAPTHFTDRQCAALREAATLAGLDAQRILIAPAAA 946

Query: 606  AIAYGLDKKGTGERNVLIFDL 668
            A+AY    +G   + VL+ DL
Sbjct: 947  ALAYA-HGRGLARKRVLVVDL 966


>UniRef50_Q1E6G2 Cluster: Heat shock protein 70 homolog; n=17;
           Pezizomycotina|Rep: Heat shock protein 70 homolog -
           Coccidioides immitis
          Length = 577

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP- 260
           A+GI  G + S +  +   GK ++IAN++G+R  PS +++ + E   G  AK Q+   P 
Sbjct: 17  AIGISFGNSNSSIAHISPEGKPQVIANEEGDRHIPSVLSYVEGEEYHGAQAKAQLVRNPK 76

Query: 261 -TTQYSMPNVSSDVSS 305
            T  Y    +  D  S
Sbjct: 77  NTIAYFRDYLGKDFKS 92



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 1/65 (1%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY-GLDKKGTGERNVLIFDLAAVPSTCP 692
           F+++QR A K A   +G++V++ ++EP AA +AY  + +    ++ V++ D     S   
Sbjct: 162 FSEAQRTALKVAAKEAGVDVIQFVHEPVAALLAYDAIPEAQVKDKLVVVADFGGTRSDIA 221

Query: 693 SLPSR 707
            + SR
Sbjct: 222 IIASR 226


>UniRef50_A7SM46 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 938

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 4/58 (6%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK----GTGERNVLIFDLAA 674
           +FN ++R+A   A  + GLNVL+I+N  TA A+ YGL ++     T E++ + +D+ A
Sbjct: 173 FFNQAERRALLRAAELVGLNVLQIMNSNTAVALNYGLFQQKSFNDTLEKHFMFYDMGA 230


>UniRef50_A4RY30 Cluster: Heat Shock Protein 70, ER lumen; n=2;
           Ostreococcus|Rep: Heat Shock Protein 70, ER lumen -
           Ostreococcus lucimarinus CCE9901
          Length = 884

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 19/52 (36%), Positives = 36/52 (69%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           + + SQR+A +DA  I+GLNVL + ++ + AA+ +G+DK+    + V++ D+
Sbjct: 146 FASQSQRRALRDAAEIAGLNVLAMKSDLSCAALQWGIDKEFPEPKWVILVDV 197



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           +GIDLG  +    +   G+  + I  N+   R T + V+F + ER IG+ A + +  +PT
Sbjct: 1   MGIDLGGEFLKASLVAPGRTPIAITLNEVSKRKTTAAVSFFNDERAIGEPANDLMPRSPT 60


>UniRef50_Q17291 Cluster: Heat shock protein 70A; n=1;
           Bursaphelenchus xylophilus|Rep: Heat shock protein 70A -
           Bursaphelenchus xylophilus (Pinewood nematode worm)
          Length = 43

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 16/20 (80%), Positives = 19/20 (95%)
 Frame = +2

Query: 296 RKFEDATVQADMKHWPFEVV 355
           RKF++ TVQADMKHWPF+VV
Sbjct: 14  RKFDEPTVQADMKHWPFKVV 33


>UniRef50_Q1VU26 Cluster: Heat shock protein Hsp70; n=2;
           Bacteroidetes|Rep: Heat shock protein Hsp70 -
           Psychroflexus torquis ATCC 700755
          Length = 838

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFD 665
           A F  +Q  AT+ AG ++G   + ++ EP AA++AYGLD  G  +   L+FD
Sbjct: 130 AAFKINQIDATRRAGKLAGFEHIEVLQEPVAASMAYGLD-SGKKDGFWLVFD 180



 Score = 37.1 bits (82), Expect = 0.46
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +3

Query: 93  GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           GIDLGTT S +   + GK  II  ++   T  S VA+     ++GD A
Sbjct: 9   GIDLGTTNSAISRIEKGKATIIQTNKRRDTMASCVAYNKKGVIVGDDA 56



 Score = 32.7 bits (71), Expect = 9.8
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGD 742
           GGTFD +++ +E+GI +V  T GD
Sbjct: 183 GGTFDSALIKVEEGIMKVADTEGD 206


>UniRef50_Q1NQZ1 Cluster: Glutamate dehydrogenase precursor; n=1;
           delta proteobacterium MLMS-1|Rep: Glutamate
           dehydrogenase precursor - delta proteobacterium MLMS-1
          Length = 656

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = -3

Query: 257 GHRHLVLGGISDETLG-VCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDS 93
           GHR L LG +  + LG V + + RR G + L VGD L      D +ARV G+Q++S
Sbjct: 586 GHR-LALGHLPHQPLGGVVKSHHRRGGAITLGVGDHLGFTAFHDRHARVGGSQVNS 640



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = -1

Query: 745 GVAGGGFHLEDTILDGKDGHVEGTAARSK 659
           GVA GG + +D + D +DG++EG+A + K
Sbjct: 426 GVAVGGLYFKDPVADLQDGNIEGSATKVK 454



 Score = 33.5 bits (73), Expect = 5.6
 Identities = 18/52 (34%), Positives = 30/52 (57%)
 Frame = -3

Query: 668 EVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEV 513
           +VKD+ +  +  L V+ +  R     +DD  ++QA D T +  GL+L +IEV
Sbjct: 452 KVKDRDLLLA--LLVQAIGQRGGGGLVDDPLDIQAGDLTGVLGGLALGIIEV 501


>UniRef50_A2UL28 Cluster: Glutamate dehydrogenase; n=5;
           Enterobacteriaceae|Rep: Glutamate dehydrogenase -
           Escherichia coli B
          Length = 678

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = -3

Query: 638 STLFVKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEV 513
           ++ FV+TVS RS  RF+DD+   Q  D  C+F  L+L +++V
Sbjct: 480 ASTFVQTVSQRSCGRFVDDTFYFQTSDTACVFGCLTLSIVKV 521


>UniRef50_A7QHP2 Cluster: Chromosome chr8 scaffold_99, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_99, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 84

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 18/24 (75%), Positives = 22/24 (91%)
 Frame = +2

Query: 410 FFPEEVSSMVLTKMKETAEAYLGK 481
           F PEE+++MVLTKMKE AEA+LGK
Sbjct: 24  FNPEEINAMVLTKMKEIAEAFLGK 47


>UniRef50_A7PR73 Cluster: Chromosome chr14 scaffold_26, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr14 scaffold_26, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 166

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 17/25 (68%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GG FDVS+LTI++G+FEV +T GDT
Sbjct: 117 GGIFDVSVLTIDNGVFEVLATNGDT 141


>UniRef50_Q01M68 Cluster: OSIGBa0114M03.5 protein; n=4; Oryza
           sativa|Rep: OSIGBa0114M03.5 protein - Oryza sativa
           (Rice)
          Length = 581

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 21/67 (31%), Positives = 39/67 (58%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 436
           P++ +F+ K LIG+ F D+ VQ   K  PF ++ +G + +  V   G   +  P E+++ 
Sbjct: 28  PSDVVFNVKNLIGKHFNDSCVQEMRKRLPFSII-EGPEGESCVEIHGIKLS--PVEITTA 84

Query: 437 VLTKMKE 457
           + TK+K+
Sbjct: 85  IFTKLKD 91



 Score = 40.3 bits (90), Expect = 0.049
 Identities = 20/55 (36%), Positives = 35/55 (63%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLAA 674
           ++FN+ QR+    AG  +GL +L++I+EP AAA++    K+G     V++F + A
Sbjct: 110 SFFNEQQREDIMSAGRRAGLEILQLIDEPIAAALSSTTIKEGV----VVVFGMGA 160


>UniRef50_A2FVJ6 Cluster: DnaK protein; n=1; Trichomonas vaginalis
           G3|Rep: DnaK protein - Trichomonas vaginalis G3
          Length = 726

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGK-VEIIANDQGNRTTPSYVAF 203
           ++ +  +  DLGTT    GVF+ G+ +EI+ N+Q  R TP+ V+F
Sbjct: 8   LSSSSVIAFDLGTTNMKTGVFRAGRSIEIVLNEQSKRKTPAMVSF 52



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 3/64 (4%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT---GERNVLIFDLAAVPS 683
           +F DSQ++    A  ++GL + +II+E TA ++ Y +DK  T     + V I D  A   
Sbjct: 158 FFTDSQKKKVSAAIKLAGLKLTKIIDEKTALSLQYAIDKHDTFVSKPKYVAIIDFGASSL 217

Query: 684 TCPS 695
           T  S
Sbjct: 218 TLSS 221


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 817,305,341
Number of Sequences: 1657284
Number of extensions: 17917629
Number of successful extensions: 55441
Number of sequences better than 10.0: 322
Number of HSP's better than 10.0 without gapping: 52156
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55283
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 60911752460
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -