SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30166.Seq
         (892 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P07237 Cluster: Protein disulfide-isomerase precursor; ...   113   6e-24
UniRef50_Q1KLB8 Cluster: Protein disulfide isomerase; n=2; Euarc...   112   1e-23
UniRef50_Q6DH89 Cluster: Proteasome (Prosome, macropain) subunit...   105   2e-21
UniRef50_Q8IG53 Cluster: Protein disulfide isomerase protein 2, ...   100   6e-20
UniRef50_Q17967 Cluster: Protein disulfide-isomerase 1 precursor...    96   9e-19
UniRef50_O48949 Cluster: Protein disulfide isomerase RB60; n=2; ...    96   1e-18
UniRef50_P13667 Cluster: Protein disulfide-isomerase A4 precurso...    90   6e-17
UniRef50_Q26593 Cluster: Protein disulfide isomerase homologue p...    89   1e-16
UniRef50_O76945 Cluster: Protein disulphide isomerase; n=2; Dige...    89   2e-16
UniRef50_A0CHN0 Cluster: Chromosome undetermined scaffold_182, w...    87   4e-16
UniRef50_UPI00006CF852 Cluster: Thioredoxin family protein; n=1;...    85   3e-15
UniRef50_Q4SZH7 Cluster: Chromosome 18 SCAF11624, whole genome s...    85   3e-15
UniRef50_A7STM8 Cluster: Predicted protein; n=2; Nematostella ve...    85   3e-15
UniRef50_Q5YER4 Cluster: Protein disulfide isomerase; n=1; Bigel...    84   4e-15
UniRef50_Q13087 Cluster: Protein disulfide-isomerase A2 precurso...    83   9e-15
UniRef50_Q5K7H6 Cluster: Putative uncharacterized protein; n=1; ...    83   1e-14
UniRef50_Q9SRG3 Cluster: Protein disulfide-isomerase 2 precursor...    83   1e-14
UniRef50_Q9FF55 Cluster: Protein disulphide isomerase-like prote...    82   2e-14
UniRef50_Q6V4H6 Cluster: Pancreas-specific protein disulfide iso...    80   9e-14
UniRef50_Q8LSK4 Cluster: Protein disulfide isomerase-like PDI-H;...    80   9e-14
UniRef50_O76191 Cluster: Transglutaminase precursor; n=11; Bilat...    79   2e-13
UniRef50_P34329 Cluster: Probable protein disulfide-isomerase A4...    79   2e-13
UniRef50_UPI0000ECAAC5 Cluster: protein disulfide isomerase-like...    78   3e-13
UniRef50_Q5W968 Cluster: Protein disulfide isomerase; n=3; Sarco...    78   3e-13
UniRef50_A7TZ65 Cluster: Protein disulfide-isomerase 2; n=1; Lep...    77   5e-13
UniRef50_Q5YBC3 Cluster: Plastid protein disulfide isomerase; n=...    77   6e-13
UniRef50_Q96VF3 Cluster: Putative uncharacterized protein; n=3; ...    75   2e-12
UniRef50_P30101 Cluster: Protein disulfide-isomerase A3 precurso...    75   2e-12
UniRef50_Q7ZW15 Cluster: Zgc:55398; n=2; Danio rerio|Rep: Zgc:55...    74   6e-12
UniRef50_Q9C818 Cluster: Protein disulfide isomerase, putative; ...    74   6e-12
UniRef50_A7TFB1 Cluster: Putative uncharacterized protein; n=1; ...    74   6e-12
UniRef50_Q2V0Z7 Cluster: Protein disulfide isomerase; n=2; Babes...    73   7e-12
UniRef50_A0CLM8 Cluster: Chromosome undetermined scaffold_20, wh...    73   7e-12
UniRef50_Q9GRI2 Cluster: Protein disulfide isomerase precursor; ...    73   1e-11
UniRef50_Q5DFE8 Cluster: SJCHGC05888 protein; n=1; Schistosoma j...    73   1e-11
UniRef50_UPI0000D574C8 Cluster: PREDICTED: similar to Protein di...    72   2e-11
UniRef50_Q7YY73 Cluster: Protein disulphide isomerase, probable;...    72   2e-11
UniRef50_A0BR04 Cluster: Chromosome undetermined scaffold_121, w...    72   2e-11
UniRef50_Q0JD21 Cluster: Os04g0436300 protein; n=3; Oryza sativa...    71   3e-11
UniRef50_A7S406 Cluster: Predicted protein; n=1; Nematostella ve...    70   7e-11
UniRef50_O15735 Cluster: Protein disulfide isomerase precursor; ...    70   9e-11
UniRef50_A0DGP2 Cluster: Chromosome undetermined scaffold_5, who...    69   1e-10
UniRef50_P38658 Cluster: Probable protein disulfide-isomerase ER...    69   2e-10
UniRef50_A0BSE8 Cluster: Chromosome undetermined scaffold_125, w...    68   3e-10
UniRef50_O22263 Cluster: Probable protein disulfide-isomerase A6...    68   4e-10
UniRef50_UPI0000E49DA6 Cluster: PREDICTED: similar to ENSANGP000...    67   5e-10
UniRef50_A5C1Q6 Cluster: Putative uncharacterized protein; n=1; ...    67   5e-10
UniRef50_A1YUM1 Cluster: NUK7; n=1; Phytophthora infestans|Rep: ...    67   5e-10
UniRef50_Q4E3F7 Cluster: Protein disulfide isomerase, putative; ...    67   6e-10
UniRef50_Q7XZ51 Cluster: Protein disulfide isomerase 1; n=1; Gri...    66   9e-10
UniRef50_Q9TWZ1 Cluster: Protein disulphide isomerase isoform/mu...    66   9e-10
UniRef50_Q9N4L6 Cluster: Putative uncharacterized protein; n=2; ...    66   9e-10
UniRef50_A2XPL0 Cluster: Putative uncharacterized protein; n=1; ...    66   1e-09
UniRef50_Q8I8E1 Cluster: Disulfide isomerase PDI; n=4; Leishmani...    66   1e-09
UniRef50_Q6C781 Cluster: Similar to sp|P55059 Humicola insolens ...    66   1e-09
UniRef50_Q5EUD0 Cluster: Protein disulfide isomerase; n=4; Poace...    66   1e-09
UniRef50_A3LVR0 Cluster: Predicted protein; n=3; Saccharomycetac...    66   1e-09
UniRef50_Q15084 Cluster: Protein disulfide-isomerase A6 precurso...    66   1e-09
UniRef50_Q92249 Cluster: Protein disulfide-isomerase erp38 precu...    66   1e-09
UniRef50_A0E0N2 Cluster: Chromosome undetermined scaffold_72, wh...    65   3e-09
UniRef50_A0BDV3 Cluster: Chromosome undetermined scaffold_101, w...    65   3e-09
UniRef50_Q9C1Z8 Cluster: Protein disulphide isomerase; n=1; Pich...    65   3e-09
UniRef50_Q00248 Cluster: Protein disulfide-isomerase precursor; ...    65   3e-09
UniRef50_Q22XT0 Cluster: Protein disulfide-isomerase domain cont...    64   3e-09
UniRef50_Q96W60 Cluster: Protein disulfide isomerase family memb...    64   5e-09
UniRef50_P17967 Cluster: Protein disulfide-isomerase precursor; ...    64   5e-09
UniRef50_Q4T338 Cluster: Chromosome undetermined SCAF10125, whol...    64   6e-09
UniRef50_Q54BW3 Cluster: Putative uncharacterized protein; n=1; ...    63   8e-09
UniRef50_UPI00015564A7 Cluster: PREDICTED: similar to Protein di...    62   1e-08
UniRef50_UPI0000E479E2 Cluster: PREDICTED: similar to protein di...    62   1e-08
UniRef50_Q4Q9C8 Cluster: Protein disulfide isomerase, putative; ...    62   1e-08
UniRef50_Q4CMH3 Cluster: Protein disulfide isomerase, putative; ...    62   1e-08
UniRef50_Q10057 Cluster: Putative protein disulfide-isomerase C1...    62   1e-08
UniRef50_P12865 Cluster: Bloodstream-specific protein 2 precurso...    62   2e-08
UniRef50_Q9LQG5 Cluster: F15O4.20; n=13; Magnoliophyta|Rep: F15O...    62   2e-08
UniRef50_Q5XWD1 Cluster: Protein disulfide isomerase; n=2; Entam...    61   3e-08
UniRef50_A7RMG9 Cluster: Predicted protein; n=1; Nematostella ve...    61   3e-08
UniRef50_Q9LRF6 Cluster: Thioredoxin; n=1; Chlorella vulgaris|Re...    61   4e-08
UniRef50_Q869Z0 Cluster: Similar to Aspergillus niger. PDI relat...    61   4e-08
UniRef50_Q4MZU0 Cluster: Protein disulfide isomerase, putative; ...    61   4e-08
UniRef50_A7S9T0 Cluster: Predicted protein; n=1; Nematostella ve...    60   6e-08
UniRef50_Q503X6 Cluster: Zgc:110025; n=3; Clupeocephala|Rep: Zgc...    60   7e-08
UniRef50_Q5A5F2 Cluster: Likely protein disulfide isomerase; n=5...    60   7e-08
UniRef50_Q54EN4 Cluster: Protein disulfide isomerase; n=1; Dicty...    60   1e-07
UniRef50_UPI0000D5742F Cluster: PREDICTED: similar to CG9911-PA,...    59   1e-07
UniRef50_Q5CGZ8 Cluster: Protein disulfide isomerase; n=2; Crypt...    59   1e-07
UniRef50_Q5KQ34 Cluster: Disulfide-isomerase, putative; n=1; Fil...    59   1e-07
UniRef50_A0DI01 Cluster: Chromosome undetermined scaffold_51, wh...    59   2e-07
UniRef50_Q9MAU6 Cluster: F13M7.3 protein; n=10; Magnoliophyta|Re...    58   2e-07
UniRef50_Q869Q9 Cluster: Similar to Acanthamoeba castellanii (Am...    58   2e-07
UniRef50_A0CB24 Cluster: Chromosome undetermined scaffold_163, w...    58   2e-07
UniRef50_O93914 Cluster: PDI related protein A; n=4; Pezizomycot...    58   2e-07
UniRef50_Q8H703 Cluster: Protein disulfide-isomerase; n=1; Phyto...    58   3e-07
UniRef50_Q9VJZ1 Cluster: CG9302-PA; n=7; Eumetazoa|Rep: CG9302-P...    58   3e-07
UniRef50_Q95TL8 Cluster: LD41494p; n=5; Endopterygota|Rep: LD414...    58   3e-07
UniRef50_UPI0000498890 Cluster: protein disulfide isomerase; n=2...    57   5e-07
UniRef50_Q9XTU8 Cluster: Putative uncharacterized protein; n=2; ...    57   5e-07
UniRef50_Q96JJ7 Cluster: Protein disulfide-isomerase TXNDC10 pre...    57   5e-07
UniRef50_Q57WS0 Cluster: Protein disulfide isomerase, putative; ...    57   7e-07
UniRef50_UPI0000E49F35 Cluster: PREDICTED: similar to Thioredoxi...    56   9e-07
UniRef50_Q2HPL0 Cluster: Putative disulphide isomerase; n=1; Sol...    56   1e-06
UniRef50_Q582J4 Cluster: Protein disulfide isomerase, putative; ...    56   1e-06
UniRef50_O97451 Cluster: Protein disulfide isomerase-1 precursor...    56   1e-06
UniRef50_A6SJX8 Cluster: Putative uncharacterized protein; n=2; ...    56   1e-06
UniRef50_Q6BZZ7 Cluster: Similarities with tr|O93914 Aspergillus...    56   2e-06
UniRef50_A7S4E7 Cluster: Predicted protein; n=1; Nematostella ve...    55   2e-06
UniRef50_Q5AKR3 Cluster: Potential thioredoxin; n=3; Saccharomyc...    55   2e-06
UniRef50_Q6CC54 Cluster: Similar to DEHA0F19404g Debaryomyces ha...    55   3e-06
UniRef50_Q4PDL1 Cluster: Putative uncharacterized protein; n=1; ...    55   3e-06
UniRef50_Q0UV07 Cluster: Putative uncharacterized protein; n=1; ...    55   3e-06
UniRef50_Q00002 Cluster: Protein disulfide-isomerase; n=1; Alter...    55   3e-06
UniRef50_Q12404 Cluster: Protein disulfide-isomerase MPD1 precur...    55   3e-06
UniRef50_UPI00015B4150 Cluster: PREDICTED: similar to protein di...    54   4e-06
UniRef50_UPI0000E47FE2 Cluster: PREDICTED: hypothetical protein;...    54   4e-06
UniRef50_Q961B9 Cluster: LD24073p; n=5; Endopterygota|Rep: LD240...    54   4e-06
UniRef50_A7S9T1 Cluster: Predicted protein; n=1; Nematostella ve...    54   4e-06
UniRef50_Q16961 Cluster: Disulfide-like protein; n=1; Acanthamoe...    54   5e-06
UniRef50_A7SNX3 Cluster: Predicted protein; n=1; Nematostella ve...    54   5e-06
UniRef50_A0BUK5 Cluster: Chromosome undetermined scaffold_13, wh...    54   5e-06
UniRef50_Q4WPF6 Cluster: Thioredoxin, putative; n=13; Pezizomyco...    54   5e-06
UniRef50_A7TMH6 Cluster: Putative uncharacterized protein; n=1; ...    54   5e-06
UniRef50_O97452 Cluster: Protein disulfide isomerase-2 precursor...    54   6e-06
UniRef50_Q9RD25 Cluster: Thioredoxin; n=27; Bacteria|Rep: Thiore...    53   9e-06
UniRef50_A7CYY1 Cluster: Thioredoxin; n=1; Opitutaceae bacterium...    53   9e-06
UniRef50_Q9BKB3 Cluster: Protein disulfide isomerase 4; n=1; Gia...    53   9e-06
UniRef50_A7SY15 Cluster: Predicted protein; n=1; Nematostella ve...    53   9e-06
UniRef50_Q5KJU3 Cluster: Protein disulfide isomerase, putative; ...    53   9e-06
UniRef50_Q4RI48 Cluster: Chromosome 8 SCAF15044, whole genome sh...    53   1e-05
UniRef50_Q5CY16 Cluster: Protein disulfide isomerase, signal pep...    53   1e-05
UniRef50_Q8NBS9 Cluster: Thioredoxin domain-containing protein 5...    53   1e-05
UniRef50_UPI0000D57458 Cluster: PREDICTED: similar to CG8983-PA,...    52   1e-05
UniRef50_Q5CSY8 Cluster: Protein disulfide isomerase, signal pep...    52   1e-05
UniRef50_A0D787 Cluster: Chromosome undetermined scaffold_4, who...    52   1e-05
UniRef50_A2Q233 Cluster: Ribonuclease T2; Thioredoxin domain 2; ...    52   2e-05
UniRef50_Q8IVQ5 Cluster: Protein disulfide isomerase-like protei...    52   2e-05
UniRef50_Q9URS7 Cluster: MPD1 homologue; n=1; Kluyveromyces lact...    52   2e-05
UniRef50_Q6DG87 Cluster: PDIA2 protein; n=5; Danio rerio|Rep: PD...    52   3e-05
UniRef50_Q0UDG8 Cluster: Putative uncharacterized protein; n=1; ...    52   3e-05
UniRef50_Q5QY72 Cluster: Thioredoxin domain-containing protein; ...    51   3e-05
UniRef50_Q6FJP0 Cluster: Candida glabrata strain CBS138 chromoso...    51   3e-05
UniRef50_UPI0000DB7CD9 Cluster: PREDICTED: similar to CG5027-PA,...    51   5e-05
UniRef50_UPI000023F2B3 Cluster: hypothetical protein FG06174.1; ...    51   5e-05
UniRef50_Q5YBC2 Cluster: Plastid protein disulfide isomerase; n=...    51   5e-05
UniRef50_Q00ZL8 Cluster: Thioredoxin/protein disulfide isomerase...    51   5e-05
UniRef50_Q4N7F7 Cluster: Protein disulfide isomerase, putative; ...    51   5e-05
UniRef50_A2BLV1 Cluster: Predicted Thioredoxin; n=1; Hyperthermu...    51   5e-05
UniRef50_O13704 Cluster: Thioredoxin domain-containing protein C...    51   5e-05
UniRef50_P42115 Cluster: Thioredoxin; n=4; Sordariomycetes|Rep: ...    51   5e-05
UniRef50_Q7XY30 Cluster: Protein disulfide isomerase 2; n=1; Gri...    50   6e-05
UniRef50_Q017G7 Cluster: Protein disulfide isomerase, putative; ...    50   6e-05
UniRef50_Q4E5B1 Cluster: Thioredoxin, putative; n=4; Trypanosoma...    50   6e-05
UniRef50_Q14554 Cluster: Protein disulfide-isomerase A5 precurso...    50   6e-05
UniRef50_UPI0000499DF8 Cluster: disulfide isomerase precursor; n...    50   8e-05
UniRef50_Q9VYV3 Cluster: CG1837-PA; n=2; Sophophora|Rep: CG1837-...    50   8e-05
UniRef50_Q4Q2Y0 Cluster: Putative uncharacterized protein; n=3; ...    50   8e-05
UniRef50_A7ARU5 Cluster: Protein disulfide isomerase related pro...    50   8e-05
UniRef50_P77395 Cluster: Uncharacterized protein ybbN; n=38; Ent...    50   8e-05
UniRef50_Q9BS26 Cluster: Thioredoxin domain-containing protein 4...    50   8e-05
UniRef50_UPI0000D557D3 Cluster: PREDICTED: similar to ER-residen...    50   1e-04
UniRef50_Q018Z4 Cluster: Thioredoxin/protein disulfide isomerase...    50   1e-04
UniRef50_A4UHA7 Cluster: Protein disulfide-isomerase; n=1; Alexa...    50   1e-04
UniRef50_Q01AS5 Cluster: Thioredoxin/protein disulfide isomerase...    49   1e-04
UniRef50_Q5CXJ5 Cluster: Thioredoxin; protein disulfide isomeras...    49   1e-04
UniRef50_Q7ZA66 Cluster: Related to protein disulfide isomerase;...    49   1e-04
UniRef50_Q7KQL8 Cluster: Thioredoxin; n=7; Plasmodium|Rep: Thior...    49   1e-04
UniRef50_UPI0000D56C28 Cluster: PREDICTED: similar to quiescin Q...    49   2e-04
UniRef50_Q73R53 Cluster: Thioredoxin, selenocysteine-containing;...    49   2e-04
UniRef50_Q7QSG3 Cluster: GLP_64_29074_28670; n=4; Giardia intest...    49   2e-04
UniRef50_Q4P3G1 Cluster: Putative uncharacterized protein; n=1; ...    49   2e-04
UniRef50_A6RP52 Cluster: Putative uncharacterized protein; n=1; ...    49   2e-04
UniRef50_Q2FU47 Cluster: Thioredoxin; n=1; Methanospirillum hung...    49   2e-04
UniRef50_O13811 Cluster: Protein disulfide-isomerase C17H9.14c p...    49   2e-04
UniRef50_UPI00015B52FE Cluster: PREDICTED: similar to Dnajc10 pr...    48   2e-04
UniRef50_Q1EV59 Cluster: Thioredoxin; n=2; Bacteria|Rep: Thiored...    48   2e-04
UniRef50_Q0F3P6 Cluster: Putative thioredoxin; n=1; Mariprofundu...    48   2e-04
UniRef50_Q50KB1 Cluster: Protein disulfide-isomerase-like protei...    48   2e-04
UniRef50_UPI0000D55597 Cluster: PREDICTED: similar to CG1837-PA;...    48   3e-04
UniRef50_UPI000065EEAF Cluster: Sulfhydryl oxidase 1 precursor (...    48   3e-04
UniRef50_Q122N1 Cluster: Thioredoxin; n=8; Comamonadaceae|Rep: T...    48   3e-04
UniRef50_A6Q9U3 Cluster: Thioredoxin; n=4; Bacteria|Rep: Thiored...    48   3e-04
UniRef50_A6DP38 Cluster: Thioredoxin; n=1; Lentisphaera araneosa...    48   3e-04
UniRef50_Q9XWE1 Cluster: Putative uncharacterized protein dnj-27...    48   3e-04
UniRef50_Q7S9W2 Cluster: Putative uncharacterized protein NCU063...    48   3e-04
UniRef50_Q752L5 Cluster: AFR559Cp; n=1; Eremothecium gossypii|Re...    48   3e-04
UniRef50_UPI0000D5729D Cluster: PREDICTED: similar to CG8983-PA,...    48   4e-04
UniRef50_A0Q679 Cluster: Thioredoxin; n=11; Francisella tularens...    48   4e-04
UniRef50_Q7M1Q4 Cluster: Protein disulfide-isomerase; n=1; Glyci...    48   4e-04
UniRef50_Q4QIX1 Cluster: Protein disulfide isomerase; n=4; Leish...    48   4e-04
UniRef50_A0RZ24 Cluster: Thiol-disulfide isomerase; n=1; Cenarch...    48   4e-04
UniRef50_A5AGF4 Cluster: Putative uncharacterized protein; n=1; ...    47   6e-04
UniRef50_Q7QEL4 Cluster: ENSANGP00000017364; n=5; Endopterygota|...    47   6e-04
UniRef50_Q25549 Cluster: Thioredoxin homolog; n=1; Naegleria fow...    47   6e-04
UniRef50_A1DGY3 Cluster: Disulfide isomerase, putative; n=10; Pe...    47   6e-04
UniRef50_UPI000049912A Cluster: protein disulfide isomerase; n=1...    47   7e-04
UniRef50_Q4SZH6 Cluster: Chromosome 18 SCAF11624, whole genome s...    47   7e-04
UniRef50_Q30NQ8 Cluster: Thioredoxin; n=1; Thiomicrospira denitr...    47   7e-04
UniRef50_Q22D05 Cluster: Thioredoxin family protein; n=2; Tetrah...    47   7e-04
UniRef50_UPI0000F1E902 Cluster: PREDICTED: similar to quiescin/s...    46   0.001
UniRef50_Q1H092 Cluster: Thioredoxin-related; n=2; Methylophilal...    46   0.001
UniRef50_Q0PQP1 Cluster: Thioredoxin domain-containing protein; ...    46   0.001
UniRef50_A6Q4J2 Cluster: Thioredoxin; n=3; Proteobacteria|Rep: T...    46   0.001
UniRef50_A3V9L9 Cluster: Thioredoxin; n=3; Rhodobacterales|Rep: ...    46   0.001
UniRef50_Q017M1 Cluster: Thioredoxin-related protein, putative; ...    46   0.001
UniRef50_Q9VI96 Cluster: CG10029-PA; n=3; Diptera|Rep: CG10029-P...    46   0.001
UniRef50_Q9GRP8 Cluster: Putative uncharacterized protein L7845....    46   0.001
UniRef50_Q7Z0N9 Cluster: Protein disulfide isomerase1-1 precurso...    46   0.001
UniRef50_Q20063 Cluster: Putative uncharacterized protein; n=3; ...    46   0.001
UniRef50_A7RXE0 Cluster: Predicted protein; n=1; Nematostella ve...    46   0.001
UniRef50_Q8TGI0 Cluster: Cytosolic thioredoxin I; n=1; Podospora...    46   0.001
UniRef50_Q6FPP9 Cluster: Similar to sp|P40557 Saccharomyces cere...    46   0.001
UniRef50_Q5KCK8 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_P32474 Cluster: Protein disulfide-isomerase EUG1 precur...    46   0.001
UniRef50_UPI00005840BF Cluster: PREDICTED: similar to MGC81459 p...    46   0.001
UniRef50_Q7W665 Cluster: Thioredoxin 2; n=4; Bordetella|Rep: Thi...    46   0.001
UniRef50_Q5LWA0 Cluster: Thioredoxin; n=3; Rhodobacteraceae|Rep:...    46   0.001
UniRef50_A4A5R1 Cluster: Thioredoxin domain-containing protein; ...    46   0.001
UniRef50_Q1HR86 Cluster: Thiol-disulfide isomerase; n=4; Culicid...    46   0.001
UniRef50_Q6BKX9 Cluster: Debaryomyces hansenii chromosome F of s...    46   0.001
UniRef50_Q2KFP4 Cluster: Putative uncharacterized protein; n=4; ...    46   0.001
UniRef50_Q11P71 Cluster: Thioredoxin; n=1; Cytophaga hutchinsoni...    46   0.002
UniRef50_Q0M233 Cluster: Thioredoxin-related; n=1; Caulobacter s...    46   0.002
UniRef50_A3HLB9 Cluster: Thioredoxin; n=20; Bacteria|Rep: Thiore...    46   0.002
UniRef50_Q5CKS0 Cluster: Transmembrane protein 17; n=2; Cryptosp...    46   0.002
UniRef50_UPI0000499AC2 Cluster: protein disulfide isomerase; n=1...    45   0.002
UniRef50_Q4RUD3 Cluster: Chromosome 1 SCAF14995, whole genome sh...    45   0.002
UniRef50_Q3YR36 Cluster: Thioredoxin; n=3; canis group|Rep: Thio...    45   0.002
UniRef50_Q5CE99 Cluster: Protein disulphide isomerase; n=2; Cryp...    45   0.002
UniRef50_Q1HFX5 Cluster: Dynein light chain 3-likeB; n=2; Tetrah...    45   0.002
UniRef50_Q6FSC0 Cluster: Candida glabrata strain CBS138 chromoso...    45   0.002
UniRef50_Q2S0L9 Cluster: Thioredoxin; n=1; Salinibacter ruber DS...    45   0.003
UniRef50_Q6IVR6 Cluster: Predicted thiol-disulfide isomerase/thi...    45   0.003
UniRef50_A1RFF7 Cluster: Thioredoxin; n=27; Gammaproteobacteria|...    45   0.003
UniRef50_P91442 Cluster: Putative uncharacterized protein; n=2; ...    45   0.003
UniRef50_UPI0000498F30 Cluster: thioredoxin; n=1; Entamoeba hist...    44   0.004
UniRef50_Q5E6R8 Cluster: Thioredoxin; n=11; Vibrionales|Rep: Thi...    44   0.004
UniRef50_Q57W47 Cluster: Disulfide isomerase, putative; n=1; Try...    44   0.004
UniRef50_Q4DPR6 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q6FLL8 Cluster: Similar to sp|P40557 Saccharomyces cere...    44   0.004
UniRef50_Q1DXY9 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_A7TFE6 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_A1D496 Cluster: Disulfide isomerase, putative; n=6; Pez...    44   0.004
UniRef50_UPI0000499F4F Cluster: protein disulfide isomerase; n=2...    44   0.005
UniRef50_Q6NEA2 Cluster: Thioredoxin; n=3; Corynebacterium|Rep: ...    44   0.005
UniRef50_Q604D2 Cluster: Thioredoxin family protein; n=1; Methyl...    44   0.005
UniRef50_Q5LLP8 Cluster: Thioredoxin; n=4; Proteobacteria|Rep: T...    44   0.005
UniRef50_Q3JDH4 Cluster: Thioredoxin domain-containing protein; ...    44   0.005
UniRef50_A4VH22 Cluster: Thioredoxin 2; n=1; Pseudomonas stutzer...    44   0.005
UniRef50_Q54UW6 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_Q4L0D7 Cluster: Thioredoxin; n=1; Chlamys farreri|Rep: ...    44   0.005
UniRef50_Q1JT82 Cluster: Thioredoxin, putative; n=1; Toxoplasma ...    44   0.005
UniRef50_Q6CQV2 Cluster: Similar to sp|P40557 Saccharomyces cere...    44   0.005
UniRef50_A4YH67 Cluster: Thioredoxin; n=1; Metallosphaera sedula...    44   0.005
UniRef50_Q8XMF0 Cluster: Thioredoxin; n=5; Clostridium perfringe...    44   0.007
UniRef50_A6Q829 Cluster: Thioredoxin; n=1; Sulfurovum sp. NBC37-...    44   0.007
UniRef50_A6EH55 Cluster: Thioredoxin C-2; n=3; cellular organism...    44   0.007
UniRef50_A6DTE5 Cluster: Thioredoxin; n=1; Lentisphaera araneosa...    44   0.007
UniRef50_A6ARS5 Cluster: Protein YbbN; n=2; Vibrio harveyi|Rep: ...    44   0.007
UniRef50_A1U5Y3 Cluster: Thioredoxin; n=2; Marinobacter|Rep: Thi...    44   0.007
UniRef50_O46709 Cluster: TrxA; n=4; Halobacteriaceae|Rep: TrxA -...    44   0.007
UniRef50_UPI000023CC85 Cluster: hypothetical protein FG06626.1; ...    43   0.009
UniRef50_A5LJL2 Cluster: Thioredoxin; n=1; Streptococcus pneumon...    43   0.009
UniRef50_A1T654 Cluster: Thioredoxin; n=3; Actinomycetales|Rep: ...    43   0.009
UniRef50_Q4N4N8 Cluster: Protein disulfide isomerase; n=4; Theil...    43   0.009
UniRef50_A7SG87 Cluster: Predicted protein; n=2; Nematostella ve...    43   0.009
UniRef50_A7AUH7 Cluster: Thioredoxin family protein; n=1; Babesi...    43   0.009
UniRef50_A2D9R2 Cluster: Putative uncharacterized protein; n=1; ...    43   0.009
UniRef50_A3LZX8 Cluster: Predicted protein; n=1; Pichia stipitis...    43   0.009
UniRef50_O83889 Cluster: Thioredoxin; n=2; Bacteria|Rep: Thiored...    43   0.009
UniRef50_Q9R6P9 Cluster: Thioredoxin; n=3; Mycoplasma gallisepti...    43   0.009
UniRef50_Q8NL58 Cluster: Thiol-disulfide isomerase and thioredox...    43   0.012
UniRef50_Q8G4Z3 Cluster: Thioredoxin; n=4; Bifidobacterium|Rep: ...    43   0.012
UniRef50_O67747 Cluster: Thioredoxin; n=3; Bacteria|Rep: Thiored...    43   0.012
UniRef50_A4BEE1 Cluster: Putative thioredoxin; n=1; Reinekea sp....    43   0.012
UniRef50_A3M8W0 Cluster: Putative uncharacterized protein; n=1; ...    43   0.012
UniRef50_Q0E9N2 Cluster: CG9432-PD, isoform D; n=14; Endopterygo...    43   0.012
UniRef50_Q6QUK5 Cluster: Thioredoxin; n=1; Paxillus involutus|Re...    43   0.012
UniRef50_Q0CGE1 Cluster: Predicted protein; n=1; Aspergillus ter...    43   0.012
UniRef50_A7ET79 Cluster: Putative uncharacterized protein; n=1; ...    43   0.012
UniRef50_Q9ZP21 Cluster: Thioredoxin M-type, chloroplast precurs...    43   0.012
UniRef50_UPI0000F1E8B4 Cluster: PREDICTED: hypothetical protein;...    42   0.016
UniRef50_UPI000038D6D9 Cluster: COG0526: Thiol-disulfide isomera...    42   0.016
UniRef50_Q2SMJ7 Cluster: Thioredoxin domain-containing protein; ...    42   0.016
UniRef50_Q127L3 Cluster: Thioredoxin; n=38; Bacteria|Rep: Thiore...    42   0.016
UniRef50_A4AZJ6 Cluster: Thioredoxin domain-containing protein; ...    42   0.016
UniRef50_A7NSL7 Cluster: Chromosome chr18 scaffold_1, whole geno...    42   0.016
UniRef50_Q7R984 Cluster: Thioredoxin, putative; n=6; Plasmodium|...    42   0.016
UniRef50_Q7JQR3 Cluster: RE62692p; n=2; Sophophora|Rep: RE62692p...    42   0.016
UniRef50_Q24I64 Cluster: Thioredoxin family protein; n=1; Tetrah...    42   0.016
UniRef50_O01492 Cluster: Putative uncharacterized protein; n=3; ...    42   0.016
UniRef50_A0D729 Cluster: Chromosome undetermined scaffold_4, who...    42   0.016
UniRef50_Q5PBS9 Cluster: Thioredoxin; n=4; Anaplasmataceae|Rep: ...    42   0.021
UniRef50_A7HA33 Cluster: Thioredoxin; n=6; Bacteria|Rep: Thiored...    42   0.021
UniRef50_A6H0K5 Cluster: Thioredoxin family protein; n=12; Bacte...    42   0.021
UniRef50_A5UUA5 Cluster: Thioredoxin; n=4; Chloroflexaceae|Rep: ...    42   0.021
UniRef50_A5D3E5 Cluster: Thiol-disulfide isomerase and thioredox...    42   0.021
UniRef50_A3WGX4 Cluster: Thioredoxin; n=6; Sphingomonadales|Rep:...    42   0.021
UniRef50_A5K8G1 Cluster: Protein disulfide-isomerase, putative; ...    42   0.021
UniRef50_A3GG43 Cluster: Thioredoxin; n=2; Pichia stipitis|Rep: ...    42   0.021
UniRef50_Q18JP7 Cluster: Thioredoxin; n=1; Haloquadratum walsbyi...    42   0.021
UniRef50_A6UUK2 Cluster: Thioredoxin domain precursor; n=1; Meth...    42   0.021
UniRef50_P80579 Cluster: Thioredoxin; n=4; Bacilli|Rep: Thioredo...    42   0.021
UniRef50_Q31F86 Cluster: Thioredoxin; n=1; Thiomicrospira crunog...    42   0.028
UniRef50_A6Q6T4 Cluster: Thioredoxin; n=2; Bacteria|Rep: Thiored...    42   0.028
UniRef50_A6C5F8 Cluster: Thioredoxin; n=1; Planctomyces maris DS...    42   0.028
UniRef50_A5ZWV5 Cluster: Putative uncharacterized protein; n=1; ...    42   0.028
UniRef50_A1HPA5 Cluster: Thioredoxin; n=1; Thermosinus carboxydi...    42   0.028
UniRef50_A0LCM9 Cluster: Thioredoxin domain; n=1; Magnetococcus ...    42   0.028
UniRef50_Q01H12 Cluster: Protein disulfide isomerase; n=1; Ostre...    42   0.028
UniRef50_A7PNF6 Cluster: Chromosome chr1 scaffold_22, whole geno...    42   0.028
UniRef50_Q9VUG9 Cluster: CG13473-PA; n=2; Sophophora|Rep: CG1347...    42   0.028
UniRef50_Q757H4 Cluster: AER039Wp; n=1; Eremothecium gossypii|Re...    42   0.028
UniRef50_A6S0W2 Cluster: Putative uncharacterized protein; n=2; ...    42   0.028
UniRef50_P22217 Cluster: Thioredoxin-1; n=4; Ascomycota|Rep: Thi...    42   0.028
UniRef50_UPI0000DB756E Cluster: PREDICTED: similar to CG4670-PA;...    41   0.037
UniRef50_UPI0000498B7F Cluster: thioredoxin; n=1; Entamoeba hist...    41   0.037
UniRef50_Q746S2 Cluster: Thioredoxin family protein, selenocyste...    41   0.037
UniRef50_Q2WBG4 Cluster: Thioredoxin domain-containing protein; ...    41   0.037
UniRef50_A1ZN24 Cluster: Thioredoxin C-2; n=1; Microscilla marin...    41   0.037
UniRef50_A1IFF9 Cluster: Thioredoxin; n=3; Proteobacteria|Rep: T...    41   0.037
UniRef50_A0L915 Cluster: Thioredoxin domain; n=1; Magnetococcus ...    41   0.037
UniRef50_Q9M9Q3 Cluster: T15D22.7 protein; n=7; Magnoliophyta|Re...    41   0.037
UniRef50_Q01BK7 Cluster: Protein disulfide-isomerase; n=2; Ostre...    41   0.037
UniRef50_Q0IEP0 Cluster: Putative uncharacterized protein; n=1; ...    41   0.037
UniRef50_A7RT76 Cluster: Predicted protein; n=1; Nematostella ve...    41   0.037
UniRef50_P75512 Cluster: Thioredoxin; n=2; Mycoplasma|Rep: Thior...    41   0.037
UniRef50_Q09433 Cluster: Thioredoxin-1; n=3; Caenorhabditis|Rep:...    41   0.037
UniRef50_Q28DN8 Cluster: DnaJ (Hsp40) homolog, subfamily C, memb...    41   0.049
UniRef50_Q47W30 Cluster: Thioredoxin domain protein; n=1; Colwel...    41   0.049
UniRef50_Q1W5W8 Cluster: Thiol-disulfide oxido-reductase; n=2; S...    41   0.049
UniRef50_Q02B71 Cluster: Thioredoxin; n=1; Solibacter usitatus E...    41   0.049
UniRef50_A6EYI3 Cluster: Thioredoxin domain-containing protein; ...    41   0.049
UniRef50_A0TRR8 Cluster: Thioredoxin; n=1; Burkholderia cenocepa...    41   0.049
UniRef50_Q01H16 Cluster: Thioredoxin I; n=2; Ostreococcus|Rep: T...    41   0.049
UniRef50_A3E3K1 Cluster: Thioredoxin; n=2; Pfiesteria piscicida|...    41   0.049
UniRef50_Q22XN6 Cluster: Thioredoxin family protein; n=2; Alveol...    41   0.049
UniRef50_A2E3T7 Cluster: Thioredoxin family protein; n=1; Tricho...    41   0.049
UniRef50_A0CHN4 Cluster: Chromosome undetermined scaffold_182, w...    41   0.049
UniRef50_Q6C4U8 Cluster: Similar to sp|P22217 Saccharomyces cere...    41   0.049
UniRef50_Q2H7B0 Cluster: Putative uncharacterized protein; n=1; ...    41   0.049
UniRef50_Q4J8R7 Cluster: Thioredoxin; n=2; Sulfolobus|Rep: Thior...    41   0.049
UniRef50_A7DR47 Cluster: Thioredoxin; n=1; Candidatus Nitrosopum...    41   0.049
UniRef50_P52228 Cluster: Thioredoxin C-3; n=3; Bacteria|Rep: Thi...    41   0.049
UniRef50_UPI0000DB7BA9 Cluster: PREDICTED: similar to lethal (2)...    40   0.064
UniRef50_Q98E31 Cluster: Thioredoxin; n=19; Alphaproteobacteria|...    40   0.064
UniRef50_Q988U5 Cluster: Thioredoxin; n=9; Alphaproteobacteria|R...    40   0.064
UniRef50_Q8DDN7 Cluster: Thioredoxin; n=35; Proteobacteria|Rep: ...    40   0.064
UniRef50_Q605Y8 Cluster: Thioredoxin; n=1; Methylococcus capsula...    40   0.064
UniRef50_Q26C75 Cluster: Putative uncharacterized protein; n=1; ...    40   0.064
UniRef50_Q1GW45 Cluster: Thioredoxin; n=1; Sphingopyxis alaskens...    40   0.064
UniRef50_A6GE23 Cluster: Thioredoxin; n=1; Plesiocystis pacifica...    40   0.064
UniRef50_A5ETY1 Cluster: Thioredoxin; n=1; Bradyrhizobium sp. BT...    40   0.064
UniRef50_A5CVM2 Cluster: Thioredoxin; n=2; Gammaproteobacteria|R...    40   0.064
UniRef50_A0YS67 Cluster: Thioredoxin-like protein; n=4; Cyanobac...    40   0.064
UniRef50_Q5EN23 Cluster: Thioredoxin-like protein; n=3; Sordario...    40   0.064
UniRef50_Q5A9W8 Cluster: Potential protein disulfide isomerase; ...    40   0.064
UniRef50_Q4PFU9 Cluster: Putative uncharacterized protein; n=1; ...    40   0.064
UniRef50_A3LU33 Cluster: Predicted protein; n=1; Pichia stipitis...    40   0.064
UniRef50_Q5UWA6 Cluster: Thioredoxin; n=2; Halobacteriaceae|Rep:...    40   0.064
UniRef50_P29429 Cluster: Thioredoxin; n=3; Ascomycota|Rep: Thior...    40   0.064
UniRef50_UPI0000D55BD3 Cluster: PREDICTED: similar to CG4670-PA;...    40   0.085
UniRef50_UPI000023DFFA Cluster: hypothetical protein FG09447.1; ...    40   0.085
UniRef50_Q4S9P6 Cluster: Chromosome 2 SCAF14695, whole genome sh...    40   0.085
UniRef50_Q8YUH9 Cluster: Thioredoxin; n=4; Cyanobacteria|Rep: Th...    40   0.085
UniRef50_Q8NLG6 Cluster: Thiol-disulfide isomerase and thioredox...    40   0.085
UniRef50_Q1QT29 Cluster: Thioredoxin-related; n=1; Chromohalobac...    40   0.085
UniRef50_Q1FK31 Cluster: Thioredoxin; n=1; Clostridium phytoferm...    40   0.085
UniRef50_Q1DA46 Cluster: Putative thioredoxin; n=1; Myxococcus x...    40   0.085
UniRef50_A6F8N1 Cluster: Putative thioredoxin protein; n=1; Mori...    40   0.085
UniRef50_A5CCQ8 Cluster: Thioredoxin; n=1; Orientia tsutsugamush...    40   0.085
UniRef50_A0JZH7 Cluster: Thioredoxin; n=7; Bacteria|Rep: Thiored...    40   0.085
UniRef50_Q01BQ5 Cluster: Protein disulfide isomerase; n=2; Ostre...    40   0.085
UniRef50_O23166 Cluster: Thiol-disulfide interchange like protei...    40   0.085
UniRef50_A4S3L5 Cluster: Predicted protein; n=4; Eukaryota|Rep: ...    40   0.085
UniRef50_Q55FU1 Cluster: Putative uncharacterized protein; n=1; ...    40   0.085
UniRef50_A7RMV6 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.085
UniRef50_Q59YD4 Cluster: Potential thioredoxin-like ER retention...    40   0.085
UniRef50_A7D1D0 Cluster: Thioredoxin; n=1; Halorubrum lacusprofu...    40   0.085
UniRef50_P40557 Cluster: Putative protein disulfide-isomerase YI...    40   0.085
UniRef50_P66928 Cluster: Thioredoxin; n=30; Bacteria|Rep: Thiore...    40   0.085
UniRef50_Q8IXB1 Cluster: DnaJ homolog subfamily C member 10 prec...    40   0.085
UniRef50_UPI00005846AB Cluster: PREDICTED: hypothetical protein ...    40   0.11 
UniRef50_Q97EM7 Cluster: Thioredoxin; n=9; Clostridium|Rep: Thio...    40   0.11 
UniRef50_Q7UJ35 Cluster: Thioredoxin 1; n=5; Bacteria|Rep: Thior...    40   0.11 
UniRef50_Q7NZ16 Cluster: Thioredoxin 2; n=1; Chromobacterium vio...    40   0.11 
UniRef50_Q5QYF9 Cluster: Thioredoxin; n=3; Proteobacteria|Rep: T...    40   0.11 
UniRef50_Q47W91 Cluster: Thioredoxin; n=1; Colwellia psychreryth...    40   0.11 
UniRef50_Q7P4W8 Cluster: Thioredoxin; n=3; Fusobacterium nucleat...    40   0.11 
UniRef50_Q1IM32 Cluster: Thioredoxin; n=7; Bacteria|Rep: Thiored...    40   0.11 
UniRef50_Q1GKM9 Cluster: Thioredoxin domain; n=25; Alphaproteoba...    40   0.11 
UniRef50_Q12PB1 Cluster: Thioredoxin-related; n=4; Shewanella|Re...    40   0.11 
UniRef50_Q110N7 Cluster: Thioredoxin domain; n=2; Oscillatoriale...    40   0.11 
UniRef50_A6UAL6 Cluster: Thioredoxin domain; n=1; Sinorhizobium ...    40   0.11 
UniRef50_A3IGS3 Cluster: Thioredoxin M; n=3; Cyanobacteria|Rep: ...    40   0.11 
UniRef50_A2U0C6 Cluster: Thioredoxin; n=13; Bacteroidetes|Rep: T...    40   0.11 
UniRef50_Q624I7 Cluster: Putative uncharacterized protein CBG015...    40   0.11 
UniRef50_Q4PLX7 Cluster: Thioredoxin domain containing protein; ...    40   0.11 
UniRef50_Q9USR1 Cluster: Thioredoxin-like I protein Txl1; n=1; S...    40   0.11 
UniRef50_Q6CLI3 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    40   0.11 
UniRef50_Q4P051 Cluster: Putative uncharacterized protein; n=1; ...    40   0.11 
UniRef50_A5DJK3 Cluster: Putative uncharacterized protein; n=1; ...    40   0.11 
UniRef50_A5DB93 Cluster: Putative uncharacterized protein; n=1; ...    40   0.11 
UniRef50_O28984 Cluster: Thioredoxin; n=1; Archaeoglobus fulgidu...    40   0.11 
UniRef50_A7D4P8 Cluster: Thioredoxin; n=1; Halorubrum lacusprofu...    40   0.11 
UniRef50_Q17688 Cluster: Thioredoxin domain-containing protein C...    40   0.11 
UniRef50_P37395 Cluster: Thioredoxin; n=28; cellular organisms|R...    40   0.11 
UniRef50_P0AGG7 Cluster: Thioredoxin-2; n=55; Gammaproteobacteri...    40   0.11 
UniRef50_UPI0000499753 Cluster: thioredoxin; n=2; Entamoeba hist...    39   0.15 
UniRef50_UPI000069DCBC Cluster: protein disulfide isomerase-like...    39   0.15 
UniRef50_Q6P131 Cluster: Zgc:77127; n=1; Danio rerio|Rep: Zgc:77...    39   0.15 
UniRef50_Q9RYY9 Cluster: Thioredoxin 1; n=3; Bacteria|Rep: Thior...    39   0.15 
UniRef50_Q8DKP7 Cluster: Thioredoxin; n=3; Bacteria|Rep: Thiored...    39   0.15 
UniRef50_Q82VN2 Cluster: Thioredoxin; n=45; Proteobacteria|Rep: ...    39   0.15 
UniRef50_Q62JU6 Cluster: Thioredoxin; n=94; Proteobacteria|Rep: ...    39   0.15 
UniRef50_Q5NNI9 Cluster: Thiol-disulfide isomerase; n=2; Bacteri...    39   0.15 
UniRef50_Q2JW92 Cluster: Thioredoxin; n=5; Bacteria|Rep: Thiored...    39   0.15 
UniRef50_Q5VAN9 Cluster: TrxA; n=9; Bacteria|Rep: TrxA - Rhizobi...    39   0.15 
UniRef50_Q113R5 Cluster: Thioredoxin domain; n=2; Oscillatoriale...    39   0.15 
UniRef50_Q0VQH8 Cluster: Thioredoxin; n=1; Alcanivorax borkumens...    39   0.15 
UniRef50_A0LDV0 Cluster: Thioredoxin; n=4; Proteobacteria|Rep: T...    39   0.15 
UniRef50_Q7XY47 Cluster: Thioredoxin; n=1; Griffithsia japonica|...    39   0.15 
UniRef50_Q962B7 Cluster: Thioredoxin; n=1; Branchiostoma belcher...    39   0.15 
UniRef50_Q7KMR7 Cluster: Thioredoxin-like protein TXL; n=13; Eum...    39   0.15 
UniRef50_Q6CKI8 Cluster: Similar to sp|P25372 Saccharomyces cere...    39   0.15 
UniRef50_Q2U7A5 Cluster: Predicted protein; n=5; Eurotiomycetida...    39   0.15 
UniRef50_A7TSI7 Cluster: Putative uncharacterized protein; n=1; ...    39   0.15 
UniRef50_A5DYR2 Cluster: Putative uncharacterized protein; n=1; ...    39   0.15 
UniRef50_O84544 Cluster: Thioredoxin; n=7; Chlamydiaceae|Rep: Th...    39   0.15 
UniRef50_UPI0000D55BD4 Cluster: PREDICTED: similar to CG4670-PA;...    39   0.20 
UniRef50_Q81L73 Cluster: Thioredoxin; n=19; Bacilli|Rep: Thiored...    39   0.20 
UniRef50_Q7NJW3 Cluster: Thiol:disulfide interchange protein; n=...    39   0.20 
UniRef50_Q72IL5 Cluster: Thioredoxin; n=2; Thermus thermophilus|...    39   0.20 
UniRef50_Q67S09 Cluster: Thioredoxin; n=1; Symbiobacterium therm...    39   0.20 
UniRef50_Q64YG6 Cluster: Thioredoxin; n=7; cellular organisms|Re...    39   0.20 
UniRef50_Q2IJZ4 Cluster: Thioredoxin; n=3; Deltaproteobacteria|R...    39   0.20 
UniRef50_Q0SGR5 Cluster: Thioredoxin; n=14; Actinomycetales|Rep:...    39   0.20 
UniRef50_Q0BZH2 Cluster: Putative thioredoxin; n=1; Hyphomonas n...    39   0.20 
UniRef50_A6P2Q7 Cluster: Putative uncharacterized protein; n=1; ...    39   0.20 
UniRef50_A6AN72 Cluster: Thioredoxin; n=2; Vibrio harveyi|Rep: T...    39   0.20 
UniRef50_A7RQN2 Cluster: Predicted protein; n=1; Nematostella ve...    39   0.20 
UniRef50_Q5KK55 Cluster: Thioredoxin (Allergen cop c 2), putativ...    39   0.20 
UniRef50_Q97WI4 Cluster: Thioredoxin; n=5; Thermoprotei|Rep: Thi...    39   0.20 
UniRef50_Q0W5E6 Cluster: Thioredoxin; n=2; uncultured methanogen...    39   0.20 
UniRef50_Q7TN22 Cluster: Thioredoxin domain-containing protein 1...    39   0.20 
UniRef50_P48384 Cluster: Thioredoxin M-type, chloroplast precurs...    39   0.20 
UniRef50_P46843 Cluster: Bifunctional thioredoxin reductase/thio...    39   0.20 
UniRef50_Q7M1B9 Cluster: Thioredoxin; n=4; Chloroflexi (class)|R...    39   0.20 
UniRef50_UPI000023F6A7 Cluster: hypothetical protein FG10417.1; ...    38   0.26 
UniRef50_Q9ABW0 Cluster: Thioredoxin; n=4; Alphaproteobacteria|R...    38   0.26 
UniRef50_Q7VKR2 Cluster: Thioredoxin; n=12; Bacteria|Rep: Thiore...    38   0.26 
UniRef50_Q7MXC8 Cluster: Thioredoxin family protein; n=1; Porphy...    38   0.26 
UniRef50_Q579B4 Cluster: Trx-2, thioredoxin; n=9; Rhizobiales|Re...    38   0.26 
UniRef50_Q482Q6 Cluster: Thioredoxin; n=3; Gammaproteobacteria|R...    38   0.26 
UniRef50_Q0FDR9 Cluster: Protein containing thioredoxin domain; ...    38   0.26 
UniRef50_Q0ABW4 Cluster: Thioredoxin; n=2; Ectothiorhodospiracea...    38   0.26 
UniRef50_A6VVH3 Cluster: Thioredoxin; n=1; Marinomonas sp. MWYL1...    38   0.26 
UniRef50_A6EKJ6 Cluster: Thioredoxin family protein; n=1; Pedoba...    38   0.26 
UniRef50_Q9CAS1 Cluster: Putative thioredoxin; 31807-30553; n=1;...    38   0.26 
UniRef50_Q8IKB2 Cluster: Protein disulfide isomerase, putative; ...    38   0.26 
UniRef50_Q4DV71 Cluster: Protein disulfide isomerase, putative; ...    38   0.26 
UniRef50_A5DP99 Cluster: Putative uncharacterized protein; n=1; ...    38   0.26 
UniRef50_A3LUN7 Cluster: Thioredoxin; n=1; Pichia stipitis|Rep: ...    38   0.26 
UniRef50_Q5UR29 Cluster: Thioredoxin-like protein R548; n=1; Aca...    38   0.26 
UniRef50_P52231 Cluster: Thioredoxin; n=35; Bacteria|Rep: Thiore...    38   0.26 
UniRef50_Q9PBH0 Cluster: Thioredoxin; n=12; Xanthomonadaceae|Rep...    38   0.34 
UniRef50_Q8DGN0 Cluster: Thioredoxin M; n=1; Synechococcus elong...    38   0.34 
UniRef50_Q8A9Y8 Cluster: Thioredoxin; n=4; Bacteroidales|Rep: Th...    38   0.34 
UniRef50_Q5QZY7 Cluster: Thioredoxin related protein; n=1; Idiom...    38   0.34 
UniRef50_A5IBQ4 Cluster: Thioredoxin; n=4; Legionella pneumophil...    38   0.34 
UniRef50_A1SVX1 Cluster: Thioredoxin domain; n=1; Psychromonas i...    38   0.34 
UniRef50_A0YMI1 Cluster: Thioredoxin; n=1; Lyngbya sp. PCC 8106|...    38   0.34 
UniRef50_A0L4T8 Cluster: Thioredoxin; n=1; Magnetococcus sp. MC-...    38   0.34 
UniRef50_A7SIZ4 Cluster: Predicted protein; n=3; Nematostella ve...    38   0.34 
UniRef50_A7ATQ9 Cluster: Thioredoxin, putative; n=1; Babesia bov...    38   0.34 
UniRef50_Q6FQA7 Cluster: Candida glabrata strain CBS138 chromoso...    38   0.34 
UniRef50_A7TEH6 Cluster: Putative uncharacterized protein; n=1; ...    38   0.34 
UniRef50_P0AA28 Cluster: Thioredoxin-1; n=38; Bacteria|Rep: Thio...    38   0.34 
UniRef50_Q99757 Cluster: Thioredoxin, mitochondrial precursor; n...    38   0.34 
UniRef50_Q95108 Cluster: Thioredoxin, mitochondrial precursor; n...    38   0.34 
UniRef50_Q99316 Cluster: Protein disulfide isomerase MPD2 precur...    38   0.34 
UniRef50_UPI0000D574E7 Cluster: PREDICTED: similar to CG8993-PA;...    38   0.45 
UniRef50_UPI0000499862 Cluster: thioredoxin; n=1; Entamoeba hist...    38   0.45 
UniRef50_Q501L2 Cluster: LOC613045 protein; n=3; Xenopus|Rep: LO...    38   0.45 
UniRef50_Q4KMD4 Cluster: Zgc:112303; n=3; Danio rerio|Rep: Zgc:1...    38   0.45 
UniRef50_Q8EWN2 Cluster: Thioredoxin; n=1; Mycoplasma penetrans|...    38   0.45 
UniRef50_Q8AB91 Cluster: Thioredoxin C-2; n=3; Bacteroides|Rep: ...    38   0.45 
UniRef50_Q7MVH7 Cluster: Thioredoxin family protein; n=1; Porphy...    38   0.45 
UniRef50_Q64RG1 Cluster: Thioredoxin; n=3; Bacteroidales|Rep: Th...    38   0.45 
UniRef50_Q5R175 Cluster: Thioredoxin related protein; n=4; Gamma...    38   0.45 
UniRef50_A7DJF8 Cluster: Thioredoxin; n=3; Alphaproteobacteria|R...    38   0.45 
UniRef50_A4YJI0 Cluster: Thioredoxin 1, redox factor; n=8; Bacte...    38   0.45 
UniRef50_A3XQ09 Cluster: AhpC/TSA family protein; n=1; Leeuwenho...    38   0.45 
UniRef50_A1EI68 Cluster: Thioredoxin 2; n=1; Vibrio cholerae V52...    38   0.45 
UniRef50_Q9XIF4 Cluster: Putative thioredoxin; n=1; Arabidopsis ...    38   0.45 
UniRef50_Q84XR8 Cluster: Thioredoxin f1; n=1; Chlamydomonas rein...    38   0.45 
UniRef50_Q9W022 Cluster: CG8993-PA; n=2; Sophophora|Rep: CG8993-...    38   0.45 
UniRef50_Q20203 Cluster: Calsequestrin; n=2; Caenorhabditis|Rep:...    38   0.45 
UniRef50_A7S3A4 Cluster: Predicted protein; n=2; Nematostella ve...    38   0.45 
UniRef50_Q7SI53 Cluster: Putative uncharacterized protein NCU005...    38   0.45 
UniRef50_Q6C7A3 Cluster: Similarity; n=1; Yarrowia lipolytica|Re...    38   0.45 
UniRef50_Q1RQI9 Cluster: Thioredoxin; n=6; Dikarya|Rep: Thioredo...    38   0.45 

>UniRef50_P07237 Cluster: Protein disulfide-isomerase precursor;
           n=84; Eukaryota|Rep: Protein disulfide-isomerase
           precursor - Homo sapiens (Human)
          Length = 508

 Score =  113 bits (272), Expect = 6e-24
 Identities = 51/87 (58%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S I+LAKVDAT+E DLA+ YGVRGYPT+KFFRNG   SP +Y+ GR+ADDI++WLKK+TG
Sbjct: 75  SEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG 134

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +     A+ L++++ V V GFF
Sbjct: 135 PAATTLPDGAAAESLVESSEVAVIGFF 161



 Score = 83.8 bits (198), Expect = 5e-15
 Identities = 37/65 (56%), Positives = 46/65 (70%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+  L   D    E++VLVL K+NF   +   +Y+LVEFYAPWCGHCK+LAPEYAKAA 
Sbjct: 9   LAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAG 68

Query: 239 KLAEE 253
           KL  E
Sbjct: 69  KLKAE 73



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AK FL  A+ +DD  F I S+  V  + + + + VVLFK F+E R  + 
Sbjct: 158 IGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFE 217

Query: 675 DEEITEDLLN 704
            E   E+LL+
Sbjct: 218 GEVTKENLLD 227



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           ++ V VL   NFE V     + + VEFYAPWCGHCK LAP + K
Sbjct: 366 KQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDK 409



 Score = 33.1 bits (72), Expect = 9.8
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLK 414
           I +AK+D+T  +   E+  V  +PTLKFF    + + IDY+G R  D    +L+
Sbjct: 420 IVIAKMDSTANE--VEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLE 471


>UniRef50_Q1KLB8 Cluster: Protein disulfide isomerase; n=2;
           Euarchontoglires|Rep: Protein disulfide isomerase -
           Spermophilus tridecemlineatus (Thirteen-lined ground
           squirrel)
          Length = 181

 Score =  112 bits (269), Expect = 1e-23
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S I+LAKVDAT+E DLA+ YGVRGYPT+KFF+NG   SP +Y+ GR+ADDI++WLKK+TG
Sbjct: 58  SEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTG 117

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +     A+ L++++ V V GFF
Sbjct: 118 PAATTLLDGAAAESLVESSEVAVIGFF 144



 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 36/56 (64%), Positives = 43/56 (76%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           D    E++VLVL K+NF   + T +Y+LVEFYAPWCGHCK+LAPEYAKAA KL  E
Sbjct: 1   DAPEEEDHVLVLRKSNFAEALATHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAE 56


>UniRef50_Q6DH89 Cluster: Proteasome (Prosome, macropain) subunit,
           beta type, 3; n=3; Euteleostomi|Rep: Proteasome
           (Prosome, macropain) subunit, beta type, 3 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 338

 Score =  105 bits (251), Expect = 2e-21
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S I+ AKVDAT+E +LA  +GVRGYPT+KFF+ G   +P +YS GRQA+DI+SWLKK+TG
Sbjct: 61  SDIRPAKVDATEESELAREFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVSWLKKRTG 120

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +    QA+ +I  N V V GFF
Sbjct: 121 PAATTLNDVMQAESIIADNEVAVIGFF 147



 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 34/55 (61%), Positives = 41/55 (74%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           E+  EE+VLVL K+NFE  +     +LVEFYAPWCGHCK+LAPEY+KAA  L  E
Sbjct: 5   EIAEEEDVLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAE 59



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/48 (47%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +2

Query: 110 VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           V VL   NFE V       + VEFYAPWCGHCK LAP + +   K  +
Sbjct: 243 VKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKD 290



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 27/69 (39%), Positives = 36/69 (52%), Gaps = 2/69 (2%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  +K F+ TA+ VDD  F I SD+ V   L+ E+  V+     EE+  KY 
Sbjct: 144 IGFFKDVESEDSKAFIKTAEAVDDIPFGITSDDSVF-GLKKEECPVIRLITLEEEMTKYK 202

Query: 675 DE--EITED 695
            E  EIT +
Sbjct: 203 PESSEITAE 211


>UniRef50_Q8IG53 Cluster: Protein disulfide isomerase protein 2,
           isoform b; n=2; Caenorhabditis elegans|Rep: Protein
           disulfide isomerase protein 2, isoform b -
           Caenorhabditis elegans
          Length = 437

 Score =  100 bits (239), Expect = 6e-20
 Identities = 47/97 (48%), Positives = 62/97 (63%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S IKL K+DAT   +++  + VRGYPTLK FRNG P +Y+GGR  D II+WLKKKTGP A
Sbjct: 74  SDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVA 133

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWTRAQPEPKLSFQ 546
             +  A+  KEL ++  V+V G+F      + K   Q
Sbjct: 134 KPLADADAVKELQESADVVVIGYFKDTTSDDAKTWIQ 170



 Score = 94.3 bits (224), Expect = 4e-18
 Identities = 45/72 (62%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = +2

Query: 47  IFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           +F  + L  L LG     +  EENV+VL+K NF+ VI   E+ILVEFYAPWCGHCKSLAP
Sbjct: 1   MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAP 60

Query: 218 EYAKAATKLAEE 253
           EYAKAAT+L EE
Sbjct: 61  EYAKAATQLKEE 72



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVIT-TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           V +L   NFE V    T+ +LVEFYAPWCGHCK LAP + K   K A+++
Sbjct: 309 VKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDE 358



 Score = 37.5 bits (83), Expect = 0.45
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKK--KTGP 429
           I +AK+D+T  +   E   ++ +PT+KFF  GS   +DY+G R  +    +L+   K G 
Sbjct: 360 IVIAKMDSTLNE--VEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEGA 417

Query: 430 PAVEVTSAEQ 459
            A E   AE+
Sbjct: 418 GASEEEKAEE 427


>UniRef50_Q17967 Cluster: Protein disulfide-isomerase 1 precursor;
           n=2; Caenorhabditis|Rep: Protein disulfide-isomerase 1
           precursor - Caenorhabditis elegans
          Length = 485

 Score = 96.3 bits (229), Expect = 9e-19
 Identities = 43/84 (51%), Positives = 56/84 (66%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S IKLAKVDAT+ Q LA  + VRGYPT+ +F++G P  Y+GGR    I+ W+KKK+GP  
Sbjct: 74  SDIKLAKVDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQIVDWVKKKSGPTV 133

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
             V S EQ +EL     V+V G+F
Sbjct: 134 TTVESVEQLEELKGKTRVVVLGYF 157



 Score = 79.8 bits (188), Expect = 9e-14
 Identities = 37/65 (56%), Positives = 47/65 (72%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           I LL  ++G  V   ENVLVL+++NFE  I   E++LV+FYAPWC HCKSLAP+Y +AA 
Sbjct: 8   IFLLVASIGAVVADSENVLVLTESNFEETINGNEFVLVKFYAPWCVHCKSLAPKYDEAAD 67

Query: 239 KLAEE 253
            L EE
Sbjct: 68  LLKEE 72



 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 4/55 (7%)
 Frame = +2

Query: 89  EVPTEENVL---VLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++P + N L   VL  +NF E  +  T+ + V+FYAPWCGHCK L P + + A K
Sbjct: 355 DLPEDWNALPVKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEK 409



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 2/72 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTGPPA 435
           + +AK+DAT  + LA+   V  +PTLK +  GS  P+DY G R  +    ++ K  G  +
Sbjct: 416 VVIAKLDATLNE-LAD-VKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFVNKYAGSAS 473

Query: 436 VEVTSAEQAKEL 471
              T+++  +EL
Sbjct: 474 ESETASQDHEEL 485


>UniRef50_O48949 Cluster: Protein disulfide isomerase RB60; n=2;
           Chlamydomonadales|Rep: Protein disulfide isomerase RB60
           - Chlamydomonas reinhardtii
          Length = 532

 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 45/81 (55%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGPPAVEV 444
           +AKVDATQE+ LA+ +GV+GYPTLK+F +G    DY+G R AD I+ W+KKKTGPPAV V
Sbjct: 104 IAKVDATQEESLAQKFGVQGYPTLKWFVDGELASDYNGPRDADGIVGWVKKKTGPPAVTV 163

Query: 445 TSAEQAKELIDANTVIVFGFF 507
             A++ K L     V+V G+F
Sbjct: 164 EDADKLKSLEADAEVVVVGYF 184



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 26/46 (56%), Positives = 36/46 (78%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V V++  N++  +  +++ LVEFYAPWCGHCK+L PEYAKAAT L
Sbjct: 50  DVTVVTVKNWDETVKKSKFALVEFYAPWCGHCKTLKPEYAKAATAL 95



 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 28/69 (40%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = +2

Query: 53  TAIALLGLALGDEVPTEENVL-VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           TA A+L      E P E+ V  ++ K     V+  T+ +L+E YAPWCGHCK L P Y K
Sbjct: 376 TAQAVLKSEAIPEDPYEDGVYKIVGKTVESVVLDETKDVLLEVYAPWCGHCKKLEPIYKK 435

Query: 230 AATKLAEED 256
            A +  + D
Sbjct: 436 LAKRFKKVD 444


>UniRef50_P13667 Cluster: Protein disulfide-isomerase A4 precursor;
           n=44; Deuterostomia|Rep: Protein disulfide-isomerase A4
           precursor - Homo sapiens (Human)
          Length = 645

 Score = 90.2 bits (214), Expect = 6e-17
 Identities = 42/93 (45%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           R  PI LAKVDAT E DLA+ + V GYPTLK FR G P DY+G R+   I+ ++ +++GP
Sbjct: 226 RSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGP 285

Query: 430 PAVEVTSAEQAKELI-DANTVIVFGFFWTRAQP 525
           P+ E+ + +Q +E + D + VI+ G F   + P
Sbjct: 286 PSKEILTLKQVQEFLKDGDDVIIIGVFKGESDP 318



 Score = 77.0 bits (181), Expect = 6e-13
 Identities = 33/55 (60%), Positives = 40/55 (72%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           D  P  E  LVL+K NF+ V+   + ILVEFYAPWCGHCK LAPEY KAA +L++
Sbjct: 171 DWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSK 225



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           EV  E  VLVL+ ANF+  +   + +L+EFYAPWCGHCK  APEY K A  L ++D
Sbjct: 57  EVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKD 112



 Score = 58.8 bits (136), Expect = 2e-07
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP--- 429
           PI +AK+DAT    LA  + V GYPT+K  + G  +DY G R  ++I++ +++ + P   
Sbjct: 114 PIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWT 173

Query: 430 PAVEVT---SAEQAKELIDANTVIVFGFF 507
           P  EVT   + E   E+++   +I+  F+
Sbjct: 174 PPPEVTLVLTKENFDEVVNDADIILVEFY 202



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           +V+ K     V+   + +L+EFYAPWCGHCK L P Y   A K
Sbjct: 529 VVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKK 571


>UniRef50_Q26593 Cluster: Protein disulfide isomerase homologue
           precursor; n=2; Schistosoma|Rep: Protein disulfide
           isomerase homologue precursor - Schistosoma mansoni
           (Blood fluke)
          Length = 482

 Score = 89.4 bits (212), Expect = 1e-16
 Identities = 41/93 (44%), Positives = 59/93 (63%)
 Frame = +1

Query: 226 QGSNKAG*RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 405
           + + K   + S IKLAKVDAT E++LA  +G +GYPTLKFFRN  PID+ G R +D I++
Sbjct: 64  EAAKKLKEKGSLIKLAKVDATVEEELALKHGEKGYPTLKFFRNEQPIDFLGERDSDAIVN 123

Query: 406 WLKKKTGPPAVEVTSAEQAKELIDANTVIVFGF 504
           W  +K+ P    + S +  K+ ID   + + GF
Sbjct: 124 WCLRKSKPSVEYIDSLDSCKQFIDKANIAILGF 156



 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 40/76 (52%), Positives = 55/76 (72%)
 Frame = +2

Query: 35  MRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA 214
           M++ +   +  L  A   EV  E++VLVL+K NF+ VI T +++LVEFYAPWCGHCK+LA
Sbjct: 1   MKLSVALVVVFLVFA-ASEVTEEDDVLVLNKKNFDDVIKTNKFVLVEFYAPWCGHCKALA 59

Query: 215 PEYAKAATKLAEEDLL 262
           PEY++AA KL E+  L
Sbjct: 60  PEYSEAAKKLKEKGSL 75



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 3/62 (4%)
 Frame = +2

Query: 80  LGDEVPTEEN--VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           + +E+P+++   V VL   N+  V+   ++ + V+ YAPWCGHCK+LAP + +       
Sbjct: 351 MSEEIPSDQTGAVKVLVGKNYNDVVKDKSKDVFVKLYAPWCGHCKALAPVWDELGETFKN 410

Query: 251 ED 256
            D
Sbjct: 411 SD 412



 Score = 40.7 bits (91), Expect = 0.049
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +3

Query: 501 FLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELE-AEDEDVVLFKNFEEKRVKY 671
           F+ D  S     F   A  +DD  FAI +  +++ E    +   +VLFKNF+E RV+Y
Sbjct: 156 FIKDTDSLDLADFEKVADELDDAGFAIANSSEILTEYGITQTPKIVLFKNFDENRVEY 213


>UniRef50_O76945 Cluster: Protein disulphide isomerase; n=2;
           Digenea|Rep: Protein disulphide isomerase - Fasciola
           hepatica (Liver fluke)
          Length = 489

 Score = 88.6 bits (210), Expect = 2e-16
 Identities = 36/83 (43%), Positives = 57/83 (68%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S I +AKVDATQ   LA+S+ V GYPTLKF+++G  +DY+GGRQ  +I+ W+K+K  P  
Sbjct: 79  SDIMIAKVDATQHSKLAKSHNVTGYPTLKFYKSGVWLDYTGGRQTKEIVHWIKRKVSPAV 138

Query: 436 VEVTSAEQAKELIDANTVIVFGF 504
             +++  + ++L+D   ++V  F
Sbjct: 139 SVLSTLSEVQQLVDKEDIVVIAF 161



 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 27/56 (48%), Positives = 38/56 (67%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +E   E  V+ L++  F+  I   E+ +V FYAPWCGHCK++ PEYA+AA +L EE
Sbjct: 22  EESVDESAVVELTEETFDDEIKKKEFAMVMFYAPWCGHCKAMKPEYARAAAQLKEE 77



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKL-AEEDLL 262
           P+ + V VL   N+  V++  ++ + VE YAPWCGHCK LAP + +       +EDL+
Sbjct: 364 PSSDPVRVLVGKNYNEVVSDLSKAVFVELYAPWCGHCKQLAPIWDELGEAYKTKEDLI 421



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 25/70 (35%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTGPPAVE 441
           +AK+DAT  +  AE   V+ +PTLK++  GS  PI+Y+G R  + +  ++  +      E
Sbjct: 422 IAKMDATANE--AEGLSVQSFPTLKYYPKGSSEPIEYTGERTLEALKRFVDSEGKGAQKE 479

Query: 442 VTSAEQAKEL 471
            T AE  +EL
Sbjct: 480 ETEAEPHEEL 489


>UniRef50_A0CHN0 Cluster: Chromosome undetermined scaffold_182,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_182,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 483

 Score = 87.4 bits (207), Expect = 4e-16
 Identities = 33/72 (45%), Positives = 53/72 (73%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + LAKVDAT E  +AE + ++GYPT+KFF +G  IDY GGR  ++I++W+ KK+GPP+ E
Sbjct: 77  VPLAKVDATAEASVAEKFSIQGYPTIKFFISGQAIDYEGGRTTNEIVAWINKKSGPPSTE 136

Query: 442 VTSAEQAKELID 477
           + + E  ++ ++
Sbjct: 137 LNTVEDIEKFLE 148



 Score = 72.9 bits (171), Expect = 1e-11
 Identities = 30/48 (62%), Positives = 38/48 (79%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           E+NVLVL+   F+  I T ++I+VEFYAPWCGHCK LAPEY+ AA +L
Sbjct: 21  EDNVLVLTTDTFQDAIDTFKFIMVEFYAPWCGHCKKLAPEYSAAAAEL 68



 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = +2

Query: 86  DEVPT--EENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +EVP   +E V ++   NF + V+   + +L+EFYAPWCGHCK LAP Y   A KL
Sbjct: 355 EEVPATNDEPVKIVVGKNFKDLVLNNDKDVLIEFYAPWCGHCKQLAPIYEGLAKKL 410



 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSP---IDYSGGRQADDIISWLKKKTGPP 432
           I +AK DAT  +   E   +  +PT+KF++NG     IDYS GR   + IS+LK+ T   
Sbjct: 416 IIIAKCDATANE--IEGVNIESFPTIKFWKNGQKNQIIDYSSGRDEANFISFLKENTSHQ 473

Query: 433 AVEVTSAEQ 459
            V++   E+
Sbjct: 474 WVDLDRVEE 482


>UniRef50_UPI00006CF852 Cluster: Thioredoxin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Thioredoxin family
           protein - Tetrahymena thermophila SB210
          Length = 490

 Score = 84.6 bits (200), Expect = 3e-15
 Identities = 37/90 (41%), Positives = 60/90 (66%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 447
           L+KVDAT E+ +A  + ++GYPTLKFF  G  I+Y GGR  +DI++W+++KTGPP+  V+
Sbjct: 90  LSKVDATAEKFVASQFTIQGYPTLKFFIKGKSIEYKGGRTTNDIVAWIERKTGPPSQLVS 149

Query: 448 SAEQAKELIDANTVIVFGFFWTRAQPEPKL 537
           +    +++I  N V++  F  +    E K+
Sbjct: 150 NPSDLQDIIKDNDVVLAYFGDSEEDKEYKI 179



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 2/72 (2%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVP--TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA 214
           + + TAI    L + +++    E  VL+L+  NF+  +   ++I+VEFYAPWCGHCKSLA
Sbjct: 12  IFVLTAIVASLLTIQEKLKFDDENGVLILTDKNFKFALEQHDFIMVEFYAPWCGHCKSLA 71

Query: 215 PEYAKAATKLAE 250
           P+Y KAA +L +
Sbjct: 72  PQYEKAAQQLKD 83



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 24/48 (50%), Positives = 30/48 (62%), Gaps = 3/48 (6%)
 Frame = +1

Query: 307 ESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPPAVE 441
           E   V  YPTL FF+NGS   P+ Y G R ADD+I ++KK T  P V+
Sbjct: 439 EDVQVNSYPTLYFFKNGSKASPVKYEGNRDADDLIQFVKKHTTHPWVQ 486



 Score = 40.3 bits (90), Expect = 0.064
 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVI-TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           V  + + N++ V+  + + +L+ ++A WCGHC    P+Y + A +  E
Sbjct: 375 VQTIVRKNYDQVVRASNKDLLIMYFATWCGHCNQFKPKYEELAKRFVE 422


>UniRef50_Q4SZH7 Cluster: Chromosome 18 SCAF11624, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 18
           SCAF11624, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 552

 Score = 84.6 bits (200), Expect = 3e-15
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           ++LAKVDAT+E++LAE + + G+PTLK F NG    P D+ G R +  II WLK+ T P 
Sbjct: 119 VRLAKVDATEEKELAEEFEIGGFPTLKLFVNGDRKEPTDFKGKRTSAGIIQWLKRHTSPG 178

Query: 433 AVEVTSAEQAKELIDANTVIVFGFFWTRAQPEPKL 537
              + S E A + ID++ V V GFF      E K+
Sbjct: 179 VPVLDSVEAAAQFIDSHNVTVVGFFEDAESEEAKV 213



 Score = 67.7 bits (158), Expect = 4e-10
 Identities = 28/55 (50%), Positives = 38/55 (69%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           E+  E +V+VL   NF   +   +++LVEFYAPWCGHCK L P YA+AA +L E+
Sbjct: 61  EIEEENHVMVLHINNFARALEENQHLLVEFYAPWCGHCKQLEPVYAEAAGQLKED 115



 Score = 62.9 bits (146), Expect = 1e-08
 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 1/53 (1%)
 Frame = +2

Query: 101 EENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +E V VL   NFE V +  T+ + VEFYAPWCGHCK LAP + K A K A+ D
Sbjct: 410 KEPVKVLVGKNFEAVALDPTKNVFVEFYAPWCGHCKELAPTWEKLAEKFADRD 462



 Score = 38.7 bits (86), Expect = 0.20
 Identities = 20/59 (33%), Positives = 29/59 (49%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY 671
           + F  D  S  AK F     +  DQ  A+ S  +V ++ E +   VVLFK F+E R  +
Sbjct: 200 VGFFEDAESEEAKVFRDVYLIKTDQEMAMSSSPEVFQKYEVKGNAVVLFKKFDEGRADF 258



 Score = 37.1 bits (82), Expect = 0.60
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWL 411
           R  I +AK DAT  +   +S  ++G+PTLK+F  G    +DY+G R  + +  +L
Sbjct: 461 RDDIIIAKFDATANE--VDSLEIKGFPTLKYFPLGERYVVDYTGKRDLETLSKFL 513


>UniRef50_A7STM8 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 646

 Score = 84.6 bits (200), Expect = 3e-15
 Identities = 38/57 (66%), Positives = 43/57 (75%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           DEV  E++VLVL+  NF+ VI     ILVEFYAPWCGHCKSLAPEYAKAA K+   D
Sbjct: 55  DEVKEEDDVLVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLND 111



 Score = 69.7 bits (163), Expect = 9e-11
 Identities = 34/84 (40%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 438
           PI LA VDAT E +LA+ Y V+GYPTLK FR G   +Y G R    I S+++ + GP + 
Sbjct: 228 PIPLAIVDATIESELAQKYEVQGYPTLKVFRKGKATEYKGQRDQYGIASYMRSQVGPSSR 287

Query: 439 EVTSAEQAKELI-DANTVIVFGFF 507
            ++S +  ++ + + + V + GFF
Sbjct: 288 ILSSLKAVQDFMKEKDDVTIMGFF 311



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 32/89 (35%), Positives = 54/89 (60%), Gaps = 6/89 (6%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG---- 426
           P+  AK+DAT   D+A+ + V GYPTLK FR G+P +Y G R+   I+ ++KK++     
Sbjct: 113 PVPFAKMDATVASDIAQRFDVSGYPTLKIFRKGTPYEYEGPREESGIVEYMKKQSDPNWK 172

Query: 427 -PPAVEVT-SAEQAKELIDANTVIVFGFF 507
            PP   +T + E   E+++  ++++  FF
Sbjct: 173 PPPVAALTLTKENFTEVVNRESLMLVEFF 201



 Score = 68.1 bits (159), Expect = 3e-10
 Identities = 29/54 (53%), Positives = 35/54 (64%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           P     L L+K NF  V+     +LVEF+APWCGHCK LAPEY KAA +L + D
Sbjct: 173 PPPVAALTLTKENFTEVVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKND 226



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 3/72 (4%)
 Frame = +2

Query: 23  DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANFETVITTTEY-ILVEFYAPWC 193
           D++   V  F A  L  +     VP   +E V V+    F+ ++   +  +L+EFYAPWC
Sbjct: 496 DSLREFVEEFKAGNLKPIIKSQPVPKSNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWC 555

Query: 194 GHCKSLAPEYAK 229
           GHCK+L P + K
Sbjct: 556 GHCKALEPTFKK 567



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 3/72 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTGPP 432
           I +AK+DAT   D+  +Y V G+PT+ F  +    +PI + GGR+  D+I ++++K    
Sbjct: 578 IVIAKIDATAN-DVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEK---- 632

Query: 433 AVEVTSAEQAKE 468
           A    S E+AK+
Sbjct: 633 ATVSLSKEKAKD 644


>UniRef50_Q5YER4 Cluster: Protein disulfide isomerase; n=1;
           Bigelowiella natans|Rep: Protein disulfide isomerase -
           Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 457

 Score = 84.2 bits (199), Expect = 4e-15
 Identities = 37/81 (45%), Positives = 52/81 (64%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + L KVDAT+E +LA+ Y VRGYPTL +F+ G   +Y GGR +D I+SW+ KK GP   E
Sbjct: 69  VVLGKVDATEEAELAQKYEVRGYPTLIWFKGGKSKEYDGGRTSDTIVSWVMKKIGPVLTE 128

Query: 442 VTSAEQAKELIDANTVIVFGF 504
           V S E+ +E    +  +V  +
Sbjct: 129 VNSVEEIEEFKKKSDAVVVAY 149



 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 29/51 (56%), Positives = 37/51 (72%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           V VL+  NF+  I   + +LVEFYAPWCGHCK LAPEY  A+ KL +ED++
Sbjct: 20  VKVLTTKNFDETIKDNQNVLVEFYAPWCGHCKRLAPEYDAASLKLKDEDVV 70



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 3/51 (5%)
 Frame = +2

Query: 86  DEVPTEEN--VLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAK 229
           +E+P +    V +L   NF+ ++  ++  +LVEFYAPWCGHCK LAP Y K
Sbjct: 329 EEIPEDNTAPVTILVGKNFDAIVKDSKKDVLVEFYAPWCGHCKKLAPTYDK 379



 Score = 38.7 bits (86), Expect = 0.20
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 2/63 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           I +AK+D+T  + +AE   VRG+PTL FF   N + + Y  GR+ +D IS++ +      
Sbjct: 390 IVIAKMDSTANE-VAEPE-VRGFPTLYFFPADNKAGVKYEQGRELEDFISYIDENRKSSK 447

Query: 436 VEV 444
            EV
Sbjct: 448 AEV 450


>UniRef50_Q13087 Cluster: Protein disulfide-isomerase A2 precursor;
           n=21; Theria|Rep: Protein disulfide-isomerase A2
           precursor - Homo sapiens (Human)
          Length = 525

 Score = 83.0 bits (196), Expect = 9e-15
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + LAKVD   +++LAE +GV  YPTLKFFRNG+   P +Y+G R A+ I  WL+++ GP 
Sbjct: 95  VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS 154

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           A+ +     A+ LI    ++V GFF
Sbjct: 155 AMRLEDEAAAQALIGGRDLVVIGFF 179



 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E+P E+ +LVLS+      +     +LVEFYAPWCGHC++LAPEY+KAA  LA E ++
Sbjct: 36  EEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMV 94



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = +2

Query: 80  LGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L  E+P + +   V  L   NFE V    T+ + V+FYAPWC HCK +AP +   A K  
Sbjct: 377 LSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQ 436

Query: 248 E-EDLL 262
           + ED++
Sbjct: 437 DHEDII 442



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY- 671
           I F  D       TFL+ AQ   D  F +    ++ ++     + VVLFK F+E R  + 
Sbjct: 176 IGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFP 235

Query: 672 XDEEITEDL 698
            DEE+  DL
Sbjct: 236 VDEELGLDL 244


>UniRef50_Q5K7H6 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 492

 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 41/78 (52%), Positives = 51/78 (65%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           IKLAKVD T EQ L   +GV GYPTLK FRNGSP DY+G R+AD IIS++ K++ P   +
Sbjct: 75  IKLAKVDCTVEQGLCGEFGVNGYPTLKVFRNGSPTDYAGTRKADGIISYMTKQSLPAISD 134

Query: 442 VTSAEQAKELIDANTVIV 495
           VT       +   N V+V
Sbjct: 135 VTPESHDTFIKSDNVVLV 152



 Score = 64.1 bits (149), Expect = 5e-09
 Identities = 26/51 (50%), Positives = 39/51 (76%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           +VL L+++ F+  I   +  LVEF+APWCGHCK+LAP Y +AAT+L E+++
Sbjct: 25  DVLDLTESTFQKEIAGEDLALVEFFAPWCGHCKNLAPHYEEAATELKEKNI 75



 Score = 41.1 bits (92), Expect = 0.037
 Identities = 15/28 (53%), Positives = 18/28 (64%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           +  EFYAPWCGHC+ LAP +     K A
Sbjct: 381 VFAEFYAPWCGHCQRLAPIWDTLGEKYA 408



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 4/55 (7%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAES--YGVRGYPTLKFFRNGSP--IDYSGGRQADDIISWLK 414
           I +A++DAT E D+  S  + V+G+PTLKF   GS   IDY+G R  D ++ +++
Sbjct: 413 IIIAQMDAT-ENDIPPSAPFRVQGFPTLKFRPAGSSEFIDYTGDRSLDSLVEFVE 466


>UniRef50_Q9SRG3 Cluster: Protein disulfide-isomerase 2 precursor;
           n=50; Magnoliophyta|Rep: Protein disulfide-isomerase 2
           precursor - Arabidopsis thaliana (Mouse-ear cress)
          Length = 508

 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 38/87 (43%), Positives = 61/87 (70%), Gaps = 4/87 (4%)
 Frame = +1

Query: 259 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTG 426
           P+ LAK+DA++E  ++ A  Y ++G+PTLK  RNG  S  DY+G R+A+ I+++LKK++G
Sbjct: 81  PLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQSG 140

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P +VE+ SA+ A E++    V+  G F
Sbjct: 141 PASVEIKSADSATEVVGEKNVVAVGVF 167



 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 2/71 (2%)
 Frame = +2

Query: 50  FTAIALLGLALGD--EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           F+ + LL L +       T+E VL L  +NF   I+  ++I+VEFYAPWCGHC+ LAPEY
Sbjct: 9   FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68

Query: 224 AKAATKLAEED 256
            KAA++L+  +
Sbjct: 69  EKAASELSSHN 79



 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%)
 Frame = +2

Query: 92  VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           +P E N    +V++++  + V  + + +L+EFYAPWCGHC+ LAP
Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 423
           +AK+DAT     ++++ V+G+PT+ F   +G+ + Y G R  +D I++++K +
Sbjct: 427 IAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479


>UniRef50_Q9FF55 Cluster: Protein disulphide isomerase-like protein;
           n=16; Magnoliophyta|Rep: Protein disulphide
           isomerase-like protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 597

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 33/81 (40%), Positives = 56/81 (69%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + LAK+DAT+E +LA+ Y V+G+PTL FF +G    Y+GGR  + I++W+KKK GP    
Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213

Query: 442 VTSAEQAKELIDANTVIVFGF 504
           +T+ + A++++ +   +V G+
Sbjct: 214 LTTLDDAEKVLTSGNKVVLGY 234



 Score = 80.6 bits (190), Expect = 5e-14
 Identities = 37/69 (53%), Positives = 50/69 (72%), Gaps = 4/69 (5%)
 Frame = +2

Query: 68  LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           LG    D +PT    E++V+V+ + NF  VI   +Y+LVEFYAPWCGHC+SLAPEYA AA
Sbjct: 87  LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146

Query: 236 TKLAEEDLL 262
           T+L E+ ++
Sbjct: 147 TELKEDGVV 155



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 3/62 (4%)
 Frame = +2

Query: 86  DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           D +P   +E+V ++   NF E V+  ++ +L+E YAPWCGHC++L P Y K A  L   D
Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492

Query: 257 LL 262
            L
Sbjct: 493 SL 494


>UniRef50_Q6V4H6 Cluster: Pancreas-specific protein disulfide
           isomerase; n=6; Xenopus|Rep: Pancreas-specific protein
           disulfide isomerase - Xenopus laevis (African clawed
           frog)
          Length = 526

 Score = 79.8 bits (188), Expect = 9e-14
 Identities = 37/98 (37%), Positives = 57/98 (58%), Gaps = 3/98 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           ++LAKVD T E DL+  + V GYPTLKFF+ G+    IDY G R  D ++ W+ ++ GP 
Sbjct: 99  VRLAKVDGTVETDLSTEFNVNGYPTLKFFKGGNRTGHIDYGGKRDQDGLVKWMLRRMGPA 158

Query: 433 AVEVTSAEQAKELIDANTVIVFGFFWTRAQPEPKLSFQ 546
           AV + + E A++   +    V GFF      + K+ ++
Sbjct: 159 AVVLDNVESAEKFTSSQEFPVIGFFKNPEDADIKIFYE 196



 Score = 79.0 bits (186), Expect = 2e-13
 Identities = 33/56 (58%), Positives = 43/56 (76%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           DE+  E+NVLVL+K NF   + T +Y+LVEFYAPWCGHC+ LAP+Y KAA  L ++
Sbjct: 40  DELLEEDNVLVLNKRNFNKALETYKYLLVEFYAPWCGHCQELAPKYTKAAEILKDK 95



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 4/63 (6%)
 Frame = +2

Query: 80  LGDEVPTEEN---VLVLSKANFETVI-TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           + +E+P + +   V VL   NFE V    T+ + VEFYAPWC HCK + P + +   K  
Sbjct: 379 MSEEIPEDWDKSPVKVLVGKNFEEVAYDETKNVFVEFYAPWCSHCKEMEPVWEELGEKYK 438

Query: 248 EED 256
           + +
Sbjct: 439 DHE 441



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 20/67 (29%), Positives = 33/67 (49%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  +   A  K F   A++ +D  FA+  DEK+ ++    ++ V+ FK  EE      
Sbjct: 180 IGFFKNPEDADIKIFYEVAELQEDFTFALAHDEKLFEKFGVTEDTVIFFKKSEENLNFKP 239

Query: 675 DEEITED 695
           DE++  D
Sbjct: 240 DEDLGLD 246


>UniRef50_Q8LSK4 Cluster: Protein disulfide isomerase-like PDI-H;
           n=3; Physcomitrella patens|Rep: Protein disulfide
           isomerase-like PDI-H - Physcomitrella patens (Moss)
          Length = 524

 Score = 79.8 bits (188), Expect = 9e-14
 Identities = 38/77 (49%), Positives = 56/77 (72%), Gaps = 6/77 (7%)
 Frame = +2

Query: 50  FTAIALLGL------ALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
           F A+ LL L      A  +++  E++V+VL  +NF  +I++ +Y+LVEFYAPWCGHC++L
Sbjct: 4   FLAVGLLALFCVTSPAYAEDID-EKDVIVLGASNFTELISSHKYVLVEFYAPWCGHCQTL 62

Query: 212 APEYAKAATKLAEEDLL 262
           APEYAKAAT L +E ++
Sbjct: 63  APEYAKAATLLKDEGVV 79



 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 35/81 (43%), Positives = 52/81 (64%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + LAKVDAT+  DL++ + VRG+PTL FF +G    Y+GGR+ D+I+ W+KKK GP    
Sbjct: 78  VVLAKVDATEHNDLSQKFEVRGFPTLLFFVDGVHRPYTGGRKVDEIVGWVKKKCGPSFQT 137

Query: 442 VTSAEQAKELIDANTVIVFGF 504
           + S   A++ ++  T I   F
Sbjct: 138 LKSTADAEKALEFETPIAVAF 158



 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = +2

Query: 50  FTAIALLGLALGDEVPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 220
           F A  L      ++VP + N    +V+ K+  + V+  ++ +L+E YAPWCGHCKSL PE
Sbjct: 342 FVANKLTPYFKSEDVPEKNNEPVKVVVGKSFEDIVLDDSKDVLLEVYAPWCGHCKSLEPE 401

Query: 221 YAKAATKLAE 250
           Y K    L +
Sbjct: 402 YNKLGELLKD 411


>UniRef50_O76191 Cluster: Transglutaminase precursor; n=11;
           Bilateria|Rep: Transglutaminase precursor - Dirofilaria
           immitis (Canine heartworm)
          Length = 497

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 34/84 (40%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGPPA 435
           PI LA+VD T+E+   + YGV G+PTLK FR G    DY G R A+ I+ +++ + GP A
Sbjct: 79  PIHLAEVDCTEEKKTCDEYGVSGFPTLKIFRKGELAQDYDGPRVAEGIVKYMRGQAGPSA 138

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+ + ++ ++++ A+ V + GFF
Sbjct: 139 TEINTQQEFEKMLQADDVTICGFF 162



 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 26/50 (52%), Positives = 37/50 (74%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +V+  + A+F+  I   + +LV+FYAPWCGHCK +APE+ KAATKL + D
Sbjct: 28  DVMKFTDADFKEGIKPYDVLLVKFYAPWCGHCKKIAPEFEKAATKLLQND 77



 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 24/58 (41%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +2

Query: 86  DEVPTEEN--VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +E P ++    +V++K   E ++   + +L+EFYAPWCGHCK+LAP+Y +   KL+ E
Sbjct: 363 EEAPEDQGDVKVVVAKTFQEMIMNVEKDVLIEFYAPWCGHCKALAPKYDELGQKLSGE 420



 Score = 41.1 bits (92), Expect = 0.037
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 3/55 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKK 417
           + +AK+DAT   D+   + V+G+PTL +    +   P  YSGGR+ DD I ++ K
Sbjct: 423 VVIAKMDATAN-DVPPPFQVQGFPTLYWVPKNKKDKPEPYSGGREVDDFIKYIAK 476


>UniRef50_P34329 Cluster: Probable protein disulfide-isomerase A4
           precursor; n=2; Caenorhabditis|Rep: Probable protein
           disulfide-isomerase A4 precursor - Caenorhabditis
           elegans
          Length = 618

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 36/86 (41%), Positives = 52/86 (60%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S +KL KVDAT E+DL   YGV GYPT+K  RNG   DY+G R+A  II ++  ++ P A
Sbjct: 198 SKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRRFDYNGPREAAGIIKYMTDQSKPAA 257

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWT 513
            ++   +  +  +  + V + GFF T
Sbjct: 258 KKLPKLKDVERFMSKDDVTIIGFFAT 283



 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 31/50 (62%), Positives = 36/50 (72%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           P  E V+ L+  NF+  I+  E +LVEFYAPWCGHCK LAPEY KAA KL
Sbjct: 144 PPPEEVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKL 193



 Score = 66.9 bits (156), Expect = 6e-10
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           +E V+VL+  NF+  +     +LV+FYAPWCGHCK LAPEY KA++K++
Sbjct: 35  DEGVVVLTDKNFDAFLKKNPSVLVKFYAPWCGHCKHLAPEYEKASSKVS 83



 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 7/89 (7%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKKTG---- 426
           I LAKVDAT E +L + + ++GYPTLKF+++G  P DY GGR    I+ W++ +      
Sbjct: 84  IPLAKVDATVETELGKRFEIQGYPTLKFWKDGKGPNDYDGGRDEAGIVEWVESRVDPNYK 143

Query: 427 PPAVEVT--SAEQAKELIDANTVIVFGFF 507
           PP  EV   + E   + I  N +++  F+
Sbjct: 144 PPPEEVVTLTTENFDDFISNNELVLVEFY 172



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 1/40 (2%)
 Frame = +2

Query: 128 ANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +NF+ ++   ++ +L+EFYAPWCGHCKS   +Y + A  L
Sbjct: 507 SNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQAL 546


>UniRef50_UPI0000ECAAC5 Cluster: protein disulfide isomerase-like
           protein of the testis; n=2; Gallus gallus|Rep: protein
           disulfide isomerase-like protein of the testis - Gallus
           gallus
          Length = 480

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 34/85 (40%), Positives = 56/85 (65%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTGPP 432
           I+  K+D T + DL + + ++ +PT+KFF +G   +PID  G R+A   I+WLK++TGP 
Sbjct: 105 IQFGKIDVTDQHDLRKEFNIQEFPTVKFFVDGIREAPIDCKGVRRASAFITWLKRQTGPS 164

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
            V + S +Q + +I+A+ + V GFF
Sbjct: 165 TVLINSTDQVEAIINADDLAVIGFF 189



 Score = 40.7 bits (91), Expect = 0.049
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 6/61 (9%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEF----YAPWCG--HCKSLAPEYAKAATKLAE 250
           ++  E +VL+L K+NF+  +  T+Y+LVEF    +  WC     ++++ E+A+AA  L +
Sbjct: 41  KIRKENSVLLLKKSNFDRALKETKYLLVEFFVNCFGSWCDILASQNVSKEFAEAARLLKK 100

Query: 251 E 253
           E
Sbjct: 101 E 101


>UniRef50_Q5W968 Cluster: Protein disulfide isomerase; n=3;
           Sarcocystidae|Rep: Protein disulfide isomerase -
           Neospora caninum
          Length = 471

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 35/63 (55%), Positives = 43/63 (68%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S I LAKVDAT E D+A+  GVR YPTL  FRN  P  ++GGR A+ I+ W++K TGP  
Sbjct: 78  SKIMLAKVDATSETDIADKQGVREYPTLTLFRNQKPEKFTGGRTAEAIVEWIEKMTGPAV 137

Query: 436 VEV 444
            EV
Sbjct: 138 TEV 140



 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 34/69 (49%), Positives = 44/69 (63%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           +  A+ LL  A       EE V VL+ +NF+  +  TE +LV+FYAPWCGHCK +APEY 
Sbjct: 8   VLLAVGLLATASVYCAAEEEAVTVLTASNFDDTLKNTEIVLVKFYAPWCGHCKRMAPEYE 67

Query: 227 KAATKLAEE 253
           KAA  L E+
Sbjct: 68  KAAKILKEK 76



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +2

Query: 101 EENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E V V+   NFE  VI   + +++E YAPWCG+CKS  P Y + A K  + D L
Sbjct: 349 DEAVKVVVGKNFEEMVIQKDKDVMLEIYAPWCGYCKSFEPIYKEFAEKYKDVDHL 403


>UniRef50_A7TZ65 Cluster: Protein disulfide-isomerase 2; n=1;
           Lepeophtheirus salmonis|Rep: Protein disulfide-isomerase
           2 - Lepeophtheirus salmonis (salmon louse)
          Length = 401

 Score = 77.4 bits (182), Expect = 5e-13
 Identities = 33/61 (54%), Positives = 41/61 (67%)
 Frame = +1

Query: 325 GYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGF 504
           GYPTLK FRNG P++Y+GGR AD II+WL+KK GPPA  + + E  K+      V V G 
Sbjct: 1   GYPTLKLFRNGKPVEYNGGRTADTIIAWLEKKNGPPAAALKTVEXVKDATKDVKVAVLGL 60

Query: 505 F 507
           F
Sbjct: 61  F 61



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 28/63 (44%), Positives = 39/63 (61%), Gaps = 4/63 (6%)
 Frame = +2

Query: 80  LGDEVPTE---ENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L +EVP +   E+V VL   NFE V +   + +LVEFYAPWCGHCK L P + +     A
Sbjct: 257 LSEEVPEDWDKEDVKVLVGKNFEEVAMNKDKNVLVEFYAPWCGHCKQLVPIWEELGKNFA 316

Query: 248 EED 256
           +++
Sbjct: 317 DKE 319



 Score = 35.9 bits (79), Expect = 1.4
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 2/56 (3%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLK 414
           +  I +AK+D+T  +   ES  V G+PT+K F+ GS   ++Y+G R  +    +L+
Sbjct: 318 KEDIVIAKMDSTTNE--LESIKVTGFPTIKLFKKGSNEVVNYNGERTLEGFTKFLE 371


>UniRef50_Q5YBC3 Cluster: Plastid protein disulfide isomerase; n=1;
           Helicosporidium sp. ex Simulium jonesii|Rep: Plastid
           protein disulfide isomerase - Helicosporidium sp. subsp.
           Simulium jonesii (Green alga)
          Length = 153

 Score = 77.0 bits (181), Expect = 6e-13
 Identities = 30/68 (44%), Positives = 47/68 (69%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + LAK+DA  EQD+A    ++GYPTL +F NG  +++SG R+  DI+ W+KK+TGPP V+
Sbjct: 83  VVLAKLDADAEQDVARENDIKGYPTLIWFENGEKVEFSGNRRRADIVRWIKKRTGPPTVD 142

Query: 442 VTSAEQAK 465
           +     ++
Sbjct: 143 LADVRGSR 150



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 35/72 (48%), Positives = 48/72 (66%)
 Frame = +2

Query: 29  IEMRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKS 208
           + + V +   ++ +  A  D+V  E +VLVL+K N+  VI   +Y++VEFYAPWCGHCK 
Sbjct: 6   LALLVALLVVVSPVVWAQEDDVD-ETDVLVLTKENYSEVIKNNKYVMVEFYAPWCGHCKK 64

Query: 209 LAPEYAKAATKL 244
           L PEYA AAT L
Sbjct: 65  LKPEYAGAATDL 76


>UniRef50_Q96VF3 Cluster: Putative uncharacterized protein; n=3;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 487

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 34/67 (50%), Positives = 47/67 (70%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           IKLAKVD T+E +L   +GV G+PTLK FR GS  +Y+G R+AD I+S++KK+  P   E
Sbjct: 64  IKLAKVDCTEENELCAEHGVEGFPTLKVFRTGSSSEYNGNRKADGIVSYMKKQALPALSE 123

Query: 442 VTSAEQA 462
           +T+   A
Sbjct: 124 LTADSYA 130



 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 22/32 (68%), Positives = 28/32 (87%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           +LVEFYAPWCGHCK+LAPEY KA+T+L  + +
Sbjct: 33  MLVEFYAPWCGHCKALAPEYEKASTELLADKI 64



 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 34/92 (36%), Positives = 48/92 (52%), Gaps = 4/92 (4%)
 Frame = +2

Query: 50  FTAIALLGLALGDEVPTEEN--VLVLSKANFETVI-TTTEYILVEFYAPWCGHCKSLAPE 220
           +T+ +L      + +P +++  V VL    F+ VI   ++  LVEFYAPWCGHCK LAP 
Sbjct: 328 YTSGSLKPSVKSEPIPKDQDGPVHVLVADEFDAVIGDDSKDKLVEFYAPWCGHCKKLAPT 387

Query: 221 YAKAATKL-AEEDLLSN*RKLTQLKNRISPRA 313
           Y     K  A +D +    K+    N I P A
Sbjct: 388 YDTLGEKYKAHKDKVLI-AKMDATANDIPPSA 418


>UniRef50_P30101 Cluster: Protein disulfide-isomerase A3 precursor;
           n=53; Eumetazoa|Rep: Protein disulfide-isomerase A3
           precursor - Homo sapiens (Human)
          Length = 505

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + LAKVD T   +    YGV GYPTLK FR+G     Y G R AD I+S LKK+ GP +V
Sbjct: 78  VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASV 137

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
            + + E+ K+ I      + GFF
Sbjct: 138 PLRTEEEFKKFISDKDASIVGFF 160



 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTE---YILVEFYAPWCGHCKS 208
           R+ +F  +ALL  A    +    +VL L+  NFE+ I+ T     +LVEF+APWCGHCK 
Sbjct: 5   RLALFPGVALLLAAA--RLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKR 62

Query: 209 LAPEYAKAATKL 244
           LAPEY  AAT+L
Sbjct: 63  LAPEYEAAATRL 74



 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V V+   NF+ ++    + +L+EFYAPWCGHCK+L P+Y +   KL+++
Sbjct: 378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKD 426



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK-TGP 429
           I +AK+DAT   D+   Y VRG+PT+ F    +  +P  Y GGR+  D IS+L+++ T P
Sbjct: 429 IVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487

Query: 430 PAVEVTSAEQAKE 468
           P ++    ++ K+
Sbjct: 488 PVIQEEKPKKKKK 500


>UniRef50_Q7ZW15 Cluster: Zgc:55398; n=2; Danio rerio|Rep: Zgc:55398
           - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 278

 Score = 73.7 bits (173), Expect = 6e-12
 Identities = 36/87 (41%), Positives = 53/87 (60%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S ++LAKVDA +E++LA  + V  +PTLKFF+ G   +   + G R    I  WL+K T 
Sbjct: 107 SEVRLAKVDAIEEKELASEFSVDSFPTLKFFKEGNRQNATTFFGKRTLKGIKRWLEKHTA 166

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +   + A+ L++AN V+V GFF
Sbjct: 167 PSATVLNDVKSAEALLEANEVLVVGFF 193



 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 27/53 (50%), Positives = 40/53 (75%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           DE+  +++VL+L   NF+  ++  +Y+LVEFYAPWCGHC+SL P YA+ A +L
Sbjct: 50  DEITEDKDVLILHSVNFDRALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQL 102



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKR 662
           + F  D    +AKTF     +  D  F I SD ++ K+ E + + +VLFK F+E+R
Sbjct: 190 VGFFKDLEGEKAKTFYDVTLIAVDVNFGITSDPELFKKYEVKTDSLVLFKKFDERR 245


>UniRef50_Q9C818 Cluster: Protein disulfide isomerase, putative;
           72379-69727; n=6; core eudicotyledons|Rep: Protein
           disulfide isomerase, putative; 72379-69727 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 546

 Score = 73.7 bits (173), Expect = 6e-12
 Identities = 29/84 (34%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S + +AK+D  +   +A    ++G+PTL  F NG+ + Y+GG  A+DI+ W++KKTG P 
Sbjct: 128 SSVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPI 187

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
           + + + ++A   +D     V G F
Sbjct: 188 ITLNTVDEAPRFLDKYHTFVLGLF 211



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           VL L+    + VI   E+++V  YAPWC     L P +A+AAT L E
Sbjct: 79  VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKE 125


>UniRef50_A7TFB1 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 541

 Score = 73.7 bits (173), Expect = 6e-12
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
 Frame = +2

Query: 56  AIALLGLALGDEV-PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKA 232
           ++A   LA  D + P + +V+ LS  +FE+ I     ++ EF+APWCGHCK+LAPEY KA
Sbjct: 16  SLATSALAQEDAIAPEDSDVVKLSGKDFESFIGKNNLVMAEFFAPWCGHCKNLAPEYVKA 75

Query: 233 ATKLAEEDL 259
           A KL E D+
Sbjct: 76  AEKLKEHDI 84



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 29/74 (39%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           I LA+VD T+ Q+L   + +RGYPT+K F+NG+   P DY G R+AD +I ++ K++ P 
Sbjct: 84  IYLAQVDCTENQELCMEHQIRGYPTIKIFKNGNLEEPKDYQGARKADAMIDFMIKQSLPT 143

Query: 433 AVEVTSAEQAKELI 474
            ++V S ++   ++
Sbjct: 144 VMDVASEDELDSIL 157



 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           + +V+ L   N + +I   +  +LV++YAPWCGHCK+LAP Y   A  LA +
Sbjct: 376 DSSVMKLVAHNHDEIIKDPKKDVLVKYYAPWCGHCKNLAPIYVDLADLLAND 427


>UniRef50_Q2V0Z7 Cluster: Protein disulfide isomerase; n=2;
           Babesia|Rep: Protein disulfide isomerase - Babesia
           caballi
          Length = 465

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 35/80 (43%), Positives = 47/80 (58%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S + LA+++      +A+ +G+ GYPTLKFFR G+P DYSG RQA+ I+SW K    P  
Sbjct: 81  SEVILAELNCDSAPAVAQEFGIEGYPTLKFFRKGTPRDYSGTRQAEGIVSWCKAVLLPAV 140

Query: 436 VEVTSAEQAKELIDANTVIV 495
           V V+S     E  D   V V
Sbjct: 141 VHVSSVADVPEDADVTFVAV 160



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 2/68 (2%)
 Frame = +2

Query: 56  AIALLGLALGDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           ++A +  A  D    E  + V+ L++ N  + +   + +LV+FYAPWC HC+SLAPEY K
Sbjct: 12  SVASVSFAAADGSSEEGAKAVVELTEQNIHSYVAEHDAVLVKFYAPWCMHCQSLAPEYEK 71

Query: 230 AATKLAEE 253
           AA +L EE
Sbjct: 72  AAKQLTEE 79


>UniRef50_A0CLM8 Cluster: Chromosome undetermined scaffold_20, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_20,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 345

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 30/67 (44%), Positives = 44/67 (65%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +    L LG +VP E  VL+LS  NFE V+   E++LV+FYA WCGHC  LAP +A +A 
Sbjct: 7   LLFFSLVLGQQVPEENGVLILSDQNFEYVLKKYEFVLVDFYAHWCGHCHHLAPVFASSAR 66

Query: 239 KLAEEDL 259
           ++  +++
Sbjct: 67  QVRNQNV 73



 Score = 62.9 bits (146), Expect = 1e-08
 Identities = 31/85 (36%), Positives = 49/85 (57%), Gaps = 2/85 (2%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTG 426
           R   ++ AK++  Q + L   Y V G+PTLK F +G  + +Y G R    I+ W++KKT 
Sbjct: 69  RNQNVQFAKINCPQYEHLCRKYQVTGFPTLKLFGDGQLLMEYQGDRTEKAIVDWMRKKTN 128

Query: 427 PPAVEVTSAEQAKELIDA-NTVIVF 498
             +VE  S +Q K+  ++ N V+VF
Sbjct: 129 KGSVEAKSLDQLKKFSESPNLVMVF 153


>UniRef50_Q9GRI2 Cluster: Protein disulfide isomerase precursor;
           n=9; Plasmodium|Rep: Protein disulfide isomerase
           precursor - Plasmodium falciparum
          Length = 483

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 32/68 (47%), Positives = 42/68 (61%)
 Frame = +1

Query: 226 QGSNKAG*RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 405
           + +N    ++S IKL  +DAT E  LA+ YGV GYPTL  F   + I+Y GGR A  I+ 
Sbjct: 72  EAANMLNEKKSEIKLVSIDATSENALAQEYGVTGYPTLILFNKKNKINYGGGRTAQSIVD 131

Query: 406 WLKKKTGP 429
           WL + TGP
Sbjct: 132 WLLQMTGP 139



 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 22/36 (61%), Positives = 26/36 (72%)
 Frame = +2

Query: 146 ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           IT  + +LV FYAPWCGHCK L PEY +AA  L E+
Sbjct: 45  ITKNDIVLVMFYAPWCGHCKRLIPEYNEAANMLNEK 80



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +V+  +  + V+ + + +L+E YAPWCGHCK L P Y     KL + D
Sbjct: 358 IVVGNSFVDVVLKSGKDVLIEIYAPWCGHCKKLEPVYEDLGRKLKKYD 405


>UniRef50_Q5DFE8 Cluster: SJCHGC05888 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05888 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 416

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 35/94 (37%), Positives = 55/94 (58%), Gaps = 9/94 (9%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS----PIDYSGGRQADDIISWLKKK 420
           +  +K+A +DAT    +A+ YG+RGYPT+KFF  GS    P+DY G R +D I++W  +K
Sbjct: 194 KGTVKVAALDATVHSRMAQKYGIRGYPTIKFFPAGSKTDDPVDYDGPRSSDGIVAWALEK 253

Query: 421 T-----GPPAVEVTSAEQAKELIDANTVIVFGFF 507
                  P  +E+TSA   KE  +++ + +   F
Sbjct: 254 VDVSAPAPEIIELTSANILKEACESHPLCIISVF 287



 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +2

Query: 101 EENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +ENV+ L+  NF E V+ + E  LVEF+APWCGHCK+L P + +AA +L
Sbjct: 145 KENVIELTDRNFNEKVLNSQEPWLVEFFAPWCGHCKNLKPHWDQAAREL 193



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 17/47 (36%), Positives = 31/47 (65%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           + ++V+ L+  NF+ V ++ +   + FYAPWCGH K+ A ++ + AT
Sbjct: 20  SHDDVIELTDQNFDKVSSSNDLWFIMFYAPWCGHSKNAAADWKRFAT 66


>UniRef50_UPI0000D574C8 Cluster: PREDICTED: similar to Protein
           disulfide-isomerase precursor (PDI); n=1; Tribolium
           castaneum|Rep: PREDICTED: similar to Protein
           disulfide-isomerase precursor (PDI) - Tribolium
           castaneum
          Length = 138

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 29/70 (41%), Positives = 45/70 (64%)
 Frame = +2

Query: 44  LIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           LI +  + LG    DE PTE+ +L+L++ NF+  ++  E ++V+FY PWC HCK+ APEY
Sbjct: 11  LISSTFSFLGGGKKDEFPTEDGILILNQFNFKEAVSHHELLMVKFYLPWCSHCKAFAPEY 70

Query: 224 AKAATKLAEE 253
            K    L ++
Sbjct: 71  LKVCKILEKQ 80



 Score = 60.1 bits (139), Expect = 7e-08
 Identities = 25/59 (42%), Positives = 40/59 (67%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           ++S IKL +VDAT E+ L     + G+P L+ F+ G PI Y+G R+A+ I++WL + +G
Sbjct: 80  QQSKIKLGQVDATVEKALVREQEIGGFPALRLFKGGYPITYTGLRKAEHIVAWLNRNSG 138


>UniRef50_Q7YY73 Cluster: Protein disulphide isomerase, probable;
           n=4; Cryptosporidium|Rep: Protein disulphide isomerase,
           probable - Cryptosporidium parvum
          Length = 481

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 40/92 (43%), Positives = 56/92 (60%), Gaps = 2/92 (2%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRN-GSPIDYSGGRQADDIISWLKKKTGPPA 435
           P+    VDAT+  +LA+ YGV GYPT+KFF    S  +YSG R  D  I ++KK TG PA
Sbjct: 85  PVHCGSVDATENMELAQQYGVSGYPTIKFFSGIDSVQNYSGARSKDAFIKYIKKLTG-PA 143

Query: 436 VEVTSAEQAKELIDANTVIVF-GFFWTRAQPE 528
           V+V  +E+A + I A++   F G F ++   E
Sbjct: 144 VQVAESEEAIKTIFASSSSAFVGRFTSKDSAE 175



 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 22/57 (38%), Positives = 37/57 (64%), Gaps = 1/57 (1%)
 Frame = +2

Query: 83  GDEVP-TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           GDE     E++  L+ +NFE  I + E+++V F+APWCGHC +L PE+     ++++
Sbjct: 25  GDEAHFISEHITSLTSSNFEDFIKSKEHVIVTFFAPWCGHCTALEPEFKATCAEISK 81



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 3/60 (5%)
 Frame = +2

Query: 86  DEVPTEEN---VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           + +P E++    +V+ K   E V  + + +L+E YA WCGHCK+L P Y +   +  + D
Sbjct: 353 EPIPAEQSGPVTVVVGKTFEEIVFRSDKDVLLEIYAQWCGHCKNLEPIYNQLGEEYKDND 412


>UniRef50_A0BR04 Cluster: Chromosome undetermined scaffold_121,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_121,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 457

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 35/80 (43%), Positives = 47/80 (58%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           R   I LAK+DAT ++ LAE YGV+GYPT+KF    +  D+ GGR AD I +W+     P
Sbjct: 69  RPEGIVLAKIDATVQKKLAEKYGVKGYPTIKFSAKQAVKDFEGGRNADGIKNWIYSNLNP 128

Query: 430 PAVEVTSAEQAKELIDANTV 489
            +  + + EQ  E I  N V
Sbjct: 129 ESELLDTLEQVNEAIAQNNV 148



 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 29/68 (42%), Positives = 46/68 (67%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           ++LL  A+  +   + +V+VL++  F+      +Y++ EFYAPWCGHCK LAP+YA+AAT
Sbjct: 7   LSLLAFAVVADYEYDGDVMVLTEETFDQAFNEFDYLMFEFYAPWCGHCKELAPKYAEAAT 66

Query: 239 KLAEEDLL 262
            L  E ++
Sbjct: 67  ALRPEGIV 74


>UniRef50_Q0JD21 Cluster: Os04g0436300 protein; n=3; Oryza
           sativa|Rep: Os04g0436300 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 293

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 33/75 (44%), Positives = 49/75 (65%)
 Frame = +2

Query: 35  MRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA 214
           + +LI ++   +G+   +E+  +E VL L   NF  V+    +I+V+FYAPWCGHCK LA
Sbjct: 11  LAILISSSPTAVGVDATEEL--KEAVLTLDAGNFSEVVAKHPFIVVKFYAPWCGHCKQLA 68

Query: 215 PEYAKAATKLAEEDL 259
           PEY KAA+ L + +L
Sbjct: 69  PEYEKAASILRKNEL 83



 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 37/87 (42%), Positives = 56/87 (64%), Gaps = 4/87 (4%)
 Frame = +1

Query: 259 PIKLAKVDATQEQ--DLAESYGVRGYPTLKFFRNG-SPI-DYSGGRQADDIISWLKKKTG 426
           P+ LAKVDA  E+  +L + YGV  YPT+K  +NG S +  Y G R+AD I+ +LK++ G
Sbjct: 84  PVVLAKVDAYNERNKELKDKYGVYSYPTIKIMKNGGSDVRGYGGPREADGIVEYLKRQVG 143

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P ++++ SAE+A   +    VI+ G F
Sbjct: 144 PASLKLESAEEAAHSVVDKGVILVGVF 170


>UniRef50_A7S406 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 267

 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 31/72 (43%), Positives = 47/72 (65%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S I +AK+DAT    ++  YGVRG+PT+KF +    I+Y G R A DII + +K +GP  
Sbjct: 72  SSINVAKLDATVYSGISREYGVRGFPTIKFIKGKKVINYEGDRTAQDIIQFAQKASGPAV 131

Query: 436 VEVTSAEQAKEL 471
            E+TS E+ +++
Sbjct: 132 RELTSGEELRKV 143



 Score = 43.2 bits (97), Expect = 0.009
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKL 244
           LVEFYAPWCG+C+ L P Y + A  L
Sbjct: 44  LVEFYAPWCGYCRKLEPVYEEVAKTL 69


>UniRef50_O15735 Cluster: Protein disulfide isomerase precursor;
           n=3; Dictyostelium discoideum|Rep: Protein disulfide
           isomerase precursor - Dictyostelium discoideum (Slime
           mold)
          Length = 363

 Score = 69.7 bits (163), Expect = 9e-11
 Identities = 32/71 (45%), Positives = 46/71 (64%)
 Frame = +2

Query: 35  MRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA 214
           M++L+F  + L+ LA       E NV+VLS  NF+TV+  ++ + V+FYAPWCGHCK LA
Sbjct: 1   MKILLF--VTLIALAFVALCSAEGNVVVLSPDNFDTVVDGSKTVFVKFYAPWCGHCKKLA 58

Query: 215 PEYAKAATKLA 247
           P++   A   A
Sbjct: 59  PDFEILADTFA 69



 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           NV+ LS +NF++V+   ++ +LVEFYAPWCGHCK L P+Y       A E
Sbjct: 143 NVVDLSPSNFDSVVLDKSKNVLVEFYAPWCGHCKKLMPDYEILGNTYANE 192



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 3/53 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQD--LAESYGVRGYPTLKFF-RNGSPIDYSGGRQADDIISWL 411
           + +AKVD  Q  +  L   Y V GYPTLK F ++ +  DY+G R  D++++++
Sbjct: 75  VVIAKVDCDQADNKALCSKYDVSGYPTLKIFDKSTTAKDYNGARSVDELLTYI 127



 Score = 39.9 bits (89), Expect = 0.085
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 4/59 (6%)
 Frame = +1

Query: 262 IKLAKVD--ATQEQDLAESYGVRGYPTLKFFRNGSP--IDYSGGRQADDIISWLKKKTG 426
           + +AK+D  A   + +   YGV G+PTLK+F   S     Y  GR  D  I+++ K+ G
Sbjct: 195 VVIAKIDCDAADNKAICSKYGVTGFPTLKWFGKQSKDGEKYEQGRDLDTFINYINKQAG 253


>UniRef50_A0DGP2 Cluster: Chromosome undetermined scaffold_5, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_5,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 397

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 217
           +LIF+ +A    AL +    +  V+ L+K NF+T V+ + E  LVEFYAPWCGHCK+LAP
Sbjct: 7   LLIFSLVATQSFALYE---ADSKVVKLTKDNFKTLVLESNEPWLVEFYAPWCGHCKALAP 63

Query: 218 EYAKAATKL 244
           EY KAA  L
Sbjct: 64  EYNKAAKAL 72



 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 28/60 (46%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +2

Query: 56  AIALLGLALGDEVPTEEN-VLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           A+  LG+ +  E   +++ V+VL+ A+F E V+++ E   VEFYAPWCGHCK L PE+ K
Sbjct: 135 ALNRLGVEIKPEPSNDDSKVVVLTDADFDEQVLSSQEAWFVEFYAPWCGHCKQLQPEWNK 194



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKK 420
           + +  +D T + +  + YGV GYPT+K+F    G PI Y G R+ + II +L  K
Sbjct: 76  VHIGALDMTTDGEAGQPYGVNGYPTIKYFGVNKGDPIAYEGERKKNAIIDYLLDK 130



 Score = 43.2 bits (97), Expect = 0.009
 Identities = 20/60 (33%), Positives = 37/60 (61%), Gaps = 4/60 (6%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID----YSGGRQADDIISWLKKK 420
           ++ I +AKVDAT +++LA  + +  YPT+ FF  G+  +    Y G R A  ++ ++K++
Sbjct: 198 QADIPIAKVDATAQKELASKFNIESYPTIYFFPAGNKQNTHKKYEGERNAAALLKYIKEQ 257


>UniRef50_P38658 Cluster: Probable protein disulfide-isomerase ER-60
           precursor; n=3; Schistosoma|Rep: Probable protein
           disulfide-isomerase ER-60 precursor - Schistosoma
           mansoni (Blood fluke)
          Length = 484

 Score = 68.9 bits (161), Expect = 2e-10
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTG 426
           + + +KL KVD T ++ +   +GV GYPTLK FRNG    +Y+G R A+ I +++  + G
Sbjct: 66  KTNDVKLVKVDCTTQESICSEFGVSGYPTLKIFRNGDLDGEYNGPRNANGIANYMISRAG 125

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFFWTRAQP 525
           P + EV++    + ++  +   VF F  + + P
Sbjct: 126 PVSKEVSTVSDVENVLSDDKPTVFAFVKSSSDP 158



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 24/42 (57%), Positives = 30/42 (71%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           VL L+K NF + + +    LV+FYAPWCGHCK LAPE+  AA
Sbjct: 19  VLELTKDNFHSELKSIPVALVKFYAPWCGHCKKLAPEFTSAA 60



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = +2

Query: 86  DEVPTEENVLV--LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           + +PT+++  V  L   NF+ ++   E  ++V F+A WCGHCK+L P+Y +AA+K+  E
Sbjct: 350 EPLPTDDSSAVKKLVALNFDEIVNNEEKDVMVVFHAGWCGHCKNLMPKYEEAASKVKNE 408



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 3/54 (5%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKK 420
           LA +DAT   D+   Y VRG+PT+ F   G   SP+ Y GGR  +DII +L ++
Sbjct: 413 LAAMDATAN-DVPSPYQVRGFPTIYFVPKGKKSSPVSYEGGRDTNDIIKYLARE 465


>UniRef50_A0BSE8 Cluster: Chromosome undetermined scaffold_125,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_125,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 472

 Score = 68.1 bits (159), Expect = 3e-10
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 1/71 (1%)
 Frame = +2

Query: 41  VLIFTAIALLGLAL-GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           +L F  + ++GL++ G   P + +VLVL+       I   +Y+LVEFYA WCGHCK  AP
Sbjct: 1   MLKFLILCVIGLSVFGYTFPYDGDVLVLNDNTINAAIKQYDYLLVEFYASWCGHCKQFAP 60

Query: 218 EYAKAATKLAE 250
           EY++ AT++ E
Sbjct: 61  EYSQFATQVKE 71



 Score = 35.9 bits (79), Expect = 1.4
 Identities = 18/72 (25%), Positives = 32/72 (44%)
 Frame = +1

Query: 313 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVI 492
           Y V  +PT+     G  + Y+G R A  +++++ +      V V   +   + +  NT+ 
Sbjct: 92  YKVSSFPTIILLIKGHAVPYNGDRSASGLMNFVTQALEDKLVRVDEIDDVYKFLSDNTLS 151

Query: 493 VFGFFWTRAQPE 528
           V  F     QPE
Sbjct: 152 VLYFVKDSQQPE 163



 Score = 35.9 bits (79), Expect = 1.4
 Identities = 17/72 (23%), Positives = 34/72 (47%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           ++F+ D      + +   A++  +  F   +     K  + ++  +VLF+ FEE+R ++ 
Sbjct: 153 LYFVKDSQQPELQIYSLAAKIFPNLKFGYTTSAYARKLYDVDEGQIVLFRTFEERRKEFT 212

Query: 675 DEEITEDLLNAL 710
           D    E L N L
Sbjct: 213 DSITLEKLTNFL 224


>UniRef50_O22263 Cluster: Probable protein disulfide-isomerase A6
           precursor; n=21; Magnoliophyta|Rep: Probable protein
           disulfide-isomerase A6 precursor - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 361

 Score = 67.7 bits (158), Expect = 4e-10
 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%)
 Frame = +2

Query: 104 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +NV+VL+  NF E V+   + +LVEFYAPWCGHCKSLAP Y K AT   +E+
Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEE 192



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 35/75 (46%), Positives = 47/75 (62%), Gaps = 2/75 (2%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           I+   ALL L L   V   ++V+VL+  +FE  +   +  LVEFYAPWCGHCK LAPEY 
Sbjct: 6   IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63

Query: 227 K--AATKLAEEDLLS 265
           K  A+ K A+  L++
Sbjct: 64  KLGASFKKAKSVLIA 78



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 426
           + +A +DA   + L E YGV G+PTLKFF   N +  DY GGR  DD +S++ +K+G
Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426
           + +AKVD  +++ +   YGV GYPT+++F  GS  P  Y G R A+ +  ++ K+ G
Sbjct: 75  VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131


>UniRef50_UPI0000E49DA6 Cluster: PREDICTED: similar to
           ENSANGP00000020140; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to ENSANGP00000020140
           - Strongylocentrotus purpuratus
          Length = 399

 Score = 67.3 bits (157), Expect = 5e-10
 Identities = 29/48 (60%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           ++V+ L+  NFE  V+ + + +LVEF+APWCGHCKSLAPE+AKAAT+L
Sbjct: 163 DDVVELTDGNFEKEVLNSKDGVLVEFFAPWCGHCKSLAPEWAKAATEL 210



 Score = 66.5 bits (155), Expect = 9e-10
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query: 98  TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           T ++V+ L+ ANF + VI   E  LVEFYAPWCGHCK+LAPE+ KAAT L
Sbjct: 19  TSDDVVELTAANFNQKVINGDEVWLVEFYAPWCGHCKNLAPEWKKAATAL 68



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 31/83 (37%), Positives = 41/83 (49%), Gaps = 7/83 (8%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-----SPIDYSGGRQADDIISWL-- 411
           +  +KL  +DAT     A  Y VRGYPTL++F  G     S  +Y GGR A  I++W   
Sbjct: 211 KGKMKLGALDATVHTVTASRYNVRGYPTLRYFPAGVKDANSAEEYDGGRTATAIVAWALD 270

Query: 412 KKKTGPPAVEVTSAEQAKELIDA 480
           K     P  EV    + K L D+
Sbjct: 271 KFSANIPPPEVMELIEQKVLTDS 293



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 2/49 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDII 402
           +K+  VD      +   Y VRG+PT+K F     SP DY+G R A  II
Sbjct: 72  VKVGAVDMDVHSSVGAPYNVRGFPTIKVFGANKASPTDYNGARTATGII 120


>UniRef50_A5C1Q6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 530

 Score = 67.3 bits (157), Expect = 5e-10
 Identities = 27/51 (52%), Positives = 36/51 (70%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           E V+ L  +NF   +   ++I+VEFYAPWCGHC+ LAPEY KAA+ L+  D
Sbjct: 30  EFVVTLDYSNFTETVAKQDFIVVEFYAPWCGHCQQLAPEYEKAASVLSSHD 80



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 4/87 (4%)
 Frame = +1

Query: 259 PIKLAKV--DATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 426
           PI LAKV  D    + L + + ++G+PTL   ++G     +Y G   AD I+++LK++ G
Sbjct: 82  PIILAKVNGDDAANRQLGQKFDIKGFPTLFIVKDGGKKVQEYXGPPDADGIVNYLKRQLG 141

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P + E+ S+E A   ID   V + G F
Sbjct: 142 PASTEIKSSEDAATFIDEKGVAIVGVF 168



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 18/39 (46%), Positives = 25/39 (64%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           E V  + + +L+EFYAPWCGHC+ LAP   +AA     +
Sbjct: 423 EIVFNSGKNVLIEFYAPWCGHCQRLAPILEEAAVSFQND 461



 Score = 37.5 bits (83), Expect = 0.45
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 1/54 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF-RNGSPIDYSGGRQADDIISWLKKK 420
           I +AK+DAT   D+ + + V G+PT+ F   NG  ++Y G    + II ++K+K
Sbjct: 464 IIIAKLDATVN-DIPKKFKVEGFPTMYFKPANGELVZYXGDATKEAIIDFIKEK 516


>UniRef50_A1YUM1 Cluster: NUK7; n=1; Phytophthora infestans|Rep:
           NUK7 - Phytophthora infestans (Potato late blight
           fungus)
          Length = 425

 Score = 67.3 bits (157), Expect = 5e-10
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +2

Query: 35  MRVLIFTAIALLGLALGDEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSL 211
           +R+ +    AL    L D  P  ++V +L+  NFE  V+ + +Y LVEFYAPWCGHCK L
Sbjct: 5   VRLALLLLSALTACVLADYGP-RDSVTILTDKNFEKEVLQSPDYWLVEFYAPWCGHCKQL 63

Query: 212 APEYAKAATKL 244
            P+Y  AA KL
Sbjct: 64  EPQYKAAAKKL 74



 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 7/74 (9%)
 Frame = +1

Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLK-----KKT 423
           +L  VDAT  Q LA  Y ++GYPT+K F  +   P DY GGR   +I+ ++K     KK 
Sbjct: 79  RLGAVDATVHQQLAHKYQIKGYPTIKEFGAKKKRPQDYRGGRTTREIVQYVKNSPEAKKL 138

Query: 424 GPPAVEVTSAEQAK 465
           G     V + E  K
Sbjct: 139 GASGGNVATLEYDK 152


>UniRef50_Q4E3F7 Cluster: Protein disulfide isomerase, putative;
           n=3; Trypanosoma cruzi|Rep: Protein disulfide isomerase,
           putative - Trypanosoma cruzi
          Length = 481

 Score = 66.9 bits (156), Expect = 6e-10
 Identities = 27/79 (34%), Positives = 51/79 (64%), Gaps = 1/79 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 444
           +  VD T+E +LA+ Y ++G+PT+  FR+G  ++ Y GGR++ DI++++K   G   V V
Sbjct: 72  MVDVDCTKESNLAQKYSIKGFPTIILFRDGKEVEHYKGGRKSSDIVNYVKANLGTAVVHV 131

Query: 445 TSAEQAKELIDANTVIVFG 501
            +AE+ ++L + +  +  G
Sbjct: 132 ETAEELEKLREEHNAVCVG 150



 Score = 57.6 bits (133), Expect = 4e-07
 Identities = 23/45 (51%), Positives = 34/45 (75%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V+  +  +F+ VI++ E  LV+FYAPWCGHC+ LAPE+ KAA ++
Sbjct: 22  VVEATDKDFDDVISSGEIALVKFYAPWCGHCQKLAPEWEKAAKEI 66



 Score = 57.6 bits (133), Expect = 4e-07
 Identities = 22/58 (37%), Positives = 37/58 (63%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           E+ T E +  +     +  +++ + +L+EF+APWCGHCK+LAP YAK A +    D++
Sbjct: 346 EIETVEGLTTVVGKTLDKYLSSGKDMLIEFFAPWCGHCKNLAPIYAKVAKEFESSDVI 403



 Score = 34.7 bits (76), Expect = 3.2
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFF-RNGSPIDYSGGRQADDIISWL 411
           S + +A +DAT  Q     + V G+PT+ F    G PI Y GGR   +I  ++
Sbjct: 400 SDVIIAAMDATANQMDNSLFDVSGFPTIYFVPHGGKPIMYDGGRTFYEIYKFV 452


>UniRef50_Q7XZ51 Cluster: Protein disulfide isomerase 1; n=1;
           Griffithsia japonica|Rep: Protein disulfide isomerase 1
           - Griffithsia japonica (Red alga)
          Length = 235

 Score = 66.5 bits (155), Expect = 9e-10
 Identities = 34/81 (41%), Positives = 49/81 (60%), Gaps = 3/81 (3%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAVEV 444
           L  +DAT E++LAE Y +RG+PTLK F  G  I DY GGR  D +I ++++   P  VE 
Sbjct: 73  LVDLDATVEKELAEKYEIRGFPTLKLFSKGELISDYKGGRTKDALIKYIERAMLPSVVEC 132

Query: 445 TSAEQAKELID--ANTVIVFG 501
              E  K+ ++  A+  +VFG
Sbjct: 133 EDEEAVKKFMEDNADKTLVFG 153



 Score = 64.1 bits (149), Expect = 5e-09
 Identities = 27/62 (43%), Positives = 44/62 (70%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +++L   L   V  +++V+V +K NF  +I+  E +LV+F+APWCGHCK +AP++ +AAT
Sbjct: 6   LSVLIALLVTTVFADDDVIVGTKDNFNDLISKDELVLVKFFAPWCGHCKKMAPDFKEAAT 65

Query: 239 KL 244
            L
Sbjct: 66  AL 67


>UniRef50_Q9TWZ1 Cluster: Protein disulphide isomerase
           isoform/multifunctional endoplasmic reticulum luminal
           polypeptide; n=8; Endopterygota|Rep: Protein disulphide
           isomerase isoform/multifunctional endoplasmic reticulum
           luminal polypeptide - Drosophila melanogaster (Fruit
           fly)
          Length = 489

 Score = 66.5 bits (155), Expect = 9e-10
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = +1

Query: 259 PIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPP 432
           PIKLAKVD T+  ++    Y V GYPTLK FR      DY+G R +  I  +++ + GP 
Sbjct: 74  PIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPRDSSGIAKYMRAQVGPA 133

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           +  V +  + K+ +D     +FG+F
Sbjct: 134 SKTVRTVAELKKFLDTKDTTLFGYF 158



 Score = 63.7 bits (148), Expect = 6e-09
 Identities = 28/52 (53%), Positives = 35/52 (67%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +E+VL L   +F T +   E  LV FYAPWCGHCK L PEYAKAA  + ++D
Sbjct: 21  DEDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDD 72



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           V V    NF+  VI   +  L+EFYAPWCGHCK L P Y + A KL +ED+
Sbjct: 366 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLTPIYEELAQKLQDEDV 416



 Score = 43.2 bits (97), Expect = 0.009
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 3/56 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK 420
           + + K+DAT   D+   + VRG+PTL +        P+ Y+GGR+ DD + ++ K+
Sbjct: 416 VAIVKMDATAN-DVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKE 470


>UniRef50_Q9N4L6 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 447

 Score = 66.5 bits (155), Expect = 9e-10
 Identities = 32/90 (35%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 438
           PI++ K+D T+   +A    ++GYPT+ FFRNG  IDY GGR+ + ++S+  K+   P +
Sbjct: 78  PIRVGKLDCTRFPAVANKLSIQGYPTILFFRNGHVIDYRGGREKEALVSF-AKRCAAPII 136

Query: 439 EVTSAEQAKEL-IDANTVIVFGFFWTRAQP 525
           EV +  Q +++ + A +   + FF T + P
Sbjct: 137 EVINENQIEKVKLSARSQPSYVFFGTSSGP 166



 Score = 40.7 bits (91), Expect = 0.049
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           VEFYAPWC HCK L P + +    L++ +L
Sbjct: 48  VEFYAPWCAHCKRLHPVWDQVGHTLSDSNL 77


>UniRef50_A2XPL0 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 157

 Score = 66.1 bits (154), Expect = 1e-09
 Identities = 29/75 (38%), Positives = 44/75 (58%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 220
           +L+  +      A  +E P +  V+ L +++FE  +   +Y+ V+FYAPWCGHCK LAPE
Sbjct: 21  LLLLLSFHAAAAAAAEEFPRDGRVIELDESSFEAALGAIDYLFVDFYAPWCGHCKRLAPE 80

Query: 221 YAKAATKLAEEDLLS 265
             + + KL E D  S
Sbjct: 81  -VEGSEKLEEGDQAS 94


>UniRef50_Q8I8E1 Cluster: Disulfide isomerase PDI; n=4;
           Leishmania|Rep: Disulfide isomerase PDI - Leishmania
           major
          Length = 477

 Score = 66.1 bits (154), Expect = 1e-09
 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 444
           LA+VD T+E+ LAE Y ++G+PTL  FRNG  +  Y G R A  I S++K   GP    +
Sbjct: 71  LAEVDCTKEESLAEKYEIKGFPTLYIFRNGEKVKIYDGPRTAAGIASYMKAHVGPSMKAI 130

Query: 445 TSAEQAKEL 471
           ++AE+ +EL
Sbjct: 131 STAEELEEL 139



 Score = 60.5 bits (140), Expect = 6e-08
 Identities = 33/68 (48%), Positives = 41/68 (60%)
 Frame = +2

Query: 44  LIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           L+F   ALL      EV       V +K NF+ V+   +  LV+FYAPWCGHCK+LAPE+
Sbjct: 6   LVFVLCALLFCVASAEVQ------VATKDNFDKVVIG-DLTLVKFYAPWCGHCKTLAPEF 58

Query: 224 AKAATKLA 247
            KAA  LA
Sbjct: 59  VKAADMLA 66



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 3/64 (4%)
 Frame = +2

Query: 80  LGDEVPTEENVLVLSKA---NFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           + D +P +E V  L+      F      T+ +++ FYAPWCGHCK L P Y K A     
Sbjct: 342 MSDAIPAKETVNGLTTVVGQTFAKYTDGTQNVMLLFYAPWCGHCKKLHPVYDKVAKSFES 401

Query: 251 EDLL 262
           E+++
Sbjct: 402 ENVI 405



 Score = 41.9 bits (94), Expect = 0.021
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLK 414
           +AK+DAT      E + V G+PT+ F   G  PI Y GGR AD+I  ++K
Sbjct: 406 IAKMDATTNDFDREKFEVSGFPTIYFIPAGKPPIVYEGGRTADEIQVFVK 455


>UniRef50_Q6C781 Cluster: Similar to sp|P55059 Humicola insolens
           Protein disulfide isomerase; n=1; Yarrowia
           lipolytica|Rep: Similar to sp|P55059 Humicola insolens
           Protein disulfide isomerase - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 504

 Score = 66.1 bits (154), Expect = 1e-09
 Identities = 29/64 (45%), Positives = 39/64 (60%)
 Frame = +2

Query: 68  LGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L +AL   +    +V+ L   NF   +T  + +L EF+APWCGHCK LAPEY  AAT L 
Sbjct: 6   LTIALMGALAAASDVVKLDSDNFADFVTDNKLVLAEFFAPWCGHCKQLAPEYESAATILK 65

Query: 248 EEDL 259
           E+ +
Sbjct: 66  EKGI 69



 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 3/84 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID---YSGGRQADDIISWLKKKTGPP 432
           I + KVD T+ ++L   + ++GYPTLK FR GS  D   Y   R ++ I+ +L K+  P 
Sbjct: 69  IPIGKVDCTENEELCSKFEIQGYPTLKIFR-GSEEDSSLYQSARTSEAIVQYLLKQALPL 127

Query: 433 AVEVTSAEQAKELIDANTVIVFGF 504
             E  + ++       N V +  F
Sbjct: 128 VSEFANEKELNAFTKDNDVTIVAF 151



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           +V+ K   + V+   + +L+EFYAPWCGHCK LAP Y
Sbjct: 365 IVVGKNYKDIVLDDDKDVLIEFYAPWCGHCKILAPIY 401


>UniRef50_Q5EUD0 Cluster: Protein disulfide isomerase; n=4;
           Poaceae|Rep: Protein disulfide isomerase - Zea mays
           (Maize)
          Length = 529

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 29/84 (34%), Positives = 47/84 (55%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S +  AK+D  +    A + GV+G+PT+  F NG+   Y G    D I++W++KKTG P 
Sbjct: 116 SAVAFAKLDGERYPKAAAAVGVKGFPTVLLFVNGTEHAYHGLHTKDAIVTWVRKKTGEPI 175

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
           + + S + A+E +  +   V G F
Sbjct: 176 IRLQSKDSAEEFLKKDMTFVIGLF 199


>UniRef50_A3LVR0 Cluster: Predicted protein; n=3;
           Saccharomycetaceae|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 310

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 3/75 (4%)
 Frame = +2

Query: 38  RVLIFTAIALL--GLALGDEVPTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKS 208
           RV++F +IAL     A GDE  ++ N+  L+ +NF+ VI  T Y  +V+FYAPWCG+C+ 
Sbjct: 5   RVILFLSIALSVSARAEGDEYASDPNIYELTPSNFDKVIQKTNYTSIVKFYAPWCGYCQQ 64

Query: 209 LAPEYAKAATKLAEE 253
           L P Y K    L ++
Sbjct: 65  LKPAYKKLGKYLHQD 79


>UniRef50_Q15084 Cluster: Protein disulfide-isomerase A6 precursor;
           n=54; Eumetazoa|Rep: Protein disulfide-isomerase A6
           precursor - Homo sapiens (Human)
          Length = 440

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 36/87 (41%), Positives = 51/87 (58%), Gaps = 6/87 (6%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW---LKKK 420
           +  +KLA VDAT  Q LA  YG+RG+PT+K F+ G SP+DY GGR   DI+S    L   
Sbjct: 212 KGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSD 271

Query: 421 TGPP--AVEVTSAEQAKELIDANTVIV 495
             PP   +E+ + + AK   + + + V
Sbjct: 272 NAPPPELLEIINEDIAKRTCEEHQLCV 298



 Score = 59.7 bits (138), Expect = 1e-07
 Identities = 28/60 (46%), Positives = 39/60 (65%), Gaps = 1/60 (1%)
 Frame = +2

Query: 74  LALGDEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           LA+     + ++V+ L+ +NF   VI +    LVEFYAPWCGHC+ L PE+ KAAT L +
Sbjct: 15  LAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKD 74



 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 23/53 (43%), Positives = 41/53 (77%), Gaps = 1/53 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           ++++V+ L+  +F+  +  +E + +VEFYAPWCGHCK+L PE+A AA+++ E+
Sbjct: 158 SKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQ 210



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDII 402
           +K+  VDA +   L   YGV+G+PT+K F      P DY GGR  + I+
Sbjct: 76  VKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIV 124


>UniRef50_Q92249 Cluster: Protein disulfide-isomerase erp38
           precursor; n=18; Pezizomycotina|Rep: Protein
           disulfide-isomerase erp38 precursor - Neurospora crassa
          Length = 369

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/81 (37%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 426
           +  +++AKVDA  E+ L + +GV+G+PTLKFF  ++  P+DY GGR  D + +++ +KTG
Sbjct: 71  KDKVQIAKVDADAERALGKRFGVQGFPTLKFFDGKSEQPVDYKGGRDLDSLSNFIAEKTG 130

Query: 427 PPAVEVTSAEQAKELIDANTV 489
             A +  SA     +++  T+
Sbjct: 131 VKARKKGSAPSLVNILNDATI 151



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 28/62 (45%), Positives = 40/62 (64%), Gaps = 1/62 (1%)
 Frame = +2

Query: 62  ALLGLALGDEVPTEENVLVLSKANFETVITTT-EYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +L+  +L   V  +  VL L  +NF+ V+  + +  LVEF+APWCGHCK+LAP Y + AT
Sbjct: 6   SLVVASLAAAVAAKSAVLDLIPSNFDDVVLKSGKPTLVEFFAPWCGHCKNLAPVYEELAT 65

Query: 239 KL 244
            L
Sbjct: 66  AL 67



 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 30/60 (50%), Positives = 40/60 (66%), Gaps = 5/60 (8%)
 Frame = +1

Query: 262 IKLAKVDA---TQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426
           I +AKVDA   T ++  AE YGV G+PT+KFF  GS  P DY+GGR   D++ +L +K G
Sbjct: 193 ITIAKVDADAPTGKKSAAE-YGVSGFPTIKFFPKGSTTPEDYNGGRSEADLVKFLNEKAG 251



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 21/48 (43%), Positives = 29/48 (60%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V +L+ A  +  I   + +LV F APWCGHCK+LAP + K A   A +
Sbjct: 143 VNILNDATIKGAIGGDKNVLVAFTAPWCGHCKNLAPTWEKLAATFASD 190


>UniRef50_A0E0N2 Cluster: Chromosome undetermined scaffold_72, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_72,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 162

 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 25/51 (49%), Positives = 36/51 (70%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           E NV++L   NF+  +   E +LV+FYAPWC HC++L PE+ KAAT+  E+
Sbjct: 30  ESNVVILDADNFDAALMRFEVLLVDFYAPWCPHCQNLMPEFEKAATQFKEQ 80



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLK 414
           ++S I L KVD T E  L + + VRGYPTL+ F +     Y G R A+ II +++
Sbjct: 80  QQSIITLGKVDCTHESVLCDEFKVRGYPTLRIFYHDRIYHYHGDRNAEGIIDFME 134


>UniRef50_A0BDV3 Cluster: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 417

 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 33/79 (41%), Positives = 47/79 (59%), Gaps = 5/79 (6%)
 Frame = +2

Query: 32  EMRVLIFTAIALLGLALGDEVPT----EENVLVLSKANF-ETVITTTEYILVEFYAPWCG 196
           ++R   F  +  +    G++ P     E +V+VL+  N  ET++ + +   VEFYAPWCG
Sbjct: 139 QIRDFAFKRVGKVPKKQGEKTPEPQIDESDVIVLTDDNLDETILNSKDSWFVEFYAPWCG 198

Query: 197 HCKSLAPEYAKAATKLAEE 253
           HCK LAPE+AK AT L  E
Sbjct: 199 HCKKLAPEWAKLATALKGE 217



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 6/61 (9%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAES-YGVRGYPTLKFFRNGSPID-----YSGGRQADDIISWLK 414
           +  +K+AK+DA+ E    +  Y V G+PT++FF  G  +D     + G R  + ++++ +
Sbjct: 215 KGEVKVAKIDASGEGSKTKGKYKVEGFPTIRFFGAGEKVDGDFESFDGARDFNTLLNYAR 274

Query: 415 K 417
           +
Sbjct: 275 E 275


>UniRef50_Q9C1Z8 Cluster: Protein disulphide isomerase; n=1; Pichia
           pastoris|Rep: Protein disulphide isomerase - Pichia
           pastoris (Yeast)
          Length = 517

 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 27/73 (36%), Positives = 47/73 (64%), Gaps = 2/73 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISWLKKKTGPPA 435
           +K+A++D T+E++L + Y ++GYPTLK F      P DY G RQ+  I+S++ K++ PP 
Sbjct: 85  VKIAQIDCTEEKELCQGYEIKGYPTLKVFHGEVEVPSDYQGQRQSQSIVSYMLKQSLPPV 144

Query: 436 VEVTSAEQAKELI 474
            E+ + +   + I
Sbjct: 145 SEINATKDLDDTI 157



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 25/54 (46%), Positives = 37/54 (68%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           P + +V+ L++A FE+ IT+  ++L EF+APWCGHCK L PE   AA  L + +
Sbjct: 30  PEDSHVVKLTEATFESFITSNPHVLAEFFAPWCGHCKKLGPELVSAAEILKDNE 83



 Score = 57.6 bits (133), Expect = 4e-07
 Identities = 23/56 (41%), Positives = 37/56 (66%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           E+  E+   ++ KA+ E V   ++ +LV++YAPWCGHCK +AP Y + AT  A ++
Sbjct: 370 EIQEEKVFKLVGKAHDEVVFDESKDVLVKYYAPWCGHCKRMAPAYEELATLYANDE 425


>UniRef50_Q00248 Cluster: Protein disulfide-isomerase precursor;
           n=39; cellular organisms|Rep: Protein
           disulfide-isomerase precursor - Aspergillus oryzae
          Length = 515

 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 27/57 (47%), Positives = 42/57 (73%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           E P++  V+ L+   FET +   + +L EF+APWCGHCK+LAP+Y +AAT+L E+++
Sbjct: 26  EAPSD--VVSLTGDTFETFVKEHDLVLAEFFAPWCGHCKALAPKYEQAATELKEKNI 80



 Score = 62.9 bits (146), Expect = 1e-08
 Identities = 32/82 (39%), Positives = 48/82 (58%), Gaps = 1/82 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAV 438
           I L KVD T+E+ L    GV GYPTLK FR    +  Y G RQ + I+S++ K++  PAV
Sbjct: 80  IPLVKVDCTEEEALCRDQGVEGYPTLKIFRGLDAVKPYQGARQTEAIVSYMVKQS-LPAV 138

Query: 439 EVTSAEQAKELIDANTVIVFGF 504
              + E  +E+   + ++V G+
Sbjct: 139 SPVTPENLEEIKTMDKIVVIGY 160



 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 19/42 (45%), Positives = 32/42 (76%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +V++ +  + V+   + +L+EFYAPWCGHCK+LAP+Y + A+
Sbjct: 367 VVVAHSYKDLVLDNEKDVLLEFYAPWCGHCKALAPKYEELAS 408



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTGPP 432
           + +AK+DAT   D+ +S  + G+PT+K F  G   SP++Y G R  +D+ +++ K+ G  
Sbjct: 416 VTIAKIDATAN-DVPDS--ITGFPTIKLFAAGAKDSPVEYEGSRTVEDLANFV-KENGKH 471

Query: 433 AVEVTSAEQAKE 468
            V+    +  KE
Sbjct: 472 KVDALEVDPKKE 483



 Score = 37.9 bits (84), Expect = 0.34
 Identities = 18/47 (38%), Positives = 28/47 (59%)
 Frame = +3

Query: 561 DDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEEITEDLL 701
           D+ +FA  SD  + K    +   +VL+K+F+EK+  Y D EI +D L
Sbjct: 181 DNYLFAATSDASIAKAEGVKQPSIVLYKDFDEKKATY-DGEIEQDAL 226


>UniRef50_Q22XT0 Cluster: Protein disulfide-isomerase domain
           containing protein; n=3; Oligohymenophorea|Rep: Protein
           disulfide-isomerase domain containing protein -
           Tetrahymena thermophila SB210
          Length = 430

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 33/63 (52%), Positives = 42/63 (66%), Gaps = 1/63 (1%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           ++LLG AL         V+ L+K+ F+  VI + E  LVEF+APWCGHCKSLAPE+ KAA
Sbjct: 11  LSLLGTALA-LYDNNSKVIKLNKSRFQNEVINSKELWLVEFFAPWCGHCKSLAPEWEKAA 69

Query: 236 TKL 244
             L
Sbjct: 70  KAL 72



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 27/58 (46%), Positives = 38/58 (65%), Gaps = 5/58 (8%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-----SPIDYSGGRQADDIISWLKKK 420
           +K+AKVDAT    +A+ +GV GYPT+KFF  G       +DY+GGR A  + SW K++
Sbjct: 216 VKVAKVDATVHPKVAQRFGVNGYPTIKFFPAGFSSDSEAVDYNGGRDASSLGSWAKEQ 273



 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query: 107 NVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +V+VL+  NF+  V+ + E   +EFYAPWCGHCK+L PE+ K AT++  E
Sbjct: 165 DVVVLTDDNFDANVVGSKEPWFIEFYAPWCGHCKNLQPEWNKLATEMKTE 214



 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 20/51 (39%), Positives = 34/51 (66%), Gaps = 2/51 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISW 408
           +K+  VD T +Q++   Y ++G+PT+KFF      P DY+ GR A+D+I++
Sbjct: 76  VKVGAVDMTTDQEVGSPYNIQGFPTIKFFGDNKSKPQDYNSGRTANDLINY 126


>UniRef50_Q96W60 Cluster: Protein disulfide isomerase family member;
           n=1; Aspergillus fumigatus|Rep: Protein disulfide
           isomerase family member - Aspergillus fumigatus
           (Sartorya fumigata)
          Length = 364

 Score = 64.1 bits (149), Expect = 5e-09
 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +2

Query: 44  LIFTAIALLGLALGDEVP-TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 220
           L+ + +    +A  D    T  +V+ L+K +F+  +   + +L EFYAPWCGHCK+LAP+
Sbjct: 7   LVLSLLGASAVASADATADTTSDVVSLTKDSFKDFMKEHDLVLAEFYAPWCGHCKALAPK 66

Query: 221 YAKAATKLAEEDL 259
           Y +AAT+L  +++
Sbjct: 67  YEEAATELKGKNI 79



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)
 Frame = +1

Query: 271 AKVDATQEQDLAESYGVRGYPTLKF-FR-NGSPIDYSGGRQADDIISWLKKKTGPP 432
           AK+D T        YGV G+PT+KF F+ +   +D + GR   D +S+L +KTG P
Sbjct: 207 AKIDNTNAT--VPDYGVSGFPTIKFSFKVSTESVDVNHGRSEQDFVSFLNEKTGIP 260



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = +2

Query: 158 EYILVEFYAPWCGHCKSLAPEYAKAA 235
           E +   FYAPWCGHCK LAP+Y + A
Sbjct: 166 EDVQAAFYAPWCGHCK-LAPKYDELA 190



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 29/84 (34%), Positives = 40/84 (47%), Gaps = 4/84 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFR---NGSPIDYSGGRQADDIISWLKKKTGPP 432
           I L KVD T+E+DL +  GV G    K  R   N  P  Y G R+   + S  K      
Sbjct: 79  IPLVKVDCTEEEDLCKENGVEGILLSKNLRGPDNSKP--YQGARRLTRLSSTWKTVPTRR 136

Query: 433 AVEV-TSAEQAKELIDANTVIVFG 501
            V+V TS  +  +++D N V+  G
Sbjct: 137 GVKVRTSRLEPTKVMDLNDVLFGG 160


>UniRef50_P17967 Cluster: Protein disulfide-isomerase precursor;
           n=6; Saccharomycetales|Rep: Protein disulfide-isomerase
           precursor - Saccharomyces cerevisiae (Baker's yeast)
          Length = 522

 Score = 64.1 bits (149), Expect = 5e-09
 Identities = 25/55 (45%), Positives = 38/55 (69%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           P +  V+ L+  +F   I + + +L EF+APWCGHCK++APEY KAA  L E+++
Sbjct: 29  PEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNI 83



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 3/66 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN---GSPIDYSGGRQADDIISWLKKKTGPP 432
           I LA++D T+ QDL   + + G+P+LK F+N    + IDY G R A+ I+ ++ K++  P
Sbjct: 83  ITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQS-QP 141

Query: 433 AVEVTS 450
           AV V +
Sbjct: 142 AVAVVA 147



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/44 (45%), Positives = 27/44 (61%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           ++ K + E V    + +LV +YAPWCGHCK LAP Y + A   A
Sbjct: 381 LVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYA 424


>UniRef50_Q4T338 Cluster: Chromosome undetermined SCAF10125, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF10125,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 547

 Score = 63.7 bits (148), Expect = 6e-09
 Identities = 35/111 (31%), Positives = 54/111 (48%), Gaps = 2/111 (1%)
 Frame = +1

Query: 181 CSMVRPLQISGTGIRQGSNKAG*-RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG 357
           C  + P         +G+  AG   R+ I L +VD T   +    +GV GYPTLK FR+G
Sbjct: 58  CKKLAPAFQKAASRLKGTVSAGEVTRALIHLLQVDCTASTETCSRFGVSGYPTLKIFRSG 117

Query: 358 -SPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFF 507
                Y G R AD I  ++K++TGP ++ + + E  +  +      + G F
Sbjct: 118 KDSAPYDGPRSADGIYEYMKRQTGPDSLHLRTDEDLQSFVSNYDASIIGVF 168



 Score = 60.5 bits (140), Expect = 6e-08
 Identities = 25/47 (53%), Positives = 35/47 (74%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           ++VL L  A+F+ +    E +LV+FYAPWCGHCK LAP + KAA++L
Sbjct: 26  QDVLELGDADFDYLAKEHETMLVKFYAPWCGHCKKLAPAFQKAASRL 72



 Score = 34.7 bits (76), Expect = 3.2
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKL 244
           LV FY+P C HCK L P Y + A K+
Sbjct: 405 LVLFYSPTCPHCKKLEPVYRELARKV 430


>UniRef50_Q54BW3 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 417

 Score = 63.3 bits (147), Expect = 8e-09
 Identities = 27/78 (34%), Positives = 43/78 (55%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S +K+A+V+    Q +   Y ++GYPT+K+F  G   DY G R  +  I++L   +  P 
Sbjct: 75  SKVKIAQVNCVDNQSVCSKYEIKGYPTIKYFSEGEIKDYRGSRDKNSFITYLDSMSKSPI 134

Query: 436 VEVTSAEQAKELIDANTV 489
           + + S EQ KE +  N V
Sbjct: 135 LNIESKEQLKEKLKENKV 152



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 30/81 (37%), Positives = 47/81 (58%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           +FT+I  L L +      E+  +V   ++   +I T  + LVEF+APWCGHCK LAP Y 
Sbjct: 4   LFTSIFALFLLVCVAFSEEKTTVVQVTSDNSDIIPTGNW-LVEFFAPWCGHCKRLAPVYE 62

Query: 227 KAATKLAEEDLLSN*RKLTQL 289
           + A +L   D+ ++  K+ Q+
Sbjct: 63  ELA-QLYNVDIENSKVKIAQV 82


>UniRef50_UPI00015564A7 Cluster: PREDICTED: similar to Protein
           disulfide isomerase family A, member 2, partial; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           Protein disulfide isomerase family A, member 2, partial
           - Ornithorhynchus anatinus
          Length = 147

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 27/53 (50%), Positives = 38/53 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           D+V  E ++LVL + NF+  +    Y+LVEFYAP C HC++LAPE++KAA  L
Sbjct: 48  DKVLEEGDILVLHRHNFDLALRAHPYLLVEFYAPGCRHCQALAPEFSKAAALL 100



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDY 372
           S ++LAKVD   E++L+E + V G+P LK F+ G+   P+DY
Sbjct: 105 SELRLAKVDGVVEKELSEEFAVGGFPALKLFKLGNRSDPVDY 146


>UniRef50_UPI0000E479E2 Cluster: PREDICTED: similar to protein
           disulfide isomerase, partial; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to protein disulfide
           isomerase, partial - Strongylocentrotus purpuratus
          Length = 553

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 25/57 (43%), Positives = 39/57 (68%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           E+   ENV  +  + FE+ +T++  +L+ FYAPWCGHCK + P +A+AAT   E++L
Sbjct: 294 ELDGGENVFQIDDSIFESFLTSSPSVLIMFYAPWCGHCKRMKPAFAEAATLAKEQNL 350



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 25/56 (44%), Positives = 34/56 (60%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           +E  V  L+  NF++     ++ LV FYAPWCGHCK   PEY  AA +  EE+ +S
Sbjct: 165 SESEVDHLTDDNFKSFTKKKKHTLVMFYAPWCGHCKKAKPEYMGAAEEFKEENKVS 220



 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 29/65 (44%), Positives = 41/65 (63%), Gaps = 1/65 (1%)
 Frame = +1

Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVE 441
           KLA VD T E+ L E Y V+G+PTL  + NG  ++ Y+GGR A+D  ++++K   P   E
Sbjct: 476 KLAAVDCTVEKGLCEQYEVKGFPTLNLYSNGQFVEKYTGGRMAEDFEAYMQKTELP---E 532

Query: 442 VTSAE 456
            TS E
Sbjct: 533 QTSEE 537



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGP 429
           +  A +D T+ +D   ++GV GYPT+K+F  G  + DY+ GR+  D I ++  +  P
Sbjct: 219 VSYAAIDCTEHKDSCTAFGVTGYPTIKYFSYGKLVQDYTSGREEADFIRFMHNQLSP 275



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 1/59 (1%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKKTGPP 432
           P + A VDAT     A ++ V+G+PTLK+F+NG   + YSG R A+ ++ ++K     P
Sbjct: 351 PGRFAAVDATVAVMTASAFEVKGFPTLKYFKNGKEDMTYSGARTAEALLEFIKDPASVP 409



 Score = 45.6 bits (103), Expect = 0.002
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPP 432
           +  VDAT+ + LAE + V+G+PTLK+F+NG        R AD  +  L     PP
Sbjct: 99  MGAVDATKARALAERFEVKGFPTLKYFKNGEHAWDLNERTADKFVEHLTDPQEPP 153



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 20/49 (40%), Positives = 27/49 (55%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           +VP+  N L  +   F   I    ++L  FYAPWCGHCK   P + +AA
Sbjct: 420 DVPSAVNHL--TGQTFGQFIQDNTHVLTMFYAPWCGHCKKAKPSFQQAA 466



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSP 363
           +  VDAT+ + LAE + V+G+PTLK+F    P
Sbjct: 27  MGAVDATKARALAERFEVKGFPTLKYFNPQEP 58



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +2

Query: 191 CGHCKSLAPEYAKAATKLAEEDL 259
           CGHCK + PEY +AA +L E  L
Sbjct: 1   CGHCKKMKPEYVEAAAELKENGL 23


>UniRef50_Q4Q9C8 Cluster: Protein disulfide isomerase, putative;
           n=3; Leishmania|Rep: Protein disulfide isomerase,
           putative - Leishmania major
          Length = 377

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 28/69 (40%), Positives = 43/69 (62%), Gaps = 6/69 (8%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEE------NVLVLSKANFETVITTTEYILVEFYAPWCGH 199
           R+ +  A+ L+   L     +E+       ++ +SK NF+ ++   + +LVEFYAPWCGH
Sbjct: 4   RLSVVLALVLVVFVLAGSCSSEDPGAVMPGIVQMSKDNFDQLVGKEKAVLVEFYAPWCGH 63

Query: 200 CKSLAPEYA 226
           CKS+APEYA
Sbjct: 64  CKSMAPEYA 72



 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 3/75 (4%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTGPPAVE 441
           + KVDATQ+ DL + +GV G+PT+ +F  GS  P  Y GGR A+D   +L        + 
Sbjct: 90  VGKVDATQDSDLGKRFGVTGFPTILYFAPGSLEPEKYKGGRTAEDFAKYLSSAIAGLRLT 149

Query: 442 VTSAEQ-AKELIDAN 483
           +    Q A EL+  N
Sbjct: 150 IPIEPQFAMELVHTN 164



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = +2

Query: 50  FTAIALLGLALGDEVPTEEN-VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEY 223
           + + A+ GL L   +P E    + L   NF+ V+   ++ +LV FYAPWCGHCK+L P Y
Sbjct: 138 YLSSAIAGLRL--TIPIEPQFAMELVHTNFDAVVKDPSKAVLVMFYAPWCGHCKALKPIY 195


>UniRef50_Q4CMH3 Cluster: Protein disulfide isomerase, putative;
           n=2; Trypanosoma cruzi|Rep: Protein disulfide isomerase,
           putative - Trypanosoma cruzi
          Length = 163

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 23/53 (43%), Positives = 37/53 (69%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           + V+ L  +N++ +I  ++Y+ VEFYA WCGHC+  APE+AK A  + E++ L
Sbjct: 51  KGVVELQPSNYDEIIGQSKYVFVEFYATWCGHCRRFAPEFAKLAAMVQEDEAL 103


>UniRef50_Q10057 Cluster: Putative protein disulfide-isomerase
           C1F5.02 precursor; n=1; Schizosaccharomyces pombe|Rep:
           Putative protein disulfide-isomerase C1F5.02 precursor -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 492

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 32/84 (38%), Positives = 50/84 (59%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAV 438
           I L +VD T+E DL   Y +RGYPTL  F+NG  I  YSG R+ D ++ +++K+   P V
Sbjct: 73  ISLVEVDCTEEGDLCSEYSIRGYPTLNVFKNGKQISQYSGPRKHDALVKYMRKQL-LPTV 131

Query: 439 EVTSAEQAKELID-ANTVIVFGFF 507
           +  S +  +  ++ A+ + V  FF
Sbjct: 132 KPISKDTLENFVEKADDLAVVAFF 155



 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 25/53 (47%), Positives = 40/53 (75%), Gaps = 1/53 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           ++E+++VL   NF+ ++   T+ +LVEFYAPWCGHCK+LAP Y K A + +++
Sbjct: 353 SQEDLVVLVADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLAEEYSDD 405



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 22/47 (46%), Positives = 34/47 (72%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           ++K     +IT  + ++V+FYAPWCGHCK+LAPEY  AA +L ++ +
Sbjct: 27  VNKEGLNELITADKVLMVKFYAPWCGHCKALAPEYESAADELEKDGI 73



 Score = 37.9 bits (84), Expect = 0.34
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKK 417
           S + +AK+DAT E D++ S  + G+PT+ FF+     +P+ Y G R  +D+ +++ K
Sbjct: 406 SNVVVAKIDAT-ENDISVS--ISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFIDK 459


>UniRef50_P12865 Cluster: Bloodstream-specific protein 2 precursor;
           n=3; Trypanosoma brucei|Rep: Bloodstream-specific
           protein 2 precursor - Trypanosoma brucei brucei
          Length = 497

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 444
           + +VD   + +LA ++ +RGYPT+  FRNG   + Y G R  DDII ++K   GP     
Sbjct: 71  MGEVDCHSQPELAANFSIRGYPTIILFRNGKEAEHYGGARTKDDIIKYIKANVGPAVTPA 130

Query: 445 TSAEQAKELIDANTVIVFG 501
           ++AE+     + + V+  G
Sbjct: 131 SNAEEVTRAKEEHDVVCVG 149



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 28/69 (40%), Positives = 39/69 (56%)
 Frame = +2

Query: 56  AIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           AI L+ LAL     +    L L+K NF   I  +E  LV+FY   CG+C+ LAPE+ KAA
Sbjct: 3   AIFLVALALATMRESTAESLKLTKENFNETIAKSEIFLVKFYVDTCGYCQMLAPEWEKAA 62

Query: 236 TKLAEEDLL 262
            +  +  L+
Sbjct: 63  NETIDNALM 71



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           EV T +    +     +  +T+ + +L+ F+APWCGHCK+ AP + K A +    DL+
Sbjct: 344 EVETVDGKTTIVAKTMQKHLTSGKDMLILFFAPWCGHCKNFAPTFDKIAKEFDATDLI 401


>UniRef50_Q9LQG5 Cluster: F15O4.20; n=13; Magnoliophyta|Rep:
           F15O4.20 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 473

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 27/55 (49%), Positives = 37/55 (67%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           D+   +  VL L+ +NF++ I+T + I V+FYAPWCGHCK L PE   AA  LA+
Sbjct: 26  DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAK 80



 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPP 432
           + PI +AK++A +   LA    +  +PTL  + +G P++Y G R+AD ++ +LKK   P 
Sbjct: 82  KQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPD 141

Query: 433 AVEVTSAEQAKELI-DANT 486
              + S    KE + DA T
Sbjct: 142 VAVLESDSTVKEFVEDAGT 160


>UniRef50_Q5XWD1 Cluster: Protein disulfide isomerase; n=2;
           Entamoeba histolytica|Rep: Protein disulfide isomerase -
           Entamoeba histolytica
          Length = 337

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 22/43 (51%), Positives = 33/43 (76%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           +V+ L+  NF T++  ++++ V+F+APWCGHCK LAPEY K A
Sbjct: 16  DVVSLNPTNFNTIVDGSKHVFVKFFAPWCGHCKKLAPEYIKLA 58



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 32/93 (34%), Positives = 53/93 (56%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 RSPIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKK 420
           +  I +A++D   +  +DL   +G+ G+PTLKFFR G+  PI+Y GGR  +D+  ++++K
Sbjct: 64  KQDIVIAELDCDNKDHKDLCGKFGISGFPTLKFFRKGTTEPIEYEGGRTVEDLSHFIQEK 123

Query: 421 TGPPA----VEVTSAEQAKELIDANTVIVFGFF 507
             P A    V VT+A     ++D    +   FF
Sbjct: 124 IQPKAPSNVVSVTTATFDSIVMDPTKNVFVKFF 156



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 22/51 (43%), Positives = 37/51 (72%), Gaps = 1/51 (1%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           NV+ ++ A F++++   T+ + V+F+APWCGHCK+LAP+Y + +   A ED
Sbjct: 131 NVVSVTTATFDSIVMDPTKNVFVKFFAPWCGHCKALAPKYIEVSKMYAGED 181



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 3/56 (5%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKKTG 426
           +A+VD T  Q+    Y V GYPTLK F    N  PI Y GGR+  D +++     G
Sbjct: 185 VAEVDCTANQETCNKYEVHGYPTLKSFPKGENKKPIAYEGGREVKDFVTYFNTNYG 240


>UniRef50_A7RMG9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 363

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 24/42 (57%), Positives = 31/42 (73%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           T+  V+ L+K NF+ V+   ++ LVEFYAPWCGHCK LAP Y
Sbjct: 20  TQGKVIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTY 61



 Score = 60.1 bits (139), Expect = 7e-08
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426
           S + +AKVDA  ++DL   + V+G+PT+K+F  GS  P +Y+GGR  +D I ++++KTG
Sbjct: 72  SDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIEEKTG 130



 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 21/46 (45%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +2

Query: 119 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           L ++NF+ ++   +  +LVEF+APWCGHCK+LAP Y K       E
Sbjct: 145 LDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKNE 190



 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 426
           +AKVDA     L + YGV GYPTLKFF   N    +YS GR     + ++ +K G
Sbjct: 195 IAKVDADAHSALGQKYGVSGYPTLKFFSKTNKDGEEYSSGRDEQSFVDFMNEKCG 249


>UniRef50_Q9LRF6 Cluster: Thioredoxin; n=1; Chlorella vulgaris|Rep:
           Thioredoxin - Chlorella vulgaris (Green alga)
          Length = 216

 Score = 60.9 bits (141), Expect = 4e-08
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +2

Query: 86  DEVPTEEN--VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +E P + +  V V++   F+ ++   + +L+EFYAPWCGHCKSLAP Y +  TK A+ +
Sbjct: 76  EEAPKDNSGPVKVVTANTFDEIVLGGKDVLIEFYAPWCGHCKSLAPIYEELGTKFADNE 134


>UniRef50_Q869Z0 Cluster: Similar to Aspergillus niger. PDI related
           protein A; n=2; Dictyostelium discoideum|Rep: Similar to
           Aspergillus niger. PDI related protein A - Dictyostelium
           discoideum (Slime mold)
          Length = 409

 Score = 60.9 bits (141), Expect = 4e-08
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +2

Query: 107 NVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           NV+ L+K NF+  V+ + +  +VEFYAPWCGHCKSL PEY K +  L
Sbjct: 28  NVINLTKKNFQQQVLNSQQNWMVEFYAPWCGHCKSLKPEYEKVSNNL 74



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 7/78 (8%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF-------RNGSPIDYSGGRQADDIISWLKKK 420
           +K+  ++  +E++L   Y ++G+PTLKFF       + G P DY G R A +I  +   K
Sbjct: 78  VKIGAINCDEEKELCGQYQIQGFPTLKFFSTNPKTGKKGQPEDYQGARSASEIAKFSLAK 137

Query: 421 TGPPAVEVTSAEQAKELI 474
                ++  S +   + +
Sbjct: 138 LPSNHIQKVSQDNINKFL 155


>UniRef50_Q4MZU0 Cluster: Protein disulfide isomerase, putative;
           n=2; Theileria|Rep: Protein disulfide isomerase,
           putative - Theileria parva
          Length = 538

 Score = 60.9 bits (141), Expect = 4e-08
 Identities = 25/59 (42%), Positives = 40/59 (67%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           +S +  AKV   +  +L E + VRG+PTL FF+NG+ ++YSG R A  ++SW+K+ + P
Sbjct: 88  KSDVVFAKVRNEEGVNLMERFNVRGFPTLYFFKNGTEVEYSGSRDAPGLVSWVKELSTP 146



 Score = 60.5 bits (140), Expect = 6e-08
 Identities = 29/76 (38%), Positives = 46/76 (60%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  IEMRVLIFTAIALLGLALGDEVPTE-ENVLVLSKANFETVITTTEYILVEFYAPWCGHCK 205
           + + +L  +     G +L  E   E ++V VL+   F+  +T  + ++V+FYA WC HCK
Sbjct: 12  VYLLILFPSGFFFSGSSLFCEAKNETDDVKVLTDDTFDKFLTENKLVMVKFYADWCVHCK 71

Query: 206 SLAPEYAKAATKLAEE 253
           +LAPEY+KAA  L +E
Sbjct: 72  NLAPEYSKAAKMLKDE 87



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%)
 Frame = +2

Query: 86  DEVPTEEN--VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           +E P E +  V V+     E +  + + +L+  +AP C HCK+  P Y + AT   + D 
Sbjct: 413 EEEPKENDGPVKVVVGNTLEKLFDSKKNVLLMIHAPHCQHCKNFLPVYTEFATVNKDNDS 472

Query: 260 L 262
           L
Sbjct: 473 L 473


>UniRef50_A7S9T0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 349

 Score = 60.5 bits (140), Expect = 6e-08
 Identities = 25/54 (46%), Positives = 36/54 (66%), Gaps = 1/54 (1%)
 Frame = +2

Query: 86  DEVPTEENVLV-LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           D VP +E  L+ L  +NFE  +   +++LV+FYAPWC HCK +AP+Y   A +L
Sbjct: 4   DGVPDDEPTLLELDDSNFEPAVQKHKFVLVDFYAPWCFHCKKMAPDYKDVAKEL 57


>UniRef50_Q503X6 Cluster: Zgc:110025; n=3; Clupeocephala|Rep:
           Zgc:110025 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 434

 Score = 60.1 bits (139), Expect = 7e-08
 Identities = 25/79 (31%), Positives = 43/79 (54%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           SP+ + K+D T    +A  + +RGYPT+K F+     DY G R  D II +  + +GP  
Sbjct: 67  SPVNVGKIDTTAHTSIATEFNIRGYPTIKLFKGDLSFDYKGPRTKDGIIEFTNRVSGPVV 126

Query: 436 VEVTSAEQAKELIDANTVI 492
             ++S +  + ++  + VI
Sbjct: 127 RPLSSVQLFQHVMSRHDVI 145



 Score = 37.1 bits (82), Expect = 0.60
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +2

Query: 140 TVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           T     E  LVEFYAPWC +C +  P + +   +L
Sbjct: 28  TEFRQNELWLVEFYAPWCAYCHTFEPVWTEVGAEL 62


>UniRef50_Q5A5F2 Cluster: Likely protein disulfide isomerase; n=5;
           Saccharomycetales|Rep: Likely protein disulfide
           isomerase - Candida albicans (Yeast)
          Length = 560

 Score = 60.1 bits (139), Expect = 7e-08
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +2

Query: 83  GDEVPTEENVLV-LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           GD V    + +V L+  NF + I     IL EF+APWCG+CK L PEY+KAA  L E
Sbjct: 29  GDAVADPNSAVVKLTSENFASFIEENPLILAEFFAPWCGYCKMLGPEYSKAADSLNE 85



 Score = 59.7 bits (138), Expect = 1e-07
 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 3/78 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTGPP 432
           IKLA++D T+++ L   +G+RGYPTLK  R+G   +  DY G R+A  I  ++ K++ P 
Sbjct: 90  IKLAQIDCTEDEALCMEHGIRGYPTLKIIRDGDSKTAEDYQGPREAAGIADYMIKQSLPA 149

Query: 433 AVEVTSAEQAKELIDANT 486
                + E+   LIDA T
Sbjct: 150 VQFPETFEELDTLIDAQT 167



 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = +2

Query: 29  IEMRVLIFTAIALLGLALGDEVPTEEN-----VLVLSKANFETVITTTEY-ILVEFYAPW 190
           IE  V  + A  L  +   + +PTEE      V+ L   N++ V+  T+  + V++YAPW
Sbjct: 362 IEKFVADYFADKLTPIIKSEPLPTEEEKSANPVVKLVAHNYKDVLEQTDKDVFVKYYAPW 421

Query: 191 CGHCKSLAPEYAKAA 235
           CGHCK LAP + + A
Sbjct: 422 CGHCKKLAPTWEELA 436



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 30/91 (32%), Positives = 44/91 (48%), Gaps = 10/91 (10%)
 Frame = +1

Query: 229 GSNKAG*RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFF-RNG---------SPIDYSG 378
           GSNK     + + +A +D T   D+   Y + GYPTL  F  NG          PI + G
Sbjct: 440 GSNKDD---AKVVVADIDHTNN-DVDVPYNIEGYPTLLMFPANGKVDEKTGIREPIVFEG 495

Query: 379 GRQADDIISWLKKKTGPPAVEVTSAEQAKEL 471
            R+ D +I ++K+K    A+ V  AE   +L
Sbjct: 496 PRELDTLIEFIKEK---GALNVDGAELKAKL 523


>UniRef50_Q54EN4 Cluster: Protein disulfide isomerase; n=1;
           Dictyostelium discoideum AX4|Rep: Protein disulfide
           isomerase - Dictyostelium discoideum AX4
          Length = 513

 Score = 59.7 bits (138), Expect = 1e-07
 Identities = 30/82 (36%), Positives = 43/82 (52%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           I +AKVD TQ + L +   V+GYPTL  F+NG    Y G R    I+  L+++  P    
Sbjct: 93  IAIAKVDCTQHEQLCKQNKVQGYPTLVVFKNGKAEPYEGDRTTKSIVQTLEEELKPTIST 152

Query: 442 VTSAEQAKELIDANTVIVFGFF 507
           + S E  +E    + + V GFF
Sbjct: 153 LESNEDIEEFKKQHPISVVGFF 174



 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 23/49 (46%), Positives = 31/49 (63%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           E  V +L   NF   ++  +  LV FYAPWCGHCK+L P Y +AA +L+
Sbjct: 40  ESFVKILDSDNFHNSVSEHDVTLVMFYAPWCGHCKTLKPLYEEAAKQLS 88



 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 21/41 (51%), Positives = 29/41 (70%)
 Frame = +2

Query: 143 VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           V+ + + +LVEFYAPWCGHCK+LAP Y K    L + + +S
Sbjct: 390 VLDSPKDVLVEFYAPWCGHCKNLAPIYDKLGEYLKDVESVS 430


>UniRef50_UPI0000D5742F Cluster: PREDICTED: similar to CG9911-PA,
           isoform A; n=2; Coelomata|Rep: PREDICTED: similar to
           CG9911-PA, isoform A - Tribolium castaneum
          Length = 406

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 2/91 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 435
           + + KVD  +E  +A  + +  YPTLK  RNG P   +Y G R  +   +++KK+   P 
Sbjct: 87  VVMGKVDCDKEGSVATRFHITKYPTLKVIRNGQPAKREYRGERSIEAFTNFIKKQLEDPV 146

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWTRAQPE 528
            E     +  E I++N  IV G+F  R QPE
Sbjct: 147 KEFKELRELNE-IESNKRIVIGYFDRRDQPE 176



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           PT+   + L++ N +  + + E + + FYA WC     L P + +A+ K+A+E
Sbjct: 28  PTDSGAVQLTQDNLDMTLASNELVFINFYAEWCRFSNILMPVFDEASDKIAQE 80


>UniRef50_Q5CGZ8 Cluster: Protein disulfide isomerase; n=2;
           Cryptosporidium|Rep: Protein disulfide isomerase -
           Cryptosporidium hominis
          Length = 556

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 25/76 (32%), Positives = 44/76 (57%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           R   + +AK++  +   + E Y +  YPT+KFFRN    +Y GGR+ ++I+ WLK++   
Sbjct: 73  RNIKVNVAKINGERNIKILEEYQINDYPTMKFFRNKVAEEYYGGREENEILEWLKEQVAF 132

Query: 430 PAVEVTSAEQAKELID 477
           P +E+      KE ++
Sbjct: 133 PVLELEKNMINKEKLE 148


>UniRef50_Q5KQ34 Cluster: Disulfide-isomerase, putative; n=1;
           Filobasidiella neoformans|Rep: Disulfide-isomerase,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 411

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 28/67 (41%), Positives = 40/67 (59%)
 Frame = +2

Query: 35  MRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA 214
           MR+ I  + ALL       + +  NV+ L   NF+ ++   +  LVEF+APWCGHCK+LA
Sbjct: 1   MRLSISISAALLAFT---SLVSASNVVDLDSTNFDQIVGQDKGALVEFFAPWCGHCKNLA 57

Query: 215 PEYAKAA 235
           P Y + A
Sbjct: 58  PTYERLA 64



 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426
           I L   D  + + +A+ YGV  +PT+KFF  GS  P+ Y  GR A+  ++W+ +K+G
Sbjct: 195 IALMDADEAENKPVAQRYGVSSFPTIKFFPKGSKEPVAYDSGRTAEQFVNWINEKSG 251



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +2

Query: 119 LSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           L  +NF+ + +  ++ +LV F APWCGHCK++ P Y K A   + E
Sbjct: 145 LDASNFDEIALNESKNVLVAFTAPWCGHCKNMKPAYEKVAKVFSSE 190



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/58 (39%), Positives = 37/58 (63%), Gaps = 3/58 (5%)
 Frame = +1

Query: 262 IKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426
           + +AK DA    ++L   +GV G+PTLK+F  GS  PI YSG R  + + +++ K++G
Sbjct: 72  VVIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLETLAAFVTKQSG 129


>UniRef50_A0DI01 Cluster: Chromosome undetermined scaffold_51, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_51,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 603

 Score = 58.8 bits (136), Expect = 2e-07
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           ++P E  V+ L++ NFE  V+ + + + V+FYAPWCGHCK++A +Y K A
Sbjct: 482 DIPNEGQVIQLTRENFEHFVLRSKQDVFVKFYAPWCGHCKAMAADYVKLA 531



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +2

Query: 110 VLVLSKANFE-TVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           V VL+ ANF+  V     ++ V+ YAPWCGHCK LAP Y + A +L  +D++
Sbjct: 351 VHVLTTANFKHQVYDNPNHVFVKIYAPWCGHCKKLAPAYEELAQQLNRKDIV 402



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 21/72 (29%), Positives = 39/72 (54%)
 Frame = +2

Query: 35  MRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA 214
           M+     A+ L+ L+  +++   + VL L++ NF+  +     +LV+FY   CG+CK + 
Sbjct: 1   MKYFFLLALVLVVLSR-EQIEEVDGVLQLTRKNFQQAVDENSRLLVKFYIDTCGYCKKMK 59

Query: 215 PEYAKAATKLAE 250
           P + + A  L E
Sbjct: 60  PVFIQLAGLLKE 71



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFR----NGSPIDYSGGRQADDIISWLKKK 420
           R  I +A+VD T   D  E   + GYPTL FF+        I++SG R A+ + +++ K 
Sbjct: 398 RKDIVIAEVDFTA--DRIEGIEIEGYPTLLFFKTEGGQKKKIEFSGERTAEGMKNFILKS 455

Query: 421 TGPPAVEVTSAEQAKELIDANTV 489
               +     ++  +E  D   +
Sbjct: 456 LDSDSKSEPESQLTEESQDVQEI 478


>UniRef50_Q9MAU6 Cluster: F13M7.3 protein; n=10; Magnoliophyta|Rep:
           F13M7.3 protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 443

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query: 119 LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           L+ +NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KAA  L
Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNL 210



 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 1/46 (2%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           VL L+ +NF++ V+ +   +LVEF+APWCGHC+SL P + K A+ L
Sbjct: 30  VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL 75



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 420
           +A +DA   + +++ YGVRG+PT+K F  G  PIDY G R A  I  +  K+
Sbjct: 81  VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 7/91 (7%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISW----LK 414
           +  +KL  V+   EQ +   + V+G+PT+  F +   SP+ Y G R A  I S+    L+
Sbjct: 211 KGKVKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLE 270

Query: 415 KKTGPPAV-EVTSAEQAKELIDANTVIVFGF 504
              GP  V E+T  +  ++   +  +    F
Sbjct: 271 SNAGPAEVTELTGPDVMEDKCGSAAICFVSF 301


>UniRef50_Q869Q9 Cluster: Similar to Acanthamoeba castellanii
           (Amoeba). Disulfide-like protein; n=2; Dictyostelium
           discoideum|Rep: Similar to Acanthamoeba castellanii
           (Amoeba). Disulfide-like protein - Dictyostelium
           discoideum (Slime mold)
          Length = 347

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 33/90 (36%), Positives = 53/90 (58%), Gaps = 13/90 (14%)
 Frame = +2

Query: 26  NIEMRVLIFTAIALLGLALG-------DEVPTEEN----VLVLSKANFETVITTT--EYI 166
           N +  +LIF  +++L + L        +EV   +N    V++L+ +NFE + T+   E  
Sbjct: 4   NFKFIILIFLIVSILFINLNNCQDNDNEEVDMNDNSNSDVIILTDSNFEDLTTSNPNETW 63

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +VEFYAPWC HCK+L   Y + +TKL ++D
Sbjct: 64  MVEFYAPWCFHCKNLKKTYDQLSTKLKQQD 93



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 13/52 (25%), Positives = 26/52 (50%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417
           +K+AK+D        + + +R YPT+K  +  S  D  G +  + +  ++ K
Sbjct: 96  LKVAKIDCVANPKQCKRFSIRSYPTIKVIKGNSVYDMKGEKTLNSLNEFINK 147


>UniRef50_A0CB24 Cluster: Chromosome undetermined scaffold_163,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_163,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 136

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 24/68 (35%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +2

Query: 50  FTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYA 226
           +  + +L +++  +V  E  V+ L+  NF++++  ++  +LV+F+APWCGHCK++A  Y 
Sbjct: 3   YLILLVLAISVFADVKNEGKVIELTSDNFKSIVLESKQDVLVKFFAPWCGHCKNMAEAYK 62

Query: 227 KAATKLAE 250
             A  LAE
Sbjct: 63  TLAANLAE 70


>UniRef50_O93914 Cluster: PDI related protein A; n=4;
           Pezizomycotina|Rep: PDI related protein A - Aspergillus
           niger
          Length = 464

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 29/70 (41%), Positives = 46/70 (65%), Gaps = 3/70 (4%)
 Frame = +2

Query: 44  LIFTAIALLGLALG-DEVPTEEN-VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLA 214
           L+F    L  L +  D + T+++ VL +++ N++ +I  + +  +VEFYAPWCGHC++L 
Sbjct: 8   LLFVTSLLAALPVNADGLYTKKSPVLQVNQKNYDQLIANSNHTSIVEFYAPWCGHCQNLK 67

Query: 215 PEYAKAATKL 244
           P Y KAAT L
Sbjct: 68  PAYEKAATNL 77


>UniRef50_Q8H703 Cluster: Protein disulfide-isomerase; n=1;
           Phytophthora infestans|Rep: Protein disulfide-isomerase
           - Phytophthora infestans (Potato late blight fungus)
          Length = 210

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 5/73 (6%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVI-----TTTEYILVEFYAPWCGHCK 205
           V +   +  L LA  D+  +  NV+VLS  +FE         TT   LVEFYAPWCGHCK
Sbjct: 9   VALLAFLGALQLAAADDAAS--NVIVLSNDDFEHKTQAGSGATTGDWLVEFYAPWCGHCK 66

Query: 206 SLAPEYAKAATKL 244
            L P Y K A++L
Sbjct: 67  KLVPIYEKVASEL 79



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLK 414
           +  + +AKVD T   +L + +G+RG+PTL  F +G    YSG R  +D+  + +
Sbjct: 80  KGQVNVAKVDVTANAELGKRFGIRGFPTLLHFSHGKSYKYSGKRTLEDLAEFAR 133


>UniRef50_Q9VJZ1 Cluster: CG9302-PA; n=7; Eumetazoa|Rep: CG9302-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 510

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 24/56 (42%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +E    + VL L   NF + +   ++ LV FYAPWCGHCK   PE+  AAT L ++
Sbjct: 390 EEEEDSKEVLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDD 445



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 22/54 (40%), Positives = 33/54 (61%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           T   ++ L+   FE  +   +  LV FYAPWCGHCK + PEY KAA ++ ++ +
Sbjct: 269 TNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKI 322



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 25/61 (40%), Positives = 37/61 (60%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           ++ P  LA +DAT+E  +AE Y V+GYPT+KFF NG        R+A  I+ +++    P
Sbjct: 320 KKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEFMRDPKEP 379

Query: 430 P 432
           P
Sbjct: 380 P 380



 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEY--ILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +E P  ++VL  S A   T     +   +LV FY PWCG CK + PEY KA+T+L
Sbjct: 137 EEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTEL 191



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN-GSPIDYSGGRQADDIISWL 411
           I    +D T+   L   Y VRGYPT+ +F    + +DY+GGR + D I+++
Sbjct: 448 IAFVAIDCTKLAALCAKYNVRGYPTILYFSYLKTKLDYNGGRTSKDFIAYM 498


>UniRef50_Q95TL8 Cluster: LD41494p; n=5; Endopterygota|Rep: LD41494p
           - Drosophila melanogaster (Fruit fly)
          Length = 412

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPA 435
           + L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P 
Sbjct: 89  VVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPI 148

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWTRAQPE 528
            E  S +  + L D+   ++ G+F  R QPE
Sbjct: 149 QEFKSLKDLENL-DSKKRLILGYFDRRDQPE 178



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+L L    +       + ++  N +  + + E + + FYA WC     LAP +A+AA 
Sbjct: 18  VAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAAD 77

Query: 239 KLAEE 253
           K+ EE
Sbjct: 78  KIKEE 82


>UniRef50_UPI0000498890 Cluster: protein disulfide isomerase; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: protein disulfide
           isomerase - Entamoeba histolytica HM-1:IMSS
          Length = 127

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 1/71 (1%)
 Frame = +2

Query: 53  TAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKA 232
           T  ALL +AL       E ++ L+  NF+T   + + +LV+F+APWCGHCK LAP Y + 
Sbjct: 3   TFFALLLIALVSA--NSEGLVSLNPDNFKTYQNSGKTLLVKFFAPWCGHCKRLAPTYEEV 60

Query: 233 ATKLAE-EDLL 262
           A    E ED++
Sbjct: 61  AQAFTENEDVI 71


>UniRef50_Q9XTU8 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 436

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           +++V  L+ +NF+  +  ++ I +VEFYAP+CGHCKSL PEY KAA  L
Sbjct: 23  KDSVFELTDSNFDAKVLKSDRIWIVEFYAPYCGHCKSLVPEYKKAAKLL 71



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V+VL+ +NF+  V+ + E  +VEF+APWCGHC+ L PE+ KAA ++
Sbjct: 156 VVVLTDSNFDKLVLNSKEPWMVEFFAPWCGHCQKLEPEWKKAAEEM 201



 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 10/91 (10%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-----DYSGGRQADDIISWLKKK-- 420
           +K   +DAT  + +A+ +G+RG+PT+KFF  G+       DY GGR + D+IS+ + K  
Sbjct: 205 VKFGALDATAHESIAQKFGIRGFPTIKFFAPGTSSASDAEDYQGGRTSTDLISYAESKYD 264

Query: 421 ---TGPPAVEVTSAEQAKELIDANTVIVFGF 504
                P  VE T     + +     + +F F
Sbjct: 265 DFGAAPEVVEGTGKAVVETVCKDKQLCIFTF 295



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 6/83 (7%)
 Frame = +1

Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKK---KTG 426
           ++  +DAT  Q +   Y ++GYPT+K F       PIDY+G R A  I   +KK   K+ 
Sbjct: 76  EIGAIDATVHQKIPLKYSIKGYPTIKIFGATEKSKPIDYNGPRTAKGIADAVKKSIEKSL 135

Query: 427 PPAVEVTSAEQAKELIDANTVIV 495
              ++  S+E++K+      V+V
Sbjct: 136 EQRLKGKSSEKSKKSDKKGKVVV 158


>UniRef50_Q96JJ7 Cluster: Protein disulfide-isomerase TXNDC10
           precursor; n=25; Euteleostomi|Rep: Protein
           disulfide-isomerase TXNDC10 precursor - Homo sapiens
           (Human)
          Length = 454

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 24/57 (42%), Positives = 35/57 (61%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           SP+K+ K+DAT    +A  +GVRGYPT+K  +     +Y G R  DDII +  + +G
Sbjct: 75  SPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSG 131



 Score = 41.1 bits (92), Expect = 0.037
 Identities = 14/17 (82%), Positives = 15/17 (88%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAP 217
           LV+FYAPWCGHCK L P
Sbjct: 45  LVDFYAPWCGHCKKLEP 61


>UniRef50_Q57WS0 Cluster: Protein disulfide isomerase, putative;
           n=3; Trypanosoma|Rep: Protein disulfide isomerase,
           putative - Trypanosoma brucei
          Length = 377

 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 23/42 (54%), Positives = 30/42 (71%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           E V+ L+  NF++ +      LVEFYAPWCGHCK+L PE+AK
Sbjct: 35  EGVVDLTSNNFDSSVGKDVAALVEFYAPWCGHCKNLVPEFAK 76



 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 2/58 (3%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKK 420
           +  + +AKVDAT ++DLA  + V GYPT+ FF  GS  P  YS GR+A   +S+L  +
Sbjct: 85  KDKVLIAKVDATAQKDLATRFEVNGYPTILFFPAGSQKPEKYSEGREAKAFVSYLNNQ 142



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 23/58 (39%), Positives = 36/58 (62%), Gaps = 5/58 (8%)
 Frame = +1

Query: 268 LAKVDATQEQ--DLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKKTG 426
           +A VDA  +   ++ + Y V GYPTL FF     G+P++Y  GR  DD+I ++ ++TG
Sbjct: 210 IANVDADDKSNSEVTKRYKVEGYPTLVFFPKGNKGNPVNYEEGRTLDDMIKFVNERTG 267



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)
 Frame = +2

Query: 92  VPTEEN-VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA-EEDLL 262
           +P E   V+ L ++NF+ V +   +   V FYAPWCGHCK L P +   A     E+DL+
Sbjct: 150 LPREHKYVMALDQSNFDKVALDEGKDAFVLFYAPWCGHCKRLHPSFESLAKVYQNEKDLI 209


>UniRef50_UPI0000E49F35 Cluster: PREDICTED: similar to Thioredoxin
           domain-containing protein 5 precursor (Thioredoxin-like
           protein p46) (Endoplasmic reticulum protein ERp46)
           (Plasma cell-specific thioredoxin-related protein)
           (PC-TRP); n=3; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Thioredoxin domain-containing
           protein 5 precursor (Thioredoxin-like protein p46)
           (Endoplasmic reticulum protein ERp46) (Plasma
           cell-specific thioredoxin-related protein) (PC-TRP) -
           Strongylocentrotus purpuratus
          Length = 685

 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 27/73 (36%), Positives = 45/73 (61%), Gaps = 2/73 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKT-GPPA 435
           + +AKVD T  + + + YGV+GYPTLKFF +G  ++ Y GGR    +  ++ K T G  A
Sbjct: 485 VTIAKVDCTAHRAVCDQYGVKGYPTLKFFTDGEAVESYKGGRDHVAMKEYVSKMTKGAEA 544

Query: 436 VEVTSAEQAKELI 474
             +  +E+A +++
Sbjct: 545 APLPGSEEAIKVV 557



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFF-RNGSPIDYSGGRQADDIISWLKKKTGPP 432
           S + +AKVD T+E  L   +GV GYPTLK + ++  P+ Y G R    + ++++K+  P 
Sbjct: 363 STVTIAKVDCTEETKLCSEHGVTGYPTLKLYKKDKEPLKYKGKRDFATLDAYIEKELNPQ 422

Query: 433 AVEVTSAEQAKELIDANTVIVF 498
             +V     AK  +   TV  F
Sbjct: 423 EADVPQVPAAKNGLYELTVATF 444



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 24/53 (45%), Positives = 31/53 (58%)
 Frame = +2

Query: 83  GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           G++   E  V+VLS  NF T  T     LV+FYAPWC HC+ L P + + A K
Sbjct: 566 GEQPAVESKVVVLSTNNFLTQ-TAKGTSLVKFYAPWCPHCQKLVPVWDELAEK 617



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = +2

Query: 89  EVPTEENVLV-LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           +VP  +N L  L+ A F+  +    +  ++FYAPWCGHCK LAP +   A      D+++
Sbjct: 428 QVPAAKNGLYELTVATFKDHVAKGNHF-IKFYAPWCGHCKRLAPTWDDLAKGFQHSDIVT 486



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 2/74 (2%)
 Frame = +2

Query: 26  NIEMRVLIFTAIALLGLAL--GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGH 199
           N+ M+ +    + + GL L  G+E     + L    A+F   I   ++  V+F+APWCGH
Sbjct: 285 NLVMKCVSLAVLVIFGLNLVCGEEEEASFD-LNYDTASFVEEIGKGDHF-VKFFAPWCGH 342

Query: 200 CKSLAPEYAKAATK 241
           C+ LAP +++ + K
Sbjct: 343 CQRLAPIWSQLSEK 356



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 3/59 (5%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQD--LAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKK 420
           R  + + KVD T E +  L + + + GYPTL  F++G  ++ +SG R    + ++LK K
Sbjct: 621 RKDVTIGKVDCTVETEKPLCKKHAIEGYPTLLLFKDGEMVEKHSGTRTLAALETYLKSK 679


>UniRef50_Q2HPL0 Cluster: Putative disulphide isomerase; n=1;
           Solanum tuberosum|Rep: Putative disulphide isomerase -
           Solanum tuberosum (Potato)
          Length = 250

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 2/55 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKK 420
           + +A+VDA   ++L   YGV  +PTLK+F  GS  P DY GGR  DD +++L +K
Sbjct: 51  VVVAEVDADSHKELGSKYGVTVFPTLKYFAKGSTEPEDYKGGRSEDDFVNFLNEK 105



 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           V  L++A+F+  VI + ++ +VEFYAPWCGHCK LAP Y +       ED
Sbjct: 119 VAALTEADFDAEVIHSKKHAIVEFYAPWCGHCKQLAPTYEEVGAIFEGED 168



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426
           + +AKVDAT   ++A  Y V+GYPTL +F  GS  P DYS GR     + ++ +  G
Sbjct: 170 VLIAKVDATANAEVASRYNVKGYPTLFYFPPGSDEPEDYSNGRDKASFVEFINEHAG 226



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = +2

Query: 143 VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           V+  ++++L++FYAPWC HCKS+ P Y   AT   + D
Sbjct: 12  VLDGSKHVLIKFYAPWCAHCKSMPPTYETVATAFKKAD 49


>UniRef50_Q582J4 Cluster: Protein disulfide isomerase, putative;
           n=1; Trypanosoma brucei|Rep: Protein disulfide
           isomerase, putative - Trypanosoma brucei
          Length = 135

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 24/71 (33%), Positives = 43/71 (60%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTE-YILVEFYAPWCGHCKSLAPE 220
           L+  ++A+  + +G      ++ + L+  NF+ V   TE ++ V FYAPWCGHCK L P+
Sbjct: 7   LLLLSVAIAFVTVGSFADEAKDSVELTPDNFDKVALDTEKHVFVMFYAPWCGHCKRLKPK 66

Query: 221 YAKAATKLAEE 253
           + + A ++ +E
Sbjct: 67  WEELAKEMKDE 77



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSP--IDYSGGRQADDIISWLK 414
           + +A++DA + +++AE + VRGYPTL  F       + Y G R    +  ++K
Sbjct: 80  VVIARLDADKHRNVAERFDVRGYPTLLLFARSKKEGLRYEGARDVAALKEFVK 132


>UniRef50_O97451 Cluster: Protein disulfide isomerase-1 precursor;
           n=2; Giardia intestinalis|Rep: Protein disulfide
           isomerase-1 precursor - Giardia lamblia (Giardia
           intestinalis)
          Length = 234

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 24/45 (53%), Positives = 30/45 (66%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V+ L K  F T+  +   + V FYAPWCGHCK+L PEYAKA  +L
Sbjct: 14  VVELGKDEFNTLRNSGASMSVVFYAPWCGHCKNLKPEYAKAGAEL 58



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 6/56 (10%)
 Frame = +1

Query: 262 IKLAKVDATQE----QDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWL 411
           + L  VD T E    +DL   + V+G+PT+K       S +DY+G R+A  + S++
Sbjct: 62  VDLYMVDCTNESNGGKDLCGEFDVQGFPTIKMINTEKDSVLDYNGAREAKALRSFV 117


>UniRef50_A6SJX8 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 507

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLA 247
           P    VL ++  +++ +I  + +  +VEFYAPWCGHCK+L P Y KAA  LA
Sbjct: 27  PKSSAVLSINGKDYDRLIAQSNHTSIVEFYAPWCGHCKNLQPAYEKAAKNLA 78



 Score = 38.3 bits (85), Expect = 0.26
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 8/80 (10%)
 Frame = +1

Query: 265 KLAKVDATQEQDLA--ESYGVRGYPTLKFFRNGS----PI--DYSGGRQADDIISWLKKK 420
           K+A VD  +E + A    +GV+G+PTLK  + GS    PI  DY+G R A  I+  +  K
Sbjct: 82  KVAAVDCDEESNKAFCGGFGVQGFPTLKIVKPGSKPGKPIVEDYNGPRTAKGIVDAVVDK 141

Query: 421 TGPPAVEVTSAEQAKELIDA 480
                  VT  +    L DA
Sbjct: 142 IPNLVKRVTDKDLESFLADA 161


>UniRef50_Q6BZZ7 Cluster: Similarities with tr|O93914 Aspergillus
           niger PDI related protein A; n=1; Yarrowia
           lipolytica|Rep: Similarities with tr|O93914 Aspergillus
           niger PDI related protein A - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 554

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 22/44 (50%), Positives = 31/44 (70%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V +K N   V+ + +  +VEFYAPWCGHC++L PEY KA+  L
Sbjct: 24  VVEAKGNLGPVLKSNKTSIVEFYAPWCGHCRNLLPEYVKASKGL 67


>UniRef50_A7S4E7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 363

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (3%)
 Frame = +2

Query: 101 EENVLV--LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           E++ LV  L  ++F   +  TE++LV FYAPWCGHCK+  P+Y KAA    ++
Sbjct: 236 EDSSLVKQLDGSDFWGYLNNTEHVLVMFYAPWCGHCKNAKPKYEKAAETFKDQ 288



 Score = 53.2 bits (122), Expect = 9e-06
 Identities = 22/56 (39%), Positives = 33/56 (58%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLSN 268
           +  V+ L+  + +  I + E +LV ++APWCGHC  + P Y KAA  L +ED   N
Sbjct: 118 DSKVVFLTDESHDEFIKSHENVLVMYFAPWCGHCNEMKPNYYKAAQVLHDEDANCN 173



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAVEV 444
           LA VD T+ +D+A+   + GYPT+K ++NG    +Y G R   D++ ++  +T     + 
Sbjct: 174 LAAVDCTKHKDVAKKVALAGYPTVKLYKNGKVAKEYEGDRSEKDLVLFM--RTASNTAKA 231

Query: 445 TSAEQAKELI 474
            SAE+   L+
Sbjct: 232 ASAEEDSSLV 241



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLK--KKTGPP 432
           LA VD T+ ++      ++GYPTL++ R G     Y+G R A+ ++S++K  KK  PP
Sbjct: 51  LAAVDCTESKNTCNQRDIKGYPTLQYIREGEFQFKYTGRRTAEALVSFMKDPKKPAPP 108



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +1

Query: 271 AKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGP 429
           AK+D T+  D+ +   V GYPTL+++  G   ++Y G R  +D+IS++++   P
Sbjct: 294 AKLDCTKFGDVCDKEEVNGYPTLRYYLYGKFVVEYDGDRVTEDLISFMEEPPLP 347


>UniRef50_Q5AKR3 Cluster: Potential thioredoxin; n=3;
           Saccharomycetales|Rep: Potential thioredoxin - Candida
           albicans (Yeast)
          Length = 299

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +2

Query: 77  ALGDEVPTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAK 229
           A  DE  ++ N+  L+ +NF+ V+  + Y  LV+FYAPWCG+C+ L P Y K
Sbjct: 20  AQADEYASDPNIFELTPSNFDKVVHKSNYTTLVKFYAPWCGYCQKLQPVYHK 71


>UniRef50_Q6CC54 Cluster: Similar to DEHA0F19404g Debaryomyces
           hansenii; n=1; Yarrowia lipolytica|Rep: Similar to
           DEHA0F19404g Debaryomyces hansenii - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 364

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 21/70 (30%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           +++A+ +  + +  ++ YG++G+PTLK+F  +   P+DY  GR  D ++ +++ K+G  A
Sbjct: 68  VEIARYNGDENRKFSKKYGIQGFPTLKWFPGKGADPVDYESGRDFDSLVQFVQSKSGVKA 127

Query: 436 VEVTSAEQAK 465
                +E AK
Sbjct: 128 KTAPKSEGAK 137



 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +++ L+   FE  +   ++  LV+FYAPWCGHCK + P+Y + A+  A  D
Sbjct: 16  SLIDLTDKTFEKSVLNADHPTLVKFYAPWCGHCKKMGPDYDQLASVYAHTD 66



 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 23/64 (35%), Positives = 39/64 (60%), Gaps = 6/64 (9%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQ---DLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWLK 414
           R P+ + +VD T+ +   DL E Y ++ YPTL +F  GS  P+ + GG R  + +++++ 
Sbjct: 186 RDPVSIGQVDCTEPEPSHDLLEKYDIKSYPTLLWFEEGSTEPVKFEGGDRSVEGLVAFIN 245

Query: 415 KKTG 426
            KTG
Sbjct: 246 DKTG 249



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 17/32 (53%), Positives = 21/32 (65%)
 Frame = +2

Query: 158 EYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +Y LV F A WCG+CK LAPEY K A   + +
Sbjct: 156 KYALVAFTAKWCGYCKQLAPEYEKVAAVFSRD 187


>UniRef50_Q4PDL1 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 398

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +2

Query: 107 NVLVLSKA-NFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           NVL L+   +F+  I  ++ +LV++YAPWCGHCK+LAP Y K A   A++
Sbjct: 21  NVLDLTATKDFDKHIGKSQSVLVKYYAPWCGHCKNLAPIYEKVADAFADQ 70



 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 22/47 (46%), Positives = 31/47 (65%), Gaps = 1/47 (2%)
 Frame = +2

Query: 119 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           L+  NF+ ++   +  +LVEFYAPWCGHCK+L P Y + A   A +D
Sbjct: 146 LTSRNFDKIVLDQDKDVLVEFYAPWCGHCKNLNPTYQQVAQDFAGDD 192



 Score = 53.2 bits (122), Expect = 9e-06
 Identities = 31/98 (31%), Positives = 56/98 (57%), Gaps = 12/98 (12%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKT 423
           ++  + +AKVDA + ++L +  G+RG+PTLK++  GS  P +++ GR  D I   + +K+
Sbjct: 70  QKDAVLIAKVDADKNKELGQKAGIRGFPTLKWYPAGSTEPEEFNSGRDLDSIAKLVTEKS 129

Query: 424 G---------PPAVE-VTSAEQAKELIDANTVIVFGFF 507
           G         PPA E +TS    K ++D +  ++  F+
Sbjct: 130 GKKSAIKPPPPPAAEQLTSRNFDKIVLDQDKDVLVEFY 167



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 5/56 (8%)
 Frame = +1

Query: 268 LAKVDATQEQD--LAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKK 420
           +A++DA  E +  +A+ YGV  YPTL FF  G   +P  Y+GGR  ++ I +L +K
Sbjct: 196 VAQMDADNEANKPIAQRYGVSSYPTLMFFPKGDKSNPKPYNGGRSEEEFIKFLNEK 251


>UniRef50_Q0UV07 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 474

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +2

Query: 41  VLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAP 217
           +L  TA   L +        +  VL ++  +++ +I  + Y  +VEFYAPWCGHCK+L P
Sbjct: 7   LLAATAAFALDVNAESMYTKKSGVLSINGPDYDRLIAKSNYTSIVEFYAPWCGHCKNLKP 66

Query: 218 EYAKAATKLA 247
            Y  AA  LA
Sbjct: 67  AYETAAKSLA 76



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 8/81 (9%)
 Frame = +1

Query: 265 KLAKVDATQEQD--LAESYGVRGYPTLKFFR----NGSPI--DYSGGRQADDIISWLKKK 420
           K+A V+  +E +       GV+G+PTLK  R     G PI  DY G R A  I++ +K K
Sbjct: 80  KVAAVNCDEEMNKPFCGQMGVQGFPTLKIVRPGKKPGKPIVDDYQGERTAKGIVNAVKDK 139

Query: 421 TGPPAVEVTSAEQAKELIDAN 483
             P +V+  + +     ++AN
Sbjct: 140 V-PNSVKRATDKDLGAWLEAN 159


>UniRef50_Q00002 Cluster: Protein disulfide-isomerase; n=1;
           Alternaria alternata|Rep: Protein disulfide-isomerase -
           Alternaria alternata (Alternaria rot fungus)
          Length = 436

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 1/51 (1%)
 Frame = +2

Query: 110 VLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           V V+   N+ + VI   + +LVEFYAPWCGHCK+LAP+Y +     A ++L
Sbjct: 238 VTVVVAHNYKDVVIDNDKDVLVEFYAPWCGHCKALAPKYEELGQLYASDEL 288


>UniRef50_Q12404 Cluster: Protein disulfide-isomerase MPD1
           precursor; n=2; Saccharomyces cerevisiae|Rep: Protein
           disulfide-isomerase MPD1 precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 318

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 29/67 (43%), Positives = 40/67 (59%), Gaps = 7/67 (10%)
 Frame = +2

Query: 65  LLGLALGDEVPTEE------NVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEY 223
           LLGL + +EV  +       ++  L+  +F+  I  T Y  LVEFYAPWCGHCK L+  +
Sbjct: 10  LLGLFIMNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTF 69

Query: 224 AKAATKL 244
            KAA +L
Sbjct: 70  RKAAKRL 76


>UniRef50_UPI00015B4150 Cluster: PREDICTED: similar to protein
           disulfide isomerase, putative; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to protein disulfide
           isomerase, putative - Nasonia vitripennis
          Length = 429

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 21/64 (32%), Positives = 39/64 (60%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S I++ ++D T+   +A S+ ++G+PT+ F +      Y+G R  D+I+ +  + +GPP 
Sbjct: 70  SSIRVGRIDCTRFTSVAHSFKIKGFPTILFLKGDQQFVYNGDRTRDEIVKFATRLSGPPV 129

Query: 436 VEVT 447
            EVT
Sbjct: 130 QEVT 133



 Score = 37.1 bits (82), Expect = 0.60
 Identities = 15/26 (57%), Positives = 16/26 (61%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKL 244
           LV  YAPWC HCK L P +A  A  L
Sbjct: 42  LVMMYAPWCAHCKRLEPIWAHVAQYL 67


>UniRef50_UPI0000E47FE2 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 321

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 26/62 (41%), Positives = 40/62 (64%), Gaps = 2/62 (3%)
 Frame = +2

Query: 86  DEVPTEENVL-VLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           +E P  ++V+ + S   FE +I+  +  +L  FYAPWCGHCK + PE+A AAT L  + +
Sbjct: 146 EEEPDADDVIHIESTKEFEKLISKEKRPVLTMFYAPWCGHCKRMKPEFAGAATDLKGDAV 205

Query: 260 LS 265
           L+
Sbjct: 206 LA 207



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWL 411
           +  VDAT+ + LAE + V+G+PTLK+F+NG        R AD  +  L
Sbjct: 272 MGAVDATKARALAERFEVKGFPTLKYFKNGEHAWDLNERTADKFVEHL 319



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +2

Query: 191 CGHCKSLAPEYAKAATKLAEEDL 259
           CGHCK + PEY +AA +L E  L
Sbjct: 246 CGHCKKMKPEYVEAAAELKENGL 268


>UniRef50_Q961B9 Cluster: LD24073p; n=5; Endopterygota|Rep: LD24073p
           - Drosophila melanogaster (Fruit fly)
          Length = 430

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 22/76 (28%), Positives = 42/76 (55%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +++ ++D T+    A+ + VRGYPT+ F +      Y+G R  D+++ +  + +GPP   
Sbjct: 75  VRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMSGPPVQL 134

Query: 442 VTSAEQAKELIDANTV 489
           VT  E    L  ++T+
Sbjct: 135 VTRTESVDMLKGSHTI 150



 Score = 39.9 bits (89), Expect = 0.085
 Identities = 28/66 (42%), Positives = 33/66 (50%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           IF  I+ L L LG        VL LS   F  V    ++ LV FYAPWCG+CK   P +A
Sbjct: 8   IFGLISALLLTLGS-TGLSSKVLELSD-RFIDVRHEGQW-LVMFYAPWCGYCKKTEPIFA 64

Query: 227 KAATKL 244
             A  L
Sbjct: 65  LVAQAL 70


>UniRef50_A7S9T1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 345

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           P    VL L+  NF   I   EY+LV+FYAPWC  C+ L+P +  AA +L + +
Sbjct: 211 PASPAVLNLNDQNFNETIKKNEYVLVDFYAPWCSDCQRLSPLFDTAALQLRDNN 264



 Score = 53.2 bits (122), Expect = 9e-06
 Identities = 23/61 (37%), Positives = 35/61 (57%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLSN*RKLTQL 289
           +L L   NFE  + ++  +LV+FY PWC HC +L PE+ +A + LA+        K  +L
Sbjct: 22  ILELDDDNFEQTVKSSPLVLVDFYVPWCPHCTNLNPEFTQADSVLAKTQPTVRLAKTARL 81

Query: 290 K 292
           K
Sbjct: 82  K 82


>UniRef50_Q16961 Cluster: Disulfide-like protein; n=1; Acanthamoeba
           castellanii|Rep: Disulfide-like protein - Acanthamoeba
           castellanii (Amoeba)
          Length = 406

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFR-NGSPIDYSGGRQADDIISWLKK 417
           +  + +AKVD T +  + + +GVRGYPTLKFF+ +G   DYSG R+  D   + KK
Sbjct: 208 KGKVNIAKVDCTTDGFMCQLFGVRGYPTLKFFKGDGLVRDYSGVREVSDFSDFAKK 263



 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 6/70 (8%)
 Frame = +2

Query: 50  FTAIALLGLALGDEVP------TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
           F    L GL +G  +       T  +V+VL   NF+    + ++ L EFYAPWCGHCK+L
Sbjct: 5   FVVFILFGLCIGSLLTISVTGETTSDVVVLDDDNFDEHTASGDWFL-EFYAPWCGHCKNL 63

Query: 212 APEYAKAATK 241
           AP +   AT+
Sbjct: 64  APVWEDLATQ 73



 Score = 53.2 bits (122), Expect = 9e-06
 Identities = 24/45 (53%), Positives = 32/45 (71%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V +L+  NF T+ T      V+FYAPWCGHCK+LAP + KAA++L
Sbjct: 164 VQILTAENF-TLATNGGKWFVKFYAPWCGHCKNLAPTWEKAASEL 207



 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 8/76 (10%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLK---KKTGP- 429
           +++ KVD TQ +++   +GV+GYPT+K  ++     Y G R+ DD + + +   K   P 
Sbjct: 79  LRVGKVDCTQNKEIGSRFGVKGYPTIKLLKDNQLYAYKGARKVDDFLQFAESGYKAVDPV 138

Query: 430 ----PAVEVTSAEQAK 465
               PAV V  AE  +
Sbjct: 139 PVPAPAVVVEEAEDVE 154


>UniRef50_A7SNX3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 359

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 1/63 (1%)
 Frame = +1

Query: 226 QGSNKAG*RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDII 402
           Q +NK   + +  K+AKVD T+E+ L +S+G+ GYPTL  F++G    +YSG R  D + 
Sbjct: 288 QLANKCADQVAGPKIAKVDCTKEESLCQSFGINGYPTLMLFKDGVQKKEYSGNRDLDSLY 347

Query: 403 SWL 411
            ++
Sbjct: 348 RFI 350



 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKK 420
           I ++K+D T        +GV G+PTLK F+NG  +D YSG R  +D+ +++K K
Sbjct: 161 ITISKIDCTAHGSKCSQHGVNGFPTLKLFKNGREVDRYSGMRSLEDLKNYVKLK 214



 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 20/45 (44%), Positives = 29/45 (64%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           L+  NF+T ++      V+FYAPWC HCK LAP + + A K A++
Sbjct: 253 LNNQNFDTTVSLGT-TFVKFYAPWCRHCKILAPVWDQLANKCADQ 296



 Score = 41.9 bits (94), Expect = 0.021
 Identities = 18/52 (34%), Positives = 31/52 (59%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417
           + +AKVD T + +L     +R YPT+K + +G    Y+G R A+D+  ++ K
Sbjct: 39  LTIAKVDCTSDVNLCVKQNIRAYPTMKLYYDGDIKRYTGRRNAEDMKVFVDK 90



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 9/113 (7%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA--------TKLAEE 253
           +E  V +L+K  F+  I    +  V+FYAPWC HC  LAP + + A          +++ 
Sbjct: 108 SEAGVHILTKNTFDKHIELGLHF-VKFYAPWCIHCIKLAPIWERLAEDFKDNADITISKI 166

Query: 254 DLLSN*RKLTQLKNRISPRATVYEDTR-LSNSSGMAVLSTIQVVVKLMTSSVG 409
           D  ++  K +Q      P   ++++ R +   SGM  L  ++  VKL  +  G
Sbjct: 167 DCTAHGSKCSQHGVNGFPTLKLFKNGREVDRYSGMRSLEDLKNYVKLKIAEHG 219



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V FY PWC HCK++ P +     + ++E
Sbjct: 8   VMFYGPWCEHCKNMMPAWEALGEQYSKE 35


>UniRef50_A0BUK5 Cluster: Chromosome undetermined scaffold_13, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_13,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 694

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 21/41 (51%), Positives = 32/41 (78%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           V S++  + VI + +++LV+FYAPWCGHCKS+A E+ + AT
Sbjct: 585 VTSESFQDIVIKSKQHVLVKFYAPWCGHCKSMAKEFEQLAT 625


>UniRef50_Q4WPF6 Cluster: Thioredoxin, putative; n=13;
           Pezizomycotina|Rep: Thioredoxin, putative - Aspergillus
           fumigatus (Sartorya fumigata)
          Length = 333

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 19/52 (36%), Positives = 37/52 (71%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           V + SK  F T+++T+++++ +FYA WCG CK++AP Y + A +L+  + ++
Sbjct: 5   VHISSKEQFSTLLSTSKFVVADFYADWCGPCKAIAPAYEQLAKQLSRPNRIT 56



 Score = 37.9 bits (84), Expect = 0.34
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 366
           R + I   KV+  Q+QD+A +YG+   PT   F+ G PI
Sbjct: 51  RPNRITFTKVNVDQQQDIARAYGITAMPTFIVFQQGRPI 89


>UniRef50_A7TMH6 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 325

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +2

Query: 26  NIEMRVLIFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYI-LVEFYAPWC 193
           +++  +L++ A  L+G   G +     T+ +++ L  +NF++V+  T Y  LVEFYAPWC
Sbjct: 6   SLQKVLLLWLAGNLIGYVSGSQPSFYTTDTHIMELDSSNFDSVVHNTNYTTLVEFYAPWC 65

Query: 194 GHCKSLAPEYAKAATKL 244
           G+C+ L     K   KL
Sbjct: 66  GYCQQLKGIMHKVGKKL 82


>UniRef50_O97452 Cluster: Protein disulfide isomerase-2 precursor;
           n=2; Giardia intestinalis|Rep: Protein disulfide
           isomerase-2 precursor - Giardia lamblia (Giardia
           intestinalis)
          Length = 449

 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 26/53 (49%), Positives = 35/53 (66%)
 Frame = +2

Query: 65  LLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           L  LAL   V  E  VLVL++ NF++ +   + + V+FYAPWCGHCK LAP +
Sbjct: 6   LCTLALLGSVSAE--VLVLTQDNFKSELEKHKNLFVKFYAPWCGHCKQLAPTW 56



 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFR-NGSPIDYSGGRQADDIISWLKKKTGPP 432
           S + +A+VD T   ++   YGV GYPT+K  + NG+ +DY G R+   ++ W +    P 
Sbjct: 64  SVMPVAEVDCTTHTEICGKYGVNGYPTIKLLQSNGAVMDYDGPREKQSMMQWAEAMLKPA 123

Query: 433 AVEVTSAEQAKE 468
            VE       K+
Sbjct: 124 LVEYNDINDIKD 135


>UniRef50_Q9RD25 Cluster: Thioredoxin; n=27; Bacteria|Rep:
           Thioredoxin - Streptomyces coelicolor
          Length = 134

 Score = 53.2 bits (122), Expect = 9e-06
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           L+K NF+  +T  E++L++F+A WCG CK   P Y KAA
Sbjct: 7   LTKENFDQTVTDNEFVLIDFWAEWCGPCKQFGPVYEKAA 45


>UniRef50_A7CYY1 Cluster: Thioredoxin; n=1; Opitutaceae bacterium
           TAV2|Rep: Thioredoxin - Opitutaceae bacterium TAV2
          Length = 107

 Score = 53.2 bits (122), Expect = 9e-06
 Identities = 21/43 (48%), Positives = 33/43 (76%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L+   F+T +T+T+ +LV+F+APWCG CK++AP   + AT+LA
Sbjct: 8   LTTDTFKTALTSTKLLLVDFWAPWCGPCKAIAPILDQIATELA 50



 Score = 37.5 bits (83), Expect = 0.45
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDII 402
           + +AKV+     +LA  YGVR  PT+  F++G   D   G    D+I
Sbjct: 53  VTIAKVNVDDNGELAAQYGVRAIPTMLLFKDGQLADTLVGMMQKDVI 99


>UniRef50_Q9BKB3 Cluster: Protein disulfide isomerase 4; n=1;
           Giardia intestinalis|Rep: Protein disulfide isomerase 4
           - Giardia lamblia (Giardia intestinalis)
          Length = 354

 Score = 53.2 bits (122), Expect = 9e-06
 Identities = 20/44 (45%), Positives = 32/44 (72%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           VLVL++ NF++ +   + + V+FYAPWCGHCK LAP + + + +
Sbjct: 17  VLVLTQDNFDSELEKHKNLFVKFYAPWCGHCKKLAPTWEEMSNE 60



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 1/68 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFR-NGSPIDYSGGRQADDIISWLKKKTGPPAVEV 444
           +A+VD T    +   YGV GYPT+K  + +G+   Y   R+ D ++ W      P   + 
Sbjct: 66  VAEVDCTAHSSICGKYGVNGYPTIKLLQSSGAVFKYEKAREKDGMMKWADSMLEPTLTKC 125

Query: 445 TSAEQAKE 468
            S E   E
Sbjct: 126 DSVEDCAE 133


>UniRef50_A7SY15 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 372

 Score = 53.2 bits (122), Expect = 9e-06
 Identities = 25/82 (30%), Positives = 43/82 (52%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + +A V+  +E +LA+  GV+    +  F  G  ++Y G R AD ++++L K   PP   
Sbjct: 104 VTVAAVNVAEEYELAQKLGVKFSGAISVFHRGKRVEYYGHRSADVLVTFLHKMFDPPVTN 163

Query: 442 VTSAEQAKELIDANTVIVFGFF 507
           + + +Q   L DA    V G+F
Sbjct: 164 IDNKKQRTLLEDAEGTKVVGYF 185


>UniRef50_Q5KJU3 Cluster: Protein disulfide isomerase, putative;
           n=2; Filobasidiella neoformans|Rep: Protein disulfide
           isomerase, putative - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 388

 Score = 53.2 bits (122), Expect = 9e-06
 Identities = 22/46 (47%), Positives = 29/46 (63%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           VL L    F++V+ +    +V F APWCGHCK+L PEY  AA  L+
Sbjct: 27  VLHLDSKTFKSVMASEHAAMVAFVAPWCGHCKNLGPEYTAAAQSLS 72



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLK 414
           P      D    + L   YGV+GYPT+K F     G+  +Y+G R+   ++ + K
Sbjct: 76  PFYAVDCDDASNRGLCAEYGVQGYPTIKGFPKAGKGAAKEYNGERKRGALVEYAK 130


>UniRef50_Q4RI48 Cluster: Chromosome 8 SCAF15044, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 8
           SCAF15044, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 416

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 435
           +  A+VD  Q  D+A+ Y +  YPTLK FRNG  +  +Y G R    I  +++++   P 
Sbjct: 65  VVFARVDCDQHSDIAQRYRINKYPTLKLFRNGMMMKREYRGQRSVVAIADFIRQQQVDPV 124

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+ S E+    +D +   + G+F
Sbjct: 125 KELLSVEE-MNTVDRSKRNIIGYF 147



 Score = 37.5 bits (83), Expect = 0.45
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +2

Query: 80  LGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +G   P +  ++ L   N + V+      LV FYA WC   + L P + +A+  + EE
Sbjct: 1   MGLSSPGKAEIINLDSGNIDEVLNNAGVALVNFYADWCRFSQMLHPIFEEASNIVREE 58


>UniRef50_Q5CY16 Cluster: Protein disulfide isomerase, signal
           peptide, ER retention motif; n=2; Cryptosporidium|Rep:
           Protein disulfide isomerase, signal peptide, ER
           retention motif - Cryptosporidium parvum Iowa II
          Length = 451

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 20/49 (40%), Positives = 31/49 (63%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +   V V++ +  + ++     ++VEF+A WCGHCK+ APEY KAA  L
Sbjct: 45  SSSQVKVINGSQLKKLVKENPVVIVEFFAEWCGHCKAFAPEYEKAAKAL 93



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 22/43 (51%), Positives = 30/43 (69%), Gaps = 2/43 (4%)
 Frame = +2

Query: 101 EENVLVLSKANFET-VITTTEYI-LVEFYAPWCGHCKSLAPEY 223
           +  V+ L+ +NF+  VI   E    V+FYAPWCGHCKSLAP++
Sbjct: 179 KSRVVELTDSNFDDLVINDNENSWFVKFYAPWCGHCKSLAPDW 221



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 22/57 (38%), Positives = 36/57 (63%), Gaps = 5/57 (8%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-----SPIDYSGGRQADDIISWLKK 417
           +K+AK+DATQ   +A  Y ++G+PTL  F  G     +P++Y+G R A+D+  +  K
Sbjct: 232 VKIAKLDATQHTMMAHRYKIQGFPTLLMFPAGEKREITPVNYNGPRTANDLFEFAIK 288



 Score = 36.7 bits (81), Expect = 0.79
 Identities = 16/40 (40%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIIS 405
           + D+AE YG++G+PT+K F   S  P D++G R+A+ +++
Sbjct: 105 QSDMAE-YGIQGFPTVKVFTEHSVKPKDFTGPRRAESVLN 143


>UniRef50_Q8NBS9 Cluster: Thioredoxin domain-containing protein 5
           precursor; n=32; Euteleostomi|Rep: Thioredoxin
           domain-containing protein 5 precursor - Homo sapiens
           (Human)
          Length = 432

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDI 399
           +K+A+VD T E+++   Y VRGYPTL  FR G  + ++SGGR  D +
Sbjct: 374 VKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL 420



 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWL------KKK 420
           + +AKVD T   D+  + GVRGYPTLK F+ G   + Y G R    + +W+      +  
Sbjct: 114 VYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPV 173

Query: 421 TGPPAVEVTSAEQAKE 468
           T  P VE  SA + K+
Sbjct: 174 TPEPEVEPPSAPELKQ 189



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK---KKTGP 429
           +K+ KVD TQ  +L     VRGYPTL +FR+G  +D Y G R  + +  +++   ++T  
Sbjct: 240 VKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTET 299

Query: 430 PAVEVTSAEQAKEL 471
            A E  +  +A  L
Sbjct: 300 GATETVTPSEAPVL 313



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           VL L++ NF+  I       ++FYAPWCGHCK+LAP + + + K
Sbjct: 324 VLALTENNFDDTIAEG-ITFIKFYAPWCGHCKTLAPTWEELSKK 366



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 19/52 (36%), Positives = 33/52 (63%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           ++ +  LS +NFE  +   ++  ++F+APWCGHCK+LAP + + A  L   +
Sbjct: 188 KQGLYELSASNFELHVAQGDHF-IKFFAPWCGHCKALAPTWEQLALGLEHSE 238



 Score = 34.7 bits (76), Expect = 3.2
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEY 223
           V F+APWCGHC+ L P +
Sbjct: 82  VMFFAPWCGHCQRLQPTW 99


>UniRef50_UPI0000D57458 Cluster: PREDICTED: similar to CG8983-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8983-PA, isoform A - Tribolium castaneum
          Length = 491

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 2/85 (2%)
 Frame = +1

Query: 259 PIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPP 432
           PI    VD   + +   E +GV  +PTLK FRNG  +  Y G R+A  I  ++K +    
Sbjct: 73  PIAFVMVDCENDGKQTCEKFGVSSFPTLKIFRNGKFLKAYEGPREAPAIAKYMKAQVDGD 132

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           + E+ S  + ++ +  + V V GFF
Sbjct: 133 SRELGSVAELEDFLSTDEVSVVGFF 157



 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 23/51 (45%), Positives = 29/51 (56%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           E   L  +  NF+T +   E  LV FYAPWC HC    P++A AA K +EE
Sbjct: 20  ETKPLQYNDRNFDTKMNEHEVALVLFYAPWCNHCIQFLPKFADAA-KQSEE 69


>UniRef50_Q5CSY8 Cluster: Protein disulfide isomerase, signal
           peptide plus possible ER retention motif; n=2;
           Cryptosporidium|Rep: Protein disulfide isomerase, signal
           peptide plus possible ER retention motif -
           Cryptosporidium parvum Iowa II
          Length = 657

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 5/78 (6%)
 Frame = +2

Query: 26  NIEMRVLIFTAIALLGLALGDEVPTEENV-----LVLSKANFETVITTTEYILVEFYAPW 190
           N+E  +  F +  L      +E P+EE+      +V+SK   + VI T   +L+ FYAPW
Sbjct: 490 NLEHFIQDFVSGRLNPYFKSEEPPSEEDNDGPVRIVVSKTFKKEVIETNLDVLIVFYAPW 549

Query: 191 CGHCKSLAPEYAKAATKL 244
           CGHC+ L P+Y   A +L
Sbjct: 550 CGHCRKLEPDYNVLAQRL 567



 Score = 38.7 bits (86), Expect = 0.20
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 3/55 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKK 417
           +K+AK+D +Q +   E+  + GYP++  F++     PI Y+G R   ++I W+ K
Sbjct: 574 LKIAKIDGSQNE--VENIQILGYPSILLFKSEMKTEPILYNGDRSVANMIEWISK 626



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 12/23 (52%), Positives = 17/23 (73%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAA 235
           +V FY PWC +C+ + PE+ KAA
Sbjct: 133 VVLFYVPWCVYCRGIMPEFEKAA 155


>UniRef50_A0D787 Cluster: Chromosome undetermined scaffold_4, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_4,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 484

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/82 (30%), Positives = 44/82 (53%), Gaps = 3/82 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQD--LAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISW-LKKKTGPP 432
           I  A  D+ ++ D    E + +  +PT  FF +G P  ++G R AD I+ W L+   GP 
Sbjct: 89  IACAAYDSQRDPDRYALEKFKISSFPTFIFFIDGKPFQFTGQRSADSILQWMLQLVNGPN 148

Query: 433 AVEVTSAEQAKELIDANTVIVF 498
             E+ + +Q  + ++ N V++F
Sbjct: 149 PTEILTQDQFNQFLNDNDVVLF 170



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           T+EN   +   N+E  VI + + +L+EFYA WCGHCK   P Y + A +L +
Sbjct: 368 TQENTYKVVALNYEEEVIKSKKDVLLEFYATWCGHCKQFKPLYDQIAYELRD 419



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 18/43 (41%), Positives = 26/43 (60%)
 Frame = +2

Query: 131 NFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           N +T+I+    IL+EFYA WC  CK  APEY +   K ++  +
Sbjct: 47  NIDTLISGHPLILIEFYASWCAPCKQFAPEYQQLTDKASKHSI 89


>UniRef50_A2Q233 Cluster: Ribonuclease T2; Thioredoxin domain 2;
           Thioredoxin fold; n=1; Medicago truncatula|Rep:
           Ribonuclease T2; Thioredoxin domain 2; Thioredoxin fold
           - Medicago truncatula (Barrel medic)
          Length = 349

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 29/73 (39%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +2

Query: 29  IEMRVLIFTAIALLGLALGDEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCK 205
           I + +L+F  + L     G    +   VL L+  NF + V+ + E +LVEF+AP CGHC+
Sbjct: 7   IALTILLFNNLILSQAIYG----SSSTVLQLTPDNFNSKVLNSNEVVLVEFFAPRCGHCE 62

Query: 206 SLAPEYAKAATKL 244
            L P + KAAT L
Sbjct: 63  VLTPIWEKAATVL 75



 Score = 45.6 bits (103), Expect = 0.002
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGR 384
           + +A +DA   + LA  YG+RG+PT+K F  G  P+DY G R
Sbjct: 79  VTVAALDADAHKSLAHEYGIRGFPTIKAFSPGKPPVDYQGAR 120


>UniRef50_Q8IVQ5 Cluster: Protein disulfide isomerase-like protein
           of the testis; n=14; Eutheria|Rep: Protein disulfide
           isomerase-like protein of the testis - Homo sapiens
           (Human)
          Length = 584

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 3/88 (3%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKT 423
           ++ I   KVD T E++L + +G+   P LK F  G+   PI   G  ++  ++ WL+++ 
Sbjct: 93  KNGIGFGKVDITIEKELQQEFGITKAPELKLFFEGNRSEPISCKGVVESAALVVWLRRQI 152

Query: 424 GPPAVEVTSAEQAKELIDANTVIVFGFF 507
              A    S+EQ  E + +  +++ GFF
Sbjct: 153 SQKAFLFNSSEQVAEFVISRPLVIVGFF 180


>UniRef50_Q9URS7 Cluster: MPD1 homologue; n=1; Kluyveromyces
           lactis|Rep: MPD1 homologue - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 328

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query: 44  LIFTAIALLGLALGDEV-PTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 211
           L++    L+ LA G      +EN++ L+ +NF+ VI  T Y  LV FYAPWCG+C+ L
Sbjct: 6   LLYALFLLVELAFGANFYDRDENIMELTPSNFDKVIHRTNYTTLVMFYAPWCGYCQEL 63


>UniRef50_Q6DG87 Cluster: PDIA2 protein; n=5; Danio rerio|Rep: PDIA2
           protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 518

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 24/87 (27%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S +KL  VD  +E++LAES  +   P+++ + +G   +P+     + +  I++WLK++ G
Sbjct: 90  SDVKLGGVDVKKEKELAESLNITTLPSIRLYLSGDKNNPVYCPVLKSSASILTWLKRRAG 149

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +++  Q +  +    ++V G F
Sbjct: 150 PSADIISNVTQLENFLRREELVVLGLF 176



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 21/57 (36%), Positives = 32/57 (56%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           + +  +++VLVL+K+NF   +   E +LV FYAP  G       E+ +AA  L E D
Sbjct: 33  NSIVEDKDVLVLTKSNFHRALKQHEQLLVHFYAPLSGQSLGSILEFREAAGALKEAD 89


>UniRef50_Q0UDG8 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 169

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 21/49 (42%), Positives = 34/49 (69%)
 Frame = +2

Query: 92  VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +PTE    +LS  +F T++T+T Y++ +FYA WC  CK +AP YA+ ++
Sbjct: 1   MPTE----ILSPLHFHTLLTSTPYLIADFYATWCPPCKQIAPVYAQLSS 45


>UniRef50_Q5QY72 Cluster: Thioredoxin domain-containing protein;
           n=2; Idiomarina|Rep: Thioredoxin domain-containing
           protein - Idiomarina loihiensis
          Length = 283

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 2/75 (2%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWLKKKTGPPAVE- 441
           LAK++  ++Q+LA  +G+R  PT+ FF++G P+D  GG + + +I   L K    P+ + 
Sbjct: 59  LAKINCDEQQELAAQFGIRSLPTVAFFKDGQPVDSFGGVKTEGEIQEILTKHLPSPSDDL 118

Query: 442 VTSAEQAKELIDANT 486
           +  A+ A    DANT
Sbjct: 119 IQQAQTAMGEGDANT 133



 Score = 40.7 bits (91), Expect = 0.049
 Identities = 18/59 (30%), Positives = 35/59 (59%), Gaps = 3/59 (5%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           +E N++ L   NF+ V+   +  + I+++F+A WC  CK L P   K A + +++ +L+
Sbjct: 2   SESNIVNLDLQNFQQVLLEGSKEKLIIIDFWADWCEPCKQLMPVLEKLAMQYSDQVILA 60


>UniRef50_Q6FJP0 Cluster: Candida glabrata strain CBS138 chromosome
           M complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome M complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 304

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = +2

Query: 35  MRVLIFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHC 202
           M+V + T +  +      +      + N++ L+ +NF+ V+  T Y  LVEFYAPWCG+C
Sbjct: 1   MKVYLLTLLVYIASVFAQDQSFYKDDPNIIELTPSNFDRVVHNTNYTTLVEFYAPWCGYC 60

Query: 203 KSL 211
           K L
Sbjct: 61  KQL 63



 Score = 37.9 bits (84), Expect = 0.34
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 10/126 (7%)
 Frame = +1

Query: 139 NCNYNHGVHFS*ILCSMVRPLQISGTGIRQGSNKAG*RRSPIKLAKVDATQEQDLAESYG 318
           N NY   V F    C   + L+ +   + + S+        +     D    + L   YG
Sbjct: 43  NTNYTTLVEFYAPWCGYCKQLKNTIHSLGKASDSI----FQVAAVNCDKASNKQLCGEYG 98

Query: 319 VRGYPTLKFFRNG----------SPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKE 468
           V G+PTLK F+ G          +   Y G R+   +I+++K K      ++TSA+   +
Sbjct: 99  VEGFPTLKVFKPGKAGKTAVKKHASETYMGERKLAPLINFIKAKIKNHVKKLTSADMVSK 158

Query: 469 LIDANT 486
           L+++ +
Sbjct: 159 LVNSQS 164


>UniRef50_UPI0000DB7CD9 Cluster: PREDICTED: similar to CG5027-PA,
           partial; n=1; Apis mellifera|Rep: PREDICTED: similar to
           CG5027-PA, partial - Apis mellifera
          Length = 236

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 25/88 (28%), Positives = 48/88 (54%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           I++ +VD T+  ++A ++ V+G+PT+ F +      Y+G R  D+I+ +  + +GPP   
Sbjct: 75  IRVGRVDCTRFTNVAHAFKVKGFPTIIFLKGEQEFIYNGDRTRDEIVKFALRVSGPPVQG 134

Query: 442 VTSAEQAKELIDANTVIVFGFFWTRAQP 525
           +T   Q+ + I     I F +   R+ P
Sbjct: 135 ITKT-QSFDTIKKEHDIYFLYVGERSGP 161



 Score = 37.1 bits (82), Expect = 0.60
 Identities = 15/26 (57%), Positives = 16/26 (61%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKL 244
           LV  YAPWC HCK L P +A  A  L
Sbjct: 45  LVMMYAPWCAHCKRLEPIWAHVAQYL 70


>UniRef50_UPI000023F2B3 Cluster: hypothetical protein FG06174.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG06174.1 - Gibberella zeae PH-1
          Length = 747

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 19/43 (44%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query: 119 LSKANFETVITTT-EYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           L+ ANF+T++T + +   ++FYAPWC HCK++AP + + A K+
Sbjct: 296 LTPANFDTLVTNSKDPWFIKFYAPWCSHCKAMAPTWQQLAKKM 338



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 12/38 (31%), Positives = 24/38 (63%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           +L L+ AN+E      ++++V+ ++P+C HC   AP +
Sbjct: 39  LLELTPANWEEQTKKNKFLMVKHFSPYCKHCTRFAPTF 76



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 20/87 (22%), Positives = 38/87 (43%), Gaps = 1/87 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG-PPAV 438
           + + +V+   +  L    GV+ +PT+ F       +Y G R   D +++ +        V
Sbjct: 342 LNIGEVNCEADHKLCTQMGVKAFPTIHFINGAEKAEYKGLRGVGDFVAYAEGALEVAGGV 401

Query: 439 EVTSAEQAKELIDANTVIVFGFFWTRA 519
               AE  KEL +    ++F +F+  A
Sbjct: 402 LDVDAESFKEL-EKTEEVLFVYFYDHA 427


>UniRef50_Q5YBC2 Cluster: Plastid protein disulfide isomerase; n=2;
           Trebouxiophyceae|Rep: Plastid protein disulfide
           isomerase - Helicosporidium sp. subsp. Simulium jonesii
           (Green alga)
          Length = 240

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 27/69 (39%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +2

Query: 53  TAIALLGLALGDEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           TA  LL  A   E  T+  +  +  + FE  V+  ++  L+E +APWCGHCK L P YAK
Sbjct: 84  TAPRLLKSAAAPEEHTKNGLTTVVGSTFEQLVLDPSKDALLEVHAPWCGHCKKLEPIYAK 143

Query: 230 AATKLAEED 256
            A +    D
Sbjct: 144 LAKRFETVD 152


>UniRef50_Q00ZL8 Cluster: Thioredoxin/protein disulfide isomerase;
           n=2; Ostreococcus|Rep: Thioredoxin/protein disulfide
           isomerase - Ostreococcus tauri
          Length = 674

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 26/58 (44%), Positives = 38/58 (65%), Gaps = 1/58 (1%)
 Frame = +2

Query: 95  PTEENVLVL-SKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           P   +V VL SK+  +   +  E +LVEFY PWC HC+  AP+YA+AA +L +E ++S
Sbjct: 147 PGSTDVKVLDSKSLSDVGESGAEAVLVEFYLPWCPHCQHFAPKYAEAA-RLVKESVVS 203


>UniRef50_Q4N7F7 Cluster: Protein disulfide isomerase, putative;
           n=2; Theileria|Rep: Protein disulfide isomerase,
           putative - Theileria parva
          Length = 387

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 22/46 (47%), Positives = 30/46 (65%), Gaps = 2/46 (4%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYI--LVEFYAPWCGHCKSLAPEYAKAATK 241
           V+ L+  NF +++T   Y   LV+FYAPWCGHCK+L PE+     K
Sbjct: 153 VVQLTSDNFHSLVTDDTYNQWLVKFYAPWCGHCKNLEPEWMSLPKK 198



 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 7/88 (7%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-----SPIDYSGGRQADDIISWLKK--K 420
           +K+ +VD T  Q L   + V+GYPT+  F  G     + ++Y G R A DI+++ KK  K
Sbjct: 202 VKVGRVDCTSHQSLCAQFNVKGYPTILLFNKGEKNPKTAMNYEGQRTAADILAFAKKNDK 261

Query: 421 TGPPAVEVTSAEQAKELIDANTVIVFGF 504
              P    T   + KE       ++F F
Sbjct: 262 ALSPPTHATLVAELKEKCSGPLCLLFFF 289


>UniRef50_A2BLV1 Cluster: Predicted Thioredoxin; n=1; Hyperthermus
           butylicus DSM 5456|Rep: Predicted Thioredoxin -
           Hyperthermus butylicus (strain DSM 5456 / JCM 9403)
          Length = 141

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 26/75 (34%), Positives = 42/75 (56%)
 Frame = +2

Query: 32  EMRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
           E+R LI   +  L   LGD +      + L+K NF+ V+   + ++VEF APWC  CK+ 
Sbjct: 8   ELRSLIEKKVNELDKELGDPL------IYLNKDNFDEVLKNYKVVVVEFSAPWCNPCKAY 61

Query: 212 APEYAKAATKLAEED 256
            P + + A +LA+ +
Sbjct: 62  TPVFKRVARRLADPE 76


>UniRef50_O13704 Cluster: Thioredoxin domain-containing protein
           C13F5.05, mitochondrial precursor; n=1;
           Schizosaccharomyces pombe|Rep: Thioredoxin
           domain-containing protein C13F5.05, mitochondrial
           precursor - Schizosaccharomyces pombe (Fission yeast)
          Length = 363

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 24/67 (35%), Positives = 31/67 (46%)
 Frame = +2

Query: 44  LIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           L     +L+    G       N + L+  NF   +      LV FYAPWCG+CK L P Y
Sbjct: 11  LFLACFSLVSGVFGYSPMFGSNTIELNSKNFRKFVKAKGPSLVVFYAPWCGYCKKLVPTY 70

Query: 224 AKAATKL 244
            K A+ L
Sbjct: 71  QKLASNL 77


>UniRef50_P42115 Cluster: Thioredoxin; n=4; Sordariomycetes|Rep:
           Thioredoxin - Neurospora crassa
          Length = 127

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 19/48 (39%), Positives = 31/48 (64%)
 Frame = +2

Query: 122 SKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           S   F  ++ TT+Y++ +FYA WCG CK++AP YA+ A   +  + L+
Sbjct: 10  SAQEFANLLNTTQYVVADFYADWCGPCKAIAPMYAQFAKTFSIPNFLA 57


>UniRef50_Q7XY30 Cluster: Protein disulfide isomerase 2; n=1;
           Griffithsia japonica|Rep: Protein disulfide isomerase 2
           - Griffithsia japonica (Red alga)
          Length = 133

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 5/72 (6%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSP--IDYSGGRQADDIISWLKKK-TGPPAV 438
           +AK+DAT+  D    Y  +GYPTL FF+ GS   + Y GGR+  D + +LK+  T    +
Sbjct: 35  IAKMDATKN-DAPADYKAQGYPTLHFFKAGSTKGVSYDGGRELADFVKYLKENATHKEGI 93

Query: 439 EVTS--AEQAKE 468
           E+ +   E+AKE
Sbjct: 94  ELPAEEKEEAKE 105



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +L+E YAPWCGHCK LAP     A+KLA  + L
Sbjct: 1   VLIEQYAPWCGHCKKLAPILDDLASKLAGVETL 33


>UniRef50_Q017G7 Cluster: Protein disulfide isomerase, putative;
           n=2; Ostreococcus|Rep: Protein disulfide isomerase,
           putative - Ostreococcus tauri
          Length = 183

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFETVIT-TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           E+VL L+  NFE  +T +T  + +EFYAPWC +CK L P + +  +KL +
Sbjct: 12  ESVLELTPENFEREVTNSTRPVFIEFYAPWCPYCKRLEPIWEELPSKLEQ 61



 Score = 35.9 bits (79), Expect = 1.4
 Identities = 14/42 (33%), Positives = 23/42 (54%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG 381
           S  ++A+++     D A +Y + G+PTL  F NG P+    G
Sbjct: 64  SKTRVARMNVDTYTDYASAYAITGFPTLMLFENGRPVGAKQG 105


>UniRef50_Q4E5B1 Cluster: Thioredoxin, putative; n=4;
           Trypanosoma|Rep: Thioredoxin, putative - Trypanosoma
           cruzi
          Length = 441

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +2

Query: 44  LIFTAIALLGLALGDEVPTEE--NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           L F  + L  +   +  P  +   V+ L+ A F+  +++ + + + FYAPWCGHC+ + P
Sbjct: 26  LFFMVLLLTSIVFAEAFPFTKFSGVVELTPATFKNFVSSHKPVYILFYAPWCGHCRRIHP 85

Query: 218 EYAKAA 235
           E+ K A
Sbjct: 86  EWEKFA 91



 Score = 40.3 bits (90), Expect = 0.064
 Identities = 19/77 (24%), Positives = 43/77 (55%), Gaps = 6/77 (7%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-----SPIDYSGGRQADDI-ISWLKKKT 423
           +++  ++A +   +A  +G+RG+PT+K++  G      P +Y+G RQA  +  + + + T
Sbjct: 98  VRVGAINADEHSQIAGQFGIRGFPTIKYWNVGEKDINKPQEYNGPRQAKSLQANAMNQIT 157

Query: 424 GPPAVEVTSAEQAKELI 474
                 +TS++  +E +
Sbjct: 158 SSGIKTITSSDALREAV 174


>UniRef50_Q14554 Cluster: Protein disulfide-isomerase A5 precursor;
           n=28; cellular organisms|Rep: Protein
           disulfide-isomerase A5 precursor - Homo sapiens (Human)
          Length = 519

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 21/49 (42%), Positives = 30/49 (61%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +V  L+  +F+  +     +LV F+APWCGHCK + PE+ KAA  L  E
Sbjct: 277 SVYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFEKAAEALHGE 325



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 24/69 (34%), Positives = 35/69 (50%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 447
           LA VDAT  + LAE + +  +PTLK+F+NG        R     + W++    PP  E T
Sbjct: 332 LAAVDATVNKALAERFHISEFPTLKYFKNGEKYAVPVLRTKKKFLEWMQNPEAPPPPEPT 391

Query: 448 SAEQAKELI 474
             EQ   ++
Sbjct: 392 WEEQQTSVL 400



 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = +2

Query: 71  GLALGDEVPTEENVLVL-SKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKL 244
           G  L +E P  ++V+ L S+ +F  ++   E  +L+ FYAPWC  CK + P + KAAT+L
Sbjct: 140 GPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQL 199

Query: 245 AEEDLLS 265
               +L+
Sbjct: 200 RGHAVLA 206



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           + +VL L   NF   +   ++ LV FYAPWC HCK + P +   A    ++
Sbjct: 396 QTSVLHLVGDNFRETLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDD 446



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
 Frame = +1

Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSG-GRQADDIISWLKKKTGPPAVEVTS 450
           V +++ +++ E Y VRG+PT+ +F  G  +  Y   G  A+DI+ WLK    PP  +V  
Sbjct: 210 VYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQ-PPQPQVPE 268

Query: 451 AEQAKE 468
              A E
Sbjct: 269 TPWADE 274


>UniRef50_UPI0000499DF8 Cluster: disulfide isomerase precursor; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: disulfide isomerase
           precursor - Entamoeba histolytica HM-1:IMSS
          Length = 469

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = +2

Query: 35  MRVLIFTAIALLGLALGDEVPTEEN----VLVLSKANFETVITTTEYILVEFYAPWCGHC 202
           M++  F  + ++ LA  D    E+     +  L+   +   I   + + V++YAPWCGHC
Sbjct: 1   MKIFFFITLLVVVLAEVDNTTQEDKRSFEIFTLNNNFYGNFIDHEDMVFVKYYAPWCGHC 60

Query: 203 KSLAPEYAKAATKL 244
           K+L P Y   A +L
Sbjct: 61  KALKPVYENLAKEL 74



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG 357
           +K A+V+  + +++ E  G+ GYPTL  FR G
Sbjct: 78  LKFAEVNCEESKEICEKEGIEGYPTLILFRKG 109


>UniRef50_Q9VYV3 Cluster: CG1837-PA; n=2; Sophophora|Rep: CG1837-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 416

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 23/72 (31%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + ++K+D TQ + + + + V+GYPTL +  +G  I+ YSG R    + ++++K  G P +
Sbjct: 217 VTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVP-L 275

Query: 439 EVTSAEQAKELI 474
           E T+ E   E +
Sbjct: 276 EKTAGEAGDEKV 287



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 2/72 (2%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +AKVD T+ Q L  ++ V GYPTL+ F+ G    + + G R    I  ++ K+   PA E
Sbjct: 91  IAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPA-E 149

Query: 442 VTSAEQAKELID 477
               E  +E ++
Sbjct: 150 ADLGEVKREQVE 161



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V+ L++  F   ++T  +  V+F+APWC HC+ LAP +   A +L +E
Sbjct: 168 VVDLTEDTFAKHVSTGNHF-VKFFAPWCSHCQRLAPTWEDLAKELIKE 214



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 3/61 (4%)
 Frame = +1

Query: 253 RSPIKLAKVDAT--QEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKT 423
           +S +K+AKVD T  + + +     V GYPTL  ++NG    +Y G R   ++ ++LKK  
Sbjct: 352 QSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQAYLKKFL 411

Query: 424 G 426
           G
Sbjct: 412 G 412



 Score = 41.1 bits (92), Expect = 0.037
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAATK 241
           ++FYAPWCGHC+ L P + + AT+
Sbjct: 324 IKFYAPWCGHCQKLQPTWEQLATE 347



 Score = 39.9 bits (89), Expect = 0.085
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           L    F+T I     + V+F+APWCGHCK + P + + A
Sbjct: 42  LDPETFDTAIAGGN-VFVKFFAPWCGHCKRIQPLWEQLA 79


>UniRef50_Q4Q2Y0 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 433

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 21/72 (29%), Positives = 36/72 (50%)
 Frame = +2

Query: 20  ADNIEMRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGH 199
           A  +++   +   + L+  +L         V  L+ A+    + T + +++ FYAPWCGH
Sbjct: 6   ASAVQLLGALLVVVCLVHTSLAYPYGRSSAVTELTPASLHAFVNTHKPVVILFYAPWCGH 65

Query: 200 CKSLAPEYAKAA 235
           CK   PEY + A
Sbjct: 66  CKQFHPEYERFA 77



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 6/78 (7%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-----SPIDYSGGRQADDIISWLKK 417
           +  I++  +DA +   + + +GVRG+PT+K++++G     S  DY G R A  + SW+ +
Sbjct: 81  KGTIRVGAIDADKNAVIGQQFGVRGFPTIKYWKSGTKSVSSSQDYQGQRTAAALQSWMVE 140

Query: 418 K-TGPPAVEVTSAEQAKE 468
             +    + VT+AEQ K+
Sbjct: 141 GISSSKVMTVTTAEQIKQ 158


>UniRef50_A7ARU5 Cluster: Protein disulfide isomerase related
           protein; n=1; Babesia bovis|Rep: Protein disulfide
           isomerase related protein - Babesia bovis
          Length = 395

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 8/87 (9%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG--SP---IDYSGGRQADDIISWLK---K 417
           +K+  +DAT    LA  YGV+G+PT+  F  G  SP   I Y G R+A+DI+ + K   +
Sbjct: 205 VKVGSIDATVYTALAARYGVKGFPTIFLFPQGVKSPTTAIRYKGPRKAEDILQFAKSYYR 264

Query: 418 KTGPPAVEVTSAEQAKELIDANTVIVF 498
             GPP V+V S    K+       ++F
Sbjct: 265 NMGPP-VKVDSVSDLKQRCSRPLCLLF 290



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
 Frame = +2

Query: 110 VLVLSKANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAA 235
           V+ L+ A FE ++    +   L+ FYAPWC HCK+  PE+A+ A
Sbjct: 156 VISLTDAEFERLVVNDRSNQWLILFYAPWCRHCKAFHPEWARMA 199


>UniRef50_P77395 Cluster: Uncharacterized protein ybbN; n=38;
           Enterobacteriaceae|Rep: Uncharacterized protein ybbN -
           Escherichia coli (strain K12)
          Length = 284

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 27/69 (39%), Positives = 40/69 (57%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 447
           LAK+D   EQ +A  +G+R  PT+  F+NG P+D   G Q ++ I  L  K  P   E+ 
Sbjct: 58  LAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEEL- 116

Query: 448 SAEQAKELI 474
            A+QA +L+
Sbjct: 117 KAQQAMQLM 125


>UniRef50_Q9BS26 Cluster: Thioredoxin domain-containing protein 4
           precursor; n=28; Coelomata|Rep: Thioredoxin
           domain-containing protein 4 precursor - Homo sapiens
           (Human)
          Length = 406

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 435
           +  A+VD  Q  D+A+ Y +  YPTLK FRNG  +  +Y G R    +  +++++   P 
Sbjct: 85  VVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPI 144

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+    +   L D +   + G+F
Sbjct: 145 QEIRDLAEITTL-DRSKRNIIGYF 167



 Score = 36.7 bits (81), Expect = 0.79
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           P    +  L   N + ++   +  LV FYA WC   + L P + +A+  + EE
Sbjct: 26  PVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEE 78


>UniRef50_UPI0000D557D3 Cluster: PREDICTED: similar to ER-resident
           protein ERdj5; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to ER-resident protein ERdj5 - Tribolium
           castaneum
          Length = 791

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYI---LVEFYAPWCGHCKSLAPEYAKAATKL 244
           V+ +    F+  I T +++   LVEFYAPWCGHC    PE+ K A KL
Sbjct: 677 VVAMDAEAFKEQILTRKFMTPWLVEFYAPWCGHCTHFEPEFRKVANKL 724



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 2/49 (4%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYIL--VEFYAPWCGHCKSLAPEYAKAATKLAE 250
           V+ L  ++F  ++   E  L  V+F+APWCG C+ LAP++ K A +LAE
Sbjct: 563 VITLDDSSFVRLMRKPEDELWVVDFFAPWCGPCQKLAPQWRKLAKQLAE 611



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +N+  LS A+F  ++       V++YAPWC  C+ L PE  +A+   A E
Sbjct: 455 QNLHALSPADFSNILNGHSAWFVDWYAPWCPPCRRLMPELRRASHHFAPE 504



 Score = 39.9 bits (89), Expect = 0.085
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           ++ LS+A++   I + +   + FY+P C HC  LAP + K +++L
Sbjct: 130 IVTLSRADYGNCIISAQAWFINFYSPNCHHCHELAPTWRKLSSEL 174



 Score = 38.3 bits (85), Expect = 0.26
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 5/76 (6%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSP-----IDYSGGRQADDIISWLKKKTG 426
           I++A+VD     DL  +  VRGYPT++ +  GS        Y+G R    +  W+     
Sbjct: 615 IRVAQVDCVANSDLCSAQNVRGYPTIRVYPLGSKGMNTVGMYNGNRDVVSLKRWVLNLLP 674

Query: 427 PPAVEVTSAEQAKELI 474
            P V +  AE  KE I
Sbjct: 675 SPVVAM-DAEAFKEQI 689


>UniRef50_Q018Z4 Cluster: Thioredoxin/protein disulfide isomerase;
           n=2; Ostreococcus|Rep: Thioredoxin/protein disulfide
           isomerase - Ostreococcus tauri
          Length = 515

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 24/77 (31%), Positives = 40/77 (51%)
 Frame = +1

Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 456
           VDAT+E++L   + +  YPTL  FR+G P  Y G R  + +  ++++    PA  +   +
Sbjct: 116 VDATREKELDARFEIEEYPTLVLFRDGVPKTYIGDRSPEHLDKFVRRNLLKPARFLEGTD 175

Query: 457 QAKELIDANTVIVFGFF 507
             +  +    V V GFF
Sbjct: 176 DVEVFLIGRAVSVIGFF 192



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           D +P + +V+ +    FE  VI   +++LV FYAPWC  CK++ P + K  T    E
Sbjct: 386 DPLPKDGDVVQIVGKTFEKLVIDNDKHVLVWFYAPWCRTCKAMKPVWEKLGTLYKNE 442



 Score = 40.7 bits (91), Expect = 0.049
 Identities = 19/49 (38%), Positives = 26/49 (53%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           E  T+E+V+ L    F+  I  + Y  V FYAPW GH K+  P +   A
Sbjct: 53  EALTDEHVVKLDAKAFDGEIKKSRYNFVMFYAPWDGHSKAFMPRWLSYA 101



 Score = 39.5 bits (88), Expect = 0.11
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI---DYSGGRQADDIISWLKKKTG 426
           I +AK+DAT+ +  A++  VR YPT+ ++  G      +Y G  + D II +LK++TG
Sbjct: 445 IIIAKMDATKNE--AKNVHVRHYPTVYYYHAGDKPRHEEYDGAMEPDAIIDFLKERTG 500


>UniRef50_A4UHA7 Cluster: Protein disulfide-isomerase; n=1;
           Alexandrium fundyense|Rep: Protein disulfide-isomerase -
           Alexandrium fundyense (Dinoflagellate)
          Length = 205

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 5/68 (7%)
 Frame = +2

Query: 56  AIALLGLALGDEVPTEENVLVLSKANFETVI-----TTTEYILVEFYAPWCGHCKSLAPE 220
           A ALL +  G  V    +V+ L+  NFE         TT    V+FYAPWCGHCKS+AP 
Sbjct: 9   AAALLSIR-GPWVVGASDVVELTDDNFEHDTQAASGATTGDWFVKFYAPWCGHCKSIAPI 67

Query: 221 YAKAATKL 244
           + + AT+L
Sbjct: 68  WEQVATEL 75



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 22/49 (44%), Positives = 29/49 (59%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISW 408
           + +AKVDAT  Q LA+ + +  YPTL  F       YSGGR  D +IS+
Sbjct: 79  VNVAKVDATVHQKLAKRFKIGSYPTLILFSQQKMYKYSGGRDKDALISY 127


>UniRef50_Q01AS5 Cluster: Thioredoxin/protein disulfide isomerase;
           n=2; Ostreococcus|Rep: Thioredoxin/protein disulfide
           isomerase - Ostreococcus tauri
          Length = 191

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 7/77 (9%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID---YSGGRQADDIISWLKKKTGPP 432
           + +  VD T+E+ L + YGV+GYPTLK+F   +      Y GGR  + + ++  +  GP 
Sbjct: 38  VVIGDVDCTKEESLCQKYGVQGYPTLKYFTGATAATGDAYQGGRDFEALQTFASENLGPS 97

Query: 433 A----VEVTSAEQAKEL 471
                +++ + EQ K +
Sbjct: 98  CGAENIDLCNEEQTKTI 114


>UniRef50_Q5CXJ5 Cluster: Thioredoxin; protein disulfide isomerase
           A6, signal peptide, possible transmembrane domain in
           C-terminal region; n=3; Cryptosporidium|Rep:
           Thioredoxin; protein disulfide isomerase A6, signal
           peptide, possible transmembrane domain in C-terminal
           region - Cryptosporidium parvum Iowa II
          Length = 524

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +2

Query: 77  ALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           A   + P  EN++ L +  F+  +   TT +   V+FYAPWCGHC+ L PE  K +
Sbjct: 26  AESQDYPKNENLINLKEYEFKEKVLDDTTDQIWFVKFYAPWCGHCRHLYPEILKVS 81



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 2/72 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQA-DDIISWLKKKTGPPA 435
           +K+AKVD + E  L +   V  YPT++ F  G+ I  Y   ++   DII +++K   P  
Sbjct: 90  VKIAKVDCSVETKLCKEQNVVSYPTMRIFSKGNLIKQYKRPKRTHTDIIKFIEKGIQPDI 149

Query: 436 VEVTSAEQAKEL 471
           +++ S +Q  EL
Sbjct: 150 IKIQSYDQINEL 161


>UniRef50_Q7ZA66 Cluster: Related to protein disulfide isomerase;
           n=2; Ustilago maydis|Rep: Related to protein disulfide
           isomerase - Ustilago maydis (Smut fungus)
          Length = 550

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + + +VD      L  SY +R YP L+ +  G+  +Y+GGR  D ++ W+ K      ++
Sbjct: 300 VNVLEVDCEANHALCASYNIRSYPVLRLYNQGNLKEYTGGRNHDAMLKWVLKAVSSSGLK 359

Query: 442 -VTSAEQAKELIDANTVI 492
            V+S+ +   L   N VI
Sbjct: 360 PVSSSTELVSLSKENEVI 377



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 13/90 (14%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA-------------PEYAKAAT 238
           T + +  L+ ANF T++    + L+EF++P C HCK                 +Y +A  
Sbjct: 45  THDGLRKLTAANF-TLVNDGAW-LIEFFSPVCVHCKKFGATWSELSQLRTRFTQYPQAPF 102

Query: 239 KLAEEDLLSN*RKLTQLKNRISPRATVYED 328
            LA+ D L+     T+   +  PR T+Y+D
Sbjct: 103 TLAQVDCLAQWDLCTEQGVQFLPRLTIYQD 132



 Score = 34.7 bits (76), Expect = 3.2
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAATKL 244
           V+F+APWC HCK++A  + + +  L
Sbjct: 272 VKFFAPWCPHCKAMAAAFKQLSQSL 296


>UniRef50_Q7KQL8 Cluster: Thioredoxin; n=7; Plasmodium|Rep:
           Thioredoxin - Plasmodium falciparum (isolate 3D7)
          Length = 104

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 17/41 (41%), Positives = 30/41 (73%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           +V S+A F+++I+  E ++V+F+A WCG CK +AP Y + +
Sbjct: 4   IVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECS 44


>UniRef50_UPI0000D56C28 Cluster: PREDICTED: similar to quiescin Q6
           isoform a; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to quiescin Q6 isoform a - Tribolium castaneum
          Length = 1304

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = +2

Query: 80  LGDEVPTEENVLVLSKANFETVI-TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           LGD    +++V +L+  NF+  +  +T   LVEFYA WCG+C+  AP + + AT+ A
Sbjct: 19  LGDLYLPDDDVEILTIENFKRYVENSTSAWLVEFYASWCGYCQRFAPPWKQFATEAA 75


>UniRef50_Q73R53 Cluster: Thioredoxin, selenocysteine-containing;
           n=2; Treponema denticola|Rep: Thioredoxin,
           selenocysteine-containing - Treponema denticola
          Length = 107

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 18/52 (34%), Positives = 34/52 (65%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           VL ++ ANF+  + T + +L++F+APWC  C  L+PE   A  +L ++ +++
Sbjct: 5   VLDITNANFDETVKTAKPVLIDFWAPWCPGCVQLSPELQAAEAELGDKAVIA 56


>UniRef50_Q7QSG3 Cluster: GLP_64_29074_28670; n=4; Giardia
           intestinalis|Rep: GLP_64_29074_28670 - Giardia lamblia
           ATCC 50803
          Length = 134

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 20/54 (37%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKK 420
           + +A+VD T  +++ +  GVRGYPTL+F++NG  ++ YSG R  + + +++  K
Sbjct: 80  VVIAEVDCTVAREVCQEEGVRGYPTLRFYKNGEFLEAYSGARDLESLKAFVTSK 133



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 16/41 (39%), Positives = 27/41 (65%)
 Frame = +2

Query: 128 ANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           ++F+  +   + ++V+F+APWCGHCK+LAP Y +      E
Sbjct: 38  SSFKAELAKGKPMMVKFFAPWCGHCKALAPTYVELGDNAPE 78


>UniRef50_Q4P3G1 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 537

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V +L  +NF+  +   E   +V F APWCGHC+ L P+Y+K A +L
Sbjct: 34  VTILDSSNFKREVLDIEKPTMVAFTAPWCGHCQKLVPDYSKVAAQL 79



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)
 Frame = +1

Query: 262 IKLAKVDATQEQD--LAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKKTG 426
           +K+A +D   +++      YG++G+PTLK F   +   P DY G R A DI +++     
Sbjct: 83  VKMASIDCDDDKNKPTCGKYGIQGFPTLKLFPPTKKRLPKDYQGPRSAKDIAAYMVDAL- 141

Query: 427 PPAVEVTSAEQAKELID 477
           P   +   AE+ +E  D
Sbjct: 142 PMGAKKLKAEELQEYAD 158


>UniRef50_A6RP52 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 251

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 16/20 (80%), Positives = 20/20 (100%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEY 223
           +L+EFYAPWCGHCK+LAP+Y
Sbjct: 95  VLIEFYAPWCGHCKALAPKY 114



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 24/70 (34%), Positives = 43/70 (61%), Gaps = 3/70 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + +AKVDAT   D+ +   ++G+PT+K ++ G+   P+ Y+G R  +D+I ++ K+ G  
Sbjct: 130 VTIAKVDATLN-DVPDE--IQGFPTIKLYKAGNKKNPVTYNGSRSIEDLIKFI-KENGQH 185

Query: 433 AVEVTSAEQA 462
            +EV   E A
Sbjct: 186 EIEVAYDENA 195


>UniRef50_Q2FU47 Cluster: Thioredoxin; n=1; Methanospirillum
           hungatei JF-1|Rep: Thioredoxin - Methanospirillum
           hungatei (strain JF-1 / DSM 864)
          Length = 154

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 17/48 (35%), Positives = 31/48 (64%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           E +L++++ NF  +I     ++++F+APWCG C+ LAP   + A + A
Sbjct: 41  EGILIVTQENFSRIIRENPNLIIDFWAPWCGPCRMLAPVIEQLAAEYA 88



 Score = 33.1 bits (72), Expect = 9.8
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG 381
           I+ AK +  + Q +A  +G+   P+L FF+NG+ I    G
Sbjct: 91  IRFAKCNTDENQQIAYQFGISAIPSLFFFQNGTIIHTVSG 130


>UniRef50_O13811 Cluster: Protein disulfide-isomerase C17H9.14c
           precursor; n=1; Schizosaccharomyces pombe|Rep: Protein
           disulfide-isomerase C17H9.14c precursor -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 359

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 27/40 (67%), Gaps = 1/40 (2%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEY 223
           NV+ L   NF+ V+   +  +LVEFYA WCG+CK LAP Y
Sbjct: 141 NVVELDSLNFDKVVMDDKKDVLVEFYADWCGYCKRLAPTY 180



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF-RNGS-PIDYSGGRQADDIISWLKKKTGPPA 435
           + + K+DA    D+A+ Y + G+PTL +F  +GS P+ YS  R  D +  ++ +KTG   
Sbjct: 74  VLIGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDSLTQFVSEKTGIKK 133

Query: 436 VEVTSAEQAKELIDAN 483
            ++       EL   N
Sbjct: 134 RKIVLPSNVVELDSLN 149



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 24/65 (36%), Positives = 34/65 (52%)
 Frame = +2

Query: 29  IEMRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKS 208
           + + +L F   AL  L     V   +++  L      T+  + +  L+EFYA WCGHCKS
Sbjct: 1   MRLPLLSFVIFALFALVFASGVVELQSLNELEN----TIRASKKGALIEFYATWCGHCKS 56

Query: 209 LAPEY 223
           LAP Y
Sbjct: 57  LAPVY 61



 Score = 37.1 bits (82), Expect = 0.60
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 3/58 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKKTG 426
           +++ K++A    D+   + V  +PT+KFF       P  Y G R  + +I ++ KK+G
Sbjct: 193 VEIVKINADVFADIGRLHEVASFPTIKFFPKDDKDKPELYEGDRSLESLIEYINKKSG 250


>UniRef50_UPI00015B52FE Cluster: PREDICTED: similar to Dnajc10
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to Dnajc10 protein - Nasonia vitripennis
          Length = 852

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/43 (48%), Positives = 30/43 (69%), Gaps = 1/43 (2%)
 Frame = +2

Query: 119 LSKANFE-TVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           L+  N E +V+ T + +LV++YAPWCGHC  L P++A AA  L
Sbjct: 729 LNDHNLEKSVLKTDDIVLVDYYAPWCGHCIILEPQFAIAAQLL 771



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+++APWCG C+ LAPE+ + A  L
Sbjct: 633 VVDYFAPWCGPCQQLAPEWTQVAKAL 658



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 17/89 (19%), Positives = 43/89 (48%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSP-----IDYSGGRQADDIISWLKKK 420
           S +K+A VD   ++ + ++  +R YPT++ +  GS        Y+G R A  ++ W+ + 
Sbjct: 662 SNVKIASVDCEAQKSVCQAQSIRSYPTIRLYPMGSEGLNSVALYNGQRDATSLLKWITQF 721

Query: 421 TGPPAVEVTSAEQAKELIDANTVIVFGFF 507
                 ++      K ++  + +++  ++
Sbjct: 722 LPVKVQDLNDHNLEKSVLKTDDIVLVDYY 750



 Score = 36.7 bits (81), Expect = 0.79
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L++ ++   +T +E +  V FY+P C HC  LAP + K A  L
Sbjct: 175 DPQIITLNRNDYFDSVTESEKMWFVNFYSPQCSHCHHLAPVWRKIAKDL 223


>UniRef50_Q1EV59 Cluster: Thioredoxin; n=2; Bacteria|Rep:
           Thioredoxin - Clostridium oremlandii OhILAs
          Length = 104

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 29/45 (64%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V+ +++ NF  VI  T  +LV+F+APWCG CK L P   + A +L
Sbjct: 2   VMEVNQGNFNEVIKDTVPVLVDFWAPWCGPCKMLGPVLEEVAVEL 46


>UniRef50_Q0F3P6 Cluster: Putative thioredoxin; n=1; Mariprofundus
           ferrooxydans PV-1|Rep: Putative thioredoxin -
           Mariprofundus ferrooxydans PV-1
          Length = 145

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 1/56 (1%)
 Frame = +2

Query: 83  GDEVPTEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           G ++P    V+  ++++F ETV+++   +LV+F+A WCG CK LAPE  K AT  A
Sbjct: 33  GADLPVNP-VMHCNESDFAETVLSSPIPVLVDFWAAWCGPCKMLAPELEKLATSFA 87


>UniRef50_Q50KB1 Cluster: Protein disulfide-isomerase-like protein
           EhSep2 precursor; n=1; Emiliania huxleyi|Rep: Protein
           disulfide-isomerase-like protein EhSep2 precursor -
           Emiliania huxleyi
          Length = 223

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 3/59 (5%)
 Frame = +1

Query: 262 IKLAKVDATQE-QDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWLKKKTGP 429
           + +A VD T   + L E YGVRGYPT+K+F   +    DY GGR  D++  + + + GP
Sbjct: 70  VLIADVDCTTGGKPLCEKYGVRGYPTIKYFNPPDEEGEDYKGGRSLDELKKFAENELGP 128



 Score = 40.7 bits (91), Expect = 0.049
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = +2

Query: 119 LSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           L+  NF E V+ + +   ++F APWCGHCK + P++   A+
Sbjct: 22  LTPDNFDELVLKSGKAAFIKFLAPWCGHCKKMKPDWDSLAS 62


>UniRef50_UPI0000D55597 Cluster: PREDICTED: similar to CG1837-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1837-PA - Tribolium castaneum
          Length = 382

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 2/73 (2%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPP 432
           S I +AKVD TQ + +   + V+GYPTL +  +G  +D Y G R  +D+ +++ K  G  
Sbjct: 197 SSISIAKVDCTQWRLVCNQFEVKGYPTLLWIEDGKKVDKYQGDRTHEDLKNYVSKMMGSS 256

Query: 433 AVEV-TSAEQAKE 468
            +   T   Q++E
Sbjct: 257 EIPTETEKPQSEE 269



 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           L++  FE  + T ++  ++FYAPWCGHC+ LAP + + A  L  +  +S
Sbjct: 153 LTEDTFEKFVATGKHF-IKFYAPWCGHCQKLAPVWEQLAKSLEFDSSIS 200



 Score = 45.6 bits (103), Expect = 0.002
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 3/60 (5%)
 Frame = +1

Query: 256 SPIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTG 426
           S + +AKVD T +  +DL     V G+PT+  ++NG  I +YSG R  +D+  ++K+  G
Sbjct: 319 SNVNIAKVDCTLDLNKDLCNEQEVEGFPTIFLYKNGDKISEYSGSRTLEDLYEFVKQHVG 378



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSP--IDYSGGRQADDIISWLKKK 420
           S I++AKVD T +  L   + V GYPTLKFF+ G+   I + G R    + +++ ++
Sbjct: 74  SNIRIAKVDCTTDSSLCSEHDVTGYPTLKFFKVGASEGIKFRGTRDLPTLTTFINEQ 130



 Score = 43.6 bits (98), Expect = 0.007
 Identities = 23/75 (30%), Positives = 40/75 (53%)
 Frame = +2

Query: 32  EMRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
           ++ VL+  A+ +   +  D+V T +     +  NF   +    + ++ FYAPWCGHC+ L
Sbjct: 4   KLSVLVLFAVFVNVFSHDDDVHTVK----YTTENFAQELPKKNHFVM-FYAPWCGHCQRL 58

Query: 212 APEYAKAATKLAEED 256
            P + + A  L E+D
Sbjct: 59  GPTWEQLAEMLNEDD 73



 Score = 41.1 bits (92), Expect = 0.037
 Identities = 15/33 (45%), Positives = 20/33 (60%)
 Frame = +2

Query: 155 TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           T    V+F+APWCGHCK LAP + +   K   +
Sbjct: 286 TGITFVKFFAPWCGHCKRLAPTWDELGKKFVAD 318


>UniRef50_UPI000065EEAF Cluster: Sulfhydryl oxidase 1 precursor (EC
           1.8.3.2) (Quiescin Q6) (hQSOX).; n=1; Takifugu
           rubripes|Rep: Sulfhydryl oxidase 1 precursor (EC
           1.8.3.2) (Quiescin Q6) (hQSOX). - Takifugu rubripes
          Length = 750

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           + ++ L+  N ETV + +T  I+ EFYA WCGHC + +P Y   A  + E
Sbjct: 52  DQIISLNAENVETVLVNSTAAIVAEFYASWCGHCVAFSPVYKSLARDIKE 101



 Score = 37.1 bits (82), Expect = 0.60
 Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 2/31 (6%)
 Frame = +1

Query: 262 IKLAKVD--ATQEQDLAESYGVRGYPTLKFF 348
           + LA VD  AT+ + L   YG++GYPTLKFF
Sbjct: 106 VDLAAVDCAATETRQLCFDYGIKGYPTLKFF 136


>UniRef50_Q122N1 Cluster: Thioredoxin; n=8; Comamonadaceae|Rep:
           Thioredoxin - Polaromonas sp. (strain JS666 / ATCC
           BAA-500)
          Length = 341

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 26/74 (35%), Positives = 37/74 (50%)
 Frame = +1

Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 444
           KL K+D+ QEQ L  ++G+R  PT     NG P+D   G   +  +     K  PPA E 
Sbjct: 95  KLVKIDSDQEQQLGAAFGIRSIPTCILMMNGQPVDGFAGALTEGKVKEFLDKHLPPA-EE 153

Query: 445 TSAEQAKELIDANT 486
              EQ  +L + +T
Sbjct: 154 QPEEQELQLEEEST 167



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 3/43 (6%)
 Frame = +2

Query: 128 ANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           ANFE  +     T  +L++F+APWCG CKSL P   K     A
Sbjct: 49  ANFEAEVVAASMTTPVLIDFWAPWCGPCKSLGPILEKVEVAYA 91


>UniRef50_A6Q9U3 Cluster: Thioredoxin; n=4; Bacteria|Rep:
           Thioredoxin - Sulfurovum sp. (strain NBC37-1)
          Length = 125

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 17/39 (43%), Positives = 26/39 (66%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           L+  NF   +T+ E ++++F+APWCG CK  AP + K A
Sbjct: 6   LTAQNFNEKVTSNEIVILDFWAPWCGPCKQFAPIFEKVA 44


>UniRef50_A6DP38 Cluster: Thioredoxin; n=1; Lentisphaera araneosa
           HTCC2155|Rep: Thioredoxin - Lentisphaera araneosa
           HTCC2155
          Length = 126

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query: 29  IEMRVLIFTAIALLGLALGDEVPTEENVLVLSKANFE-TVITTTEYILVEFYAPWCGHCK 205
           ++++ ++     LL L L      ++N++ ++  +F+  VI     +LV+F+A WCG CK
Sbjct: 1   MKLKTILIACALLLSLGLS---AADKNIIDVTDKDFDKNVIKKEGIVLVDFHATWCGPCK 57

Query: 206 SLAPEYAKAATK 241
            L+PE  K A K
Sbjct: 58  KLSPEITKLAEK 69


>UniRef50_Q9XWE1 Cluster: Putative uncharacterized protein dnj-27;
           n=4; Caenorhabditis|Rep: Putative uncharacterized
           protein dnj-27 - Caenorhabditis elegans
          Length = 788

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 3/53 (5%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTT---EYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +V+ +S   FE ++      E  LV+F+APWCG C+ LAPE  KAA ++A  D
Sbjct: 550 SVMEMSPEQFEELVMNRKDEETWLVDFFAPWCGPCQQLAPELQKAARQIAAFD 602



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +2

Query: 92  VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           +PTE  V+ L      TV+ ++E  +V+F+APWCGHC   AP Y + A +LA
Sbjct: 668 LPTE--VVSLGNDFHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDQIAKELA 717



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 16/55 (29%), Positives = 35/55 (63%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           ++ ++ VL++ ++E  I+  E+ +++++APWC  C  L  EY +  T  +E+ +L
Sbjct: 436 SKSHIHVLNRDSYEYAISGGEFYIIDYFAPWCPPCMKLLGEYRRFHTATSEDSML 490



 Score = 40.3 bits (90), Expect = 0.064
 Identities = 14/49 (28%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           ++ ++ L++A+F+ +++ +  I  + FY+ +C HC  LAP + K A ++
Sbjct: 115 DQEIVTLNRADFQRMVSDSNEIWFINFYSTYCSHCHQLAPTWRKFAREI 163


>UniRef50_Q7S9W2 Cluster: Putative uncharacterized protein
           NCU06344.1; n=5; Pezizomycotina|Rep: Putative
           uncharacterized protein NCU06344.1 - Neurospora crassa
          Length = 813

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 1/87 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG-PPAV 438
           + + +V+  QE  L +   V GYPT++FFR G  ++Y+G R   D +++ +K       V
Sbjct: 387 LNIGEVNCEQEARLCKDVRVTGYPTIQFFRGGERVEYTGLRGLGDFLAYAEKAIDISKGV 446

Query: 439 EVTSAEQAKELIDANTVIVFGFFWTRA 519
           +   A   K L +   VI F +F+  A
Sbjct: 447 QDVDAASFKALEEKEEVI-FVYFYDHA 472



 Score = 41.9 bits (94), Expect = 0.021
 Identities = 16/43 (37%), Positives = 30/43 (69%), Gaps = 1/43 (2%)
 Frame = +2

Query: 119 LSKANFETVITTT-EYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           L+  +F++ +T T E   ++FYAPWC HC+++A  +A+ A ++
Sbjct: 341 LTAESFQSQVTMTQEPWFIKFYAPWCHHCQAMAANWAQVAREM 383



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           ++VP    ++ L+  N+E     +++++V+ Y+P+C HC   AP Y
Sbjct: 36  NDVPVPP-LIELTPDNWEKESKASKWLMVKHYSPYCPHCIDFAPTY 80


>UniRef50_Q752L5 Cluster: AFR559Cp; n=1; Eremothecium gossypii|Rep:
           AFR559Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 307

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +2

Query: 56  AIALLGLALGDEV-PTEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAK 229
           A AL GLA    +     +V+ L+   F+  +  T +  LVEFYAPWCG+C+ L P   +
Sbjct: 24  AAALGGLAAAQNLYDRNPHVMELTAKTFKRAVHGTNHTTLVEFYAPWCGYCQKLKPTMER 83

Query: 230 AATKL 244
           AA  L
Sbjct: 84  AARAL 88


>UniRef50_UPI0000D5729D Cluster: PREDICTED: similar to CG8983-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8983-PA, isoform A - Tribolium castaneum
          Length = 508

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +2

Query: 14  KGADNIEMRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWC 193
           K   N+++ V+    + LL   +    P++ +VL LS  NF   +     +LV+F+ PW 
Sbjct: 6   KSVRNVKIPVMWPLLLLLLLQHIRPAHPSDAHVLSLSDTNFHRQLRLNPTLLVQFFIPWS 65

Query: 194 GHCKSLAPEYAKAATKLAEEDL 259
           G C+   P +A+AA  L+   +
Sbjct: 66  GMCQKTRPHFARAAHILSTNQI 87


>UniRef50_A0Q679 Cluster: Thioredoxin; n=11; Francisella
           tularensis|Rep: Thioredoxin - Francisella tularensis
           subsp. novicida (strain U112)
          Length = 108

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 20/38 (52%), Positives = 28/38 (73%), Gaps = 1/38 (2%)
 Frame = +2

Query: 107 NVLVLSKANFETVI-TTTEYILVEFYAPWCGHCKSLAP 217
           NV+   +ANF+ +I  T + +LV+FYA WCG CK+LAP
Sbjct: 5   NVIKTDEANFDKLIDNTNKAVLVDFYADWCGPCKTLAP 42


>UniRef50_Q7M1Q4 Cluster: Protein disulfide-isomerase; n=1; Glycine
           max|Rep: Protein disulfide-isomerase - Glycine max
           (Soybean)
          Length = 63

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 8/54 (14%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANF--------ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           +E   +E VL L  +NF        E V+   ++I+VEFYAPWCGHCK++  E+
Sbjct: 1   EESSEKEFVLTLDHSNFHDTVVKHDEVVLWKHDFIVVEFYAPWCGHCKNVLLEF 54



 Score = 38.3 bits (85), Expect = 0.26
 Identities = 12/14 (85%), Positives = 14/14 (100%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCK 205
           +L+EFYAPWCGHCK
Sbjct: 50  VLLEFYAPWCGHCK 63


>UniRef50_Q4QIX1 Cluster: Protein disulfide isomerase; n=4;
           Leishmania|Rep: Protein disulfide isomerase - Leishmania
           major
          Length = 133

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 2/72 (2%)
 Frame = +2

Query: 53  TAIALLGLALGDEVPTEENVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAK 229
           T   LL +AL   V  +  ++ L+ ANF  V+   ++ + V FYAPWCGHC ++ P + +
Sbjct: 7   TLAVLLAVALL-VVCAKAEIVELNPANFHKVVKDPSKNVFVMFYAPWCGHCNNMKPMWLE 65

Query: 230 AATKL-AEEDLL 262
            A K    ED++
Sbjct: 66  LADKYPTAEDVI 77



 Score = 41.1 bits (92), Expect = 0.037
 Identities = 16/51 (31%), Positives = 33/51 (64%), Gaps = 3/51 (5%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFR---NGSPIDYSGGRQADDIISWL 411
           +A++DA++ + +A+ + +RG+PTLKFF        I+Y G R+    ++++
Sbjct: 78  IARIDASEYRGIAKEFDIRGFPTLKFFSKRDKSGEIEYDGPRELSAFVAYV 128


>UniRef50_A0RZ24 Cluster: Thiol-disulfide isomerase; n=1;
           Cenarchaeum symbiosum|Rep: Thiol-disulfide isomerase -
           Cenarchaeum symbiosum
          Length = 135

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 22/59 (37%), Positives = 34/59 (57%)
 Frame = +2

Query: 65  LLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           L+G     ++  +  VL L  +NF+ VI     +LV+F+A WCG CKS+ P + + A K
Sbjct: 17  LMGEHREGQLAAKAGVLELDTSNFDGVIGAGGLVLVDFWAEWCGPCKSMHPIFERMAKK 75



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 21/53 (39%), Positives = 28/53 (52%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           IK A+V+    Q +A  YGV+  PT   FR+GSP D   G   +  I  + KK
Sbjct: 79  IKFARVNVDNAQPIAHRYGVQAIPTFVMFRDGSPADRMTGAVGEPGIHMIAKK 131


>UniRef50_A5AGF4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 277

 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 16/26 (61%), Positives = 23/26 (88%)
 Frame = +2

Query: 161 YILVEFYAPWCGHCKSLAPEYAKAAT 238
           ++LVEF+APWCG+CK+L P + KAA+
Sbjct: 148 FVLVEFFAPWCGYCKALTPTWEKAAS 173


>UniRef50_Q7QEL4 Cluster: ENSANGP00000017364; n=5;
           Endopterygota|Rep: ENSANGP00000017364 - Anopheles
           gambiae str. PEST
          Length = 400

 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 22/49 (44%), Positives = 29/49 (59%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           V+ LS+ +F   I     + V+FYAPWCGHC  LAP + + A KL   D
Sbjct: 286 VVQLSEGDFAHAIAKGVTV-VKFYAPWCGHCMRLAPTWEQLAEKLTARD 333



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 18/39 (46%), Positives = 27/39 (69%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           L+K NF++ +  + Y ++ FYAPWC +CK LAP +A  A
Sbjct: 22  LTKDNFQSELEGSSYFVM-FYAPWCDYCKKLAPTWATLA 59



 Score = 43.2 bits (97), Expect = 0.009
 Identities = 16/28 (57%), Positives = 19/28 (67%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V+FYAPWCGHC  LAP + + A  L  E
Sbjct: 170 VKFYAPWCGHCTKLAPTWEELARSLEHE 197



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTG 426
           I+++K+D TQ + +   + V+GYPTL +  +G  I+ Y+G R   D+  ++ +  G
Sbjct: 200 IRVSKIDCTQYRPICTDFEVKGYPTLLWIEDGKKIEKYTGPRTHADLKQYVARMAG 255



 Score = 41.1 bits (92), Expect = 0.037
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 5/72 (6%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID----YSGGRQADDIISWLKKK-TG 426
           +K+ +VD T + DL   + V GYP LK FR     D    Y G R      +W +++ T 
Sbjct: 70  VKIGRVDCTTDGDLCTQHDVTGYPMLKLFRKDGGADGATKYRGARDLAQFNAWHRRRATA 129

Query: 427 PPAVEVTSAEQA 462
            P     +A  A
Sbjct: 130 RPRAPTGTARTA 141



 Score = 37.1 bits (82), Expect = 0.60
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 3/52 (5%)
 Frame = +1

Query: 253 RSPIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDI 399
           R  + +AKVD T +  ++L     V GYPT+  +R+G  + +Y G R  DD+
Sbjct: 332 RDGVTIAKVDCTVDANKELCGEQEVNGYPTVFLYRDGEKVTEYFGHRSLDDL 383


>UniRef50_Q25549 Cluster: Thioredoxin homolog; n=1; Naegleria
           fowleri|Rep: Thioredoxin homolog - Naegleria fowleri
          Length = 98

 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417
           +K  K+D  + QD+A  YG+   PT +FF+NG+ +D   G   D +   +KK
Sbjct: 43  VKFLKIDVDECQDIALEYGIEAMPTFQFFKNGTKVDEVQGADPDSLEQLVKK 94


>UniRef50_A1DGY3 Cluster: Disulfide isomerase, putative; n=10;
           Pezizomycotina|Rep: Disulfide isomerase, putative -
           Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 737

 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG-PPAV 438
           + + +V+   E  L +   V  YPT+ FFR G  ++Y+G R   D++++ KK       V
Sbjct: 321 LNVGEVNCDAEPRLCKDARVNAYPTMYFFRGGERVEYTGLRGLGDLVNYAKKAVDIGSGV 380

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
           +   A Q K+L +   VI   F+
Sbjct: 381 QDVDAAQFKQLEEKEEVIFLYFY 403



 Score = 43.6 bits (98), Expect = 0.007
 Identities = 18/43 (41%), Positives = 30/43 (69%), Gaps = 1/43 (2%)
 Frame = +2

Query: 119 LSKANFETVITTT-EYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           L+  +F+ ++TTT +   V+FYAPWC HC++LAP +   A ++
Sbjct: 275 LTAESFQKLVTTTRDPWFVKFYAPWCHHCQALAPVWQGMAREM 317



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +2

Query: 83  GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           G EVP  +    L+  NFE  +T   Y  V+ Y+P C HCK++AP +
Sbjct: 58  GVEVPPLKE---LTPENFEE-LTKNGYWFVKHYSPSCPHCKAIAPTW 100


>UniRef50_UPI000049912A Cluster: protein disulfide isomerase; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: protein disulfide
           isomerase - Entamoeba histolytica HM-1:IMSS
          Length = 125

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           ++ ++ L+K+N E V+   + ++V+F++P+C HC   +P Y++ A K+  E+ L
Sbjct: 17  KQGLVQLNKSNHELVLKQNKNVIVKFFSPYCPHCVRFSPIYSEFAVKMQNEENL 70



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSG-GRQADDIISWLKK 417
           +A+++    +DL   Y +RGYPT+ F+ NG  ++  G  R  D+++ + KK
Sbjct: 72  VAELNCVDFRDLCGFYKIRGYPTVNFYHNGEFVERFGQQRTVDNLVEFSKK 122


>UniRef50_Q4SZH6 Cluster: Chromosome 18 SCAF11624, whole genome
           shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 18
           SCAF11624, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 511

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S +KLA VD   E+DLA+   V G   ++ +  G   SP+     +++  I++WL+++ G
Sbjct: 79  SEVKLAAVDTATEKDLAKELNVTGRSQIRLYVAGDKHSPVVCPVPQRSTSILTWLRRRAG 138

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
            P   +T   Q +   DA  V   GFF
Sbjct: 139 SPEDLITDLSQLEASEDATVV---GFF 162


>UniRef50_Q30NQ8 Cluster: Thioredoxin; n=1; Thiomicrospira
           denitrificans ATCC 33889|Rep: Thioredoxin -
           Thiomicrospira denitrificans (strain ATCC 33889 / DSM
           1351)
          Length = 140

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 18/40 (45%), Positives = 29/40 (72%), Gaps = 1/40 (2%)
 Frame = +2

Query: 119 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAA 235
           L+  NF+ VI  ++  ++V+F+APWCG CK +AP + K+A
Sbjct: 40  LTTLNFDEVIVNSDIPVVVDFWAPWCGPCKMMAPNFQKSA 79


>UniRef50_Q22D05 Cluster: Thioredoxin family protein; n=2;
           Tetrahymena thermophila SB210|Rep: Thioredoxin family
           protein - Tetrahymena thermophila SB210
          Length = 425

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 3/64 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           I +AK+D T          +R +PT+KF++NG+   P+D+   R  +DI+ +LK+KT  P
Sbjct: 360 IIIAKIDYTAND--VPGVNIRRFPTIKFYQNGNKSTPLDFEDDRTEEDILKFLKEKTTFP 417

Query: 433 AVEV 444
            VE+
Sbjct: 418 WVEM 421



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 3/57 (5%)
 Frame = +2

Query: 86  DEVPT--EENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           +++P   +E V VL   +F+  VI + + +LV+FYAPW GH K  AP     A KL+
Sbjct: 297 EDIPATNDEPVKVLVGNSFDDLVINSNKDVLVQFYAPWVGHGKKFAPILEAVAKKLS 353


>UniRef50_UPI0000F1E902 Cluster: PREDICTED: similar to
           quiescin/sulfhydryl oxidase; n=9; Danio rerio|Rep:
           PREDICTED: similar to quiescin/sulfhydryl oxidase -
           Danio rerio
          Length = 778

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFE-TVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           + V+VL+  N + T+   T  +LVEFYA WCGHC + +P +   A  + E
Sbjct: 48  DQVIVLTPENVDSTLFNNTAALLVEFYATWCGHCIAFSPVWKSLARDIKE 97


>UniRef50_Q1H092 Cluster: Thioredoxin-related; n=2;
           Methylophilales|Rep: Thioredoxin-related -
           Methylobacillus flagellatus (strain KT / ATCC 51484 /
           DSM 6875)
          Length = 124

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 17/42 (40%), Positives = 29/42 (69%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           VL L+KANF+  I + ++++V+F+APWC  C +  P +  A+
Sbjct: 3   VLQLTKANFKHTIESNDFVIVDFWAPWCQPCVAFTPVFEAAS 44


>UniRef50_Q0PQP1 Cluster: Thioredoxin domain-containing protein;
           n=1; Endoriftia persephone 'Hot96_1+Hot96_2'|Rep:
           Thioredoxin domain-containing protein - Endoriftia
           persephone 'Hot96_1+Hot96_2'
          Length = 121

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 20/51 (39%), Positives = 34/51 (66%), Gaps = 1/51 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKK 417
           LAK++  ++++LA  YG+R  PT+K FRNG P+D + G     +I ++L +
Sbjct: 17  LAKLNTEEQRELAAQYGIRSLPTVKLFRNGQPLDEFMGALPEREIRTFLDR 67


>UniRef50_A6Q4J2 Cluster: Thioredoxin; n=3; Proteobacteria|Rep:
           Thioredoxin - Nitratiruptor sp. (strain SB155-2)
          Length = 143

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 1/40 (2%)
 Frame = +2

Query: 119 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAA 235
           L  +NFE +IT  +  ++V+F+APWCG C+ +AP +  AA
Sbjct: 43  LDPSNFEIMITKNDIPVIVDFWAPWCGPCRMMAPNFEAAA 82



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = +1

Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKK 417
           + AK++  +   LA  +G+RG PT+  F +G  +D  SG   A  I+ W+++
Sbjct: 90  RFAKLNTEEYPQLAAPFGIRGIPTMIAFLHGKELDRVSGALSAPQIVQWVQR 141


>UniRef50_A3V9L9 Cluster: Thioredoxin; n=3; Rhodobacterales|Rep:
           Thioredoxin - Rhodobacterales bacterium HTCC2654
          Length = 148

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 17/28 (60%), Positives = 23/28 (82%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           +LV+F+APWCG C+ +APE+ KAA  LA
Sbjct: 60  LLVDFWAPWCGPCRMMAPEFQKAAQSLA 87


>UniRef50_Q017M1 Cluster: Thioredoxin-related protein, putative;
           n=2; Ostreococcus|Rep: Thioredoxin-related protein,
           putative - Ostreococcus tauri
          Length = 246

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 19/48 (39%), Positives = 31/48 (64%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V+ L++ NF+  +T    +LV+ YA WC HC++LAP + + A +L  E
Sbjct: 39  VVDLTETNFDEALTRGTPVLVKVYADWCKHCQALAPVWGEVARELEGE 86



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDY-SGGRQADDIISWLKK 417
           +A+VD  + + L +  G +GYPT+  F+ G   +Y SG R    ++S+ +K
Sbjct: 89  VARVDGPKNRLLVKRIGAKGYPTIALFKGGKMYEYDSGDRSVHALVSFARK 139


>UniRef50_Q9VI96 Cluster: CG10029-PA; n=3; Diptera|Rep: CG10029-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 410

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 441
           L KV+   E  LA+ + +  YPT+K  RNG     +Y G R  + +  +++K+   P  E
Sbjct: 85  LGKVNCDTEDILADQFDILKYPTIKIVRNGLIGNQEYRGQRSVEALFQFVEKELSDPIKE 144

Query: 442 VTSAEQAKELIDANTVIVFGFFWTRAQPE 528
             + +  K  +D    IV G+F ++   E
Sbjct: 145 FHNIDDLKN-VDVGYGIVIGYFISKDHAE 172



 Score = 40.3 bits (90), Expect = 0.064
 Identities = 19/69 (27%), Positives = 39/69 (56%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           I  ++A+L ++L   V    +V+ ++  N + +I + E +L+ FY  WC   + L P + 
Sbjct: 9   ILYSLAIL-VSLHSLVAGNSSVVAVTHENLQGIIDSNELVLLSFYTDWCRFSQILQPIFE 67

Query: 227 KAATKLAEE 253
           +AA K+ ++
Sbjct: 68  EAAAKVIQK 76


>UniRef50_Q9GRP8 Cluster: Putative uncharacterized protein L7845.03;
           n=4; Leishmania|Rep: Putative uncharacterized protein
           L7845.03 - Leishmania major
          Length = 562

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 5/52 (9%)
 Frame = +2

Query: 104 ENVLVLSKANFETVI-----TTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           ++++VL+ ANFE+ +      T    LV  Y+PWC HCKSL P++  A+ +L
Sbjct: 58  DSMVVLNNANFESYLFPSKRATPRAFLVLCYSPWCPHCKSLLPQFLNASMQL 109


>UniRef50_Q7Z0N9 Cluster: Protein disulfide isomerase1-1 precursor;
           n=2; Paramecium tetraurelia|Rep: Protein disulfide
           isomerase1-1 precursor - Paramecium tetraurelia
          Length = 485

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVL-VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           +F  I  L + +    P EEN L V+   N +      E  ++ FY P CGHC+   PE 
Sbjct: 1   MFLQIFALSIFILCAQPKEENDLHVVFDKNSKQFFEKNEVSMIFFYTPQCGHCERFQPEV 60

Query: 224 AKAATKLAEE 253
            KAA +L EE
Sbjct: 61  EKAAKQLKEE 70



 Score = 38.3 bits (85), Expect = 0.26
 Identities = 20/76 (26%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = +1

Query: 271 AKVDATQEQDLAESYGVRGYPTLKFFR-NGSPI-DYSGGRQADDIISWLKKKTGPPAVEV 444
           AKVD    +D+A+ + V GYP++   + +G     + G R +D +I W+ ++      E+
Sbjct: 75  AKVDGHNYKDIAKQFEVTGYPSVFLSQDHGKKYKKFEGPRTSDSVIMWMYEQLNEGTKEL 134

Query: 445 TSAEQAKELIDANTVI 492
            + +Q K+ I  + ++
Sbjct: 135 KTIQQIKDKISQSQLM 150


>UniRef50_Q20063 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 601

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           P  E ++ L +  F   + +    LVEFYA WCGHC++ AP + + A  + +
Sbjct: 48  PGFEPIMHLDQMTFNDTVFSDRAFLVEFYADWCGHCRAFAPYFRQFANMVRD 99


>UniRef50_A7RXE0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 844

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 3/57 (5%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTT---EYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLSN 268
           +V+ LS   FE+++      E  LV+FYAPWCG C+ L P++ K A ++  E  L +
Sbjct: 538 SVVQLSPETFESLVHNKKIGETWLVDFYAPWCGPCQELLPDWNKLAKRMEGETFLGS 594



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 22/72 (30%), Positives = 33/72 (45%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 438
           P+    VD T    L   Y +R YPT   + N  P  + G   A DII +++    P  V
Sbjct: 481 PVGFGTVDCTVHSQLCHQYNIRSYPTTILYNNSQPHQFIGHHNALDIIEFVENTLKPSVV 540

Query: 439 EVTSAEQAKELI 474
           ++ S E  + L+
Sbjct: 541 QL-SPETFESLV 551



 Score = 43.6 bits (98), Expect = 0.007
 Identities = 19/43 (44%), Positives = 26/43 (60%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V SK  F  V+ + +  +V+FYAPWCG C   AP+Y + A  L
Sbjct: 655 VNSKNFFTDVLASEDAWVVDFYAPWCGPCMRFAPKYEQLAKML 697



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +2

Query: 74  LALGDEVPTEENVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAA 235
           +AL  +     NV  L   +F + +T+ +    V+F+APWC  C  L PEY KAA
Sbjct: 420 IALFAKESVSSNVHALGPEDFPSSVTSPSRPFFVDFFAPWCPPCMRLLPEYRKAA 474



 Score = 37.9 bits (84), Expect = 0.34
 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ LS ++F+  +  +E I  + +Y+P+C HC  LAP + + A  L
Sbjct: 116 DPEIITLSYSDFQMSVEGSEDIWFINYYSPFCSHCHDLAPTWREVARDL 164


>UniRef50_Q8TGI0 Cluster: Cytosolic thioredoxin I; n=1; Podospora
           anserina|Rep: Cytosolic thioredoxin I - Podospora
           anserina
          Length = 161

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 16/42 (38%), Positives = 30/42 (71%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           E + + +      +IT+T+Y++++F+A WCG CK++AP +AK
Sbjct: 3   EPIKISTLDELNQLITSTKYVILDFWAEWCGPCKAIAPLFAK 44


>UniRef50_Q6FPP9 Cluster: Similar to sp|P40557 Saccharomyces
           cerevisiae YIL005w; n=1; Candida glabrata|Rep: Similar
           to sp|P40557 Saccharomyces cerevisiae YIL005w - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 708

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 25/59 (42%), Positives = 35/59 (59%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLSN*RKLTQL 289
           L L+K NFE  ++   + LVEFY+P+C HCK+LAP +        EE    N  KL+Q+
Sbjct: 37  LPLNKKNFEVELSNG-FHLVEFYSPYCSHCKNLAPIWEDTWVSFREEGKKLN-MKLSQV 93


>UniRef50_Q5KCK8 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 570

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 16/27 (59%), Positives = 22/27 (81%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +LVE++APWCGHCK+L P Y + A +L
Sbjct: 185 VLVEYFAPWCGHCKALRPTYEQLALEL 211



 Score = 38.7 bits (86), Expect = 0.20
 Identities = 16/74 (21%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + +A V+    + L  + G++ YPT++   +G+  +YSG R    +  + ++   P ++ 
Sbjct: 215 LNVAAVNCDDHRALCVNSGIKAYPTIRLLHHGTSAEYSGARSLAKLKEFSQRAEKPASLT 274

Query: 442 VTSAEQAKELIDAN 483
              A    +++ AN
Sbjct: 275 SIKAGDFDKIVSAN 288


>UniRef50_P32474 Cluster: Protein disulfide-isomerase EUG1
           precursor; n=3; Saccharomyces cerevisiae|Rep: Protein
           disulfide-isomerase EUG1 precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 517

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 20/51 (39%), Positives = 34/51 (66%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           ++LVL++  F++ I +   +LVEF+APWC H + L P   +AA+ L E ++
Sbjct: 34  DLLVLTEKKFKSFIESHPLVLVEFFAPWCLHSQILRPHLEEAASILKEHNV 84



 Score = 41.1 bits (92), Expect = 0.037
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 3/60 (5%)
 Frame = +2

Query: 86  DEVPTEE--NVL-VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +E+P E+  NV  ++ K + + V    + +LV++YA WC H K  AP Y + A  LA ++
Sbjct: 367 EEIPKEQKSNVYKIVGKTHDDIVHDDDKDVLVKYYATWCIHSKRFAPIYEEIANVLASDE 426


>UniRef50_UPI00005840BF Cluster: PREDICTED: similar to MGC81459
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to MGC81459 protein -
           Strongylocentrotus purpuratus
          Length = 817

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/48 (43%), Positives = 32/48 (66%), Gaps = 3/48 (6%)
 Frame = +2

Query: 110 VLVLSKANFETVITTT---EYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V+ LS+  F++++      +  LV+FYAPWCG C++L PE+ K A KL
Sbjct: 579 VITLSQDLFDSLVKNRAKGDLWLVDFYAPWCGPCQALMPEWRKFAKKL 626



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 22/63 (34%), Positives = 40/63 (63%), Gaps = 1/63 (1%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           +AL+G  + + +PT  +V ++++ NF + V+ +T+  +V+FYAPWCG C +  P   + A
Sbjct: 679 MALMGW-VQNFLPT--SVEIITQGNFRDLVLRSTDPWVVDFYAPWCGPCMAYMPSLEEVA 735

Query: 236 TKL 244
             L
Sbjct: 736 KAL 738



 Score = 40.3 bits (90), Expect = 0.064
 Identities = 16/48 (33%), Positives = 29/48 (60%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ LSK++FE  +   +  +V FY+P C HC  LAP + + A ++
Sbjct: 128 DPEIVTLSKSDFEQSVFGEDIWIVNFYSPRCHHCHDLAPAWREFAKEV 175



 Score = 37.1 bits (82), Expect = 0.60
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 6/97 (6%)
 Frame = +2

Query: 116 VLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL-----AEEDLLSN*RK 277
           VL   +F + VI + E   V+F++P C  CK L PE  KAA+++        D  ++   
Sbjct: 476 VLGPKDFPDPVINSGELWFVDFFSPHCPPCKQLLPEVRKAASRVPYVNFGTVDCTTHQAL 535

Query: 278 LTQLKNRISPRATVYEDTRLSNSSGMAVLSTIQVVVK 388
            +Q   R  P    + D++   S G +    IQ  ++
Sbjct: 536 CSQQNIRSYPTTVFFNDSKPHVSVGFSNSHAIQEFIE 572


>UniRef50_Q7W665 Cluster: Thioredoxin 2; n=4; Bordetella|Rep:
           Thioredoxin 2 - Bordetella parapertussis
          Length = 127

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 16/43 (37%), Positives = 29/43 (67%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           +++ L+K  F+  IT    ++++F+APWCG C+  AP + +AA
Sbjct: 2   SIVELTKDTFQDAITPDGTLIIDFWAPWCGPCRGFAPVFEQAA 44


>UniRef50_Q5LWA0 Cluster: Thioredoxin; n=3; Rhodobacteraceae|Rep:
           Thioredoxin - Silicibacter pomeroyi
          Length = 141

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 17/28 (60%), Positives = 23/28 (82%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           ++V+F+APWCG C+ + PEYAKAA  LA
Sbjct: 59  LVVDFWAPWCGPCRMMGPEYAKAAGVLA 86



 Score = 38.7 bits (86), Expect = 0.20
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%)
 Frame = +1

Query: 241 AG*RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK 414
           AG      +L K+D  + Q     YG+RG PT+  F  G      SG  Q+  I+ W++
Sbjct: 82  AGVLAGQARLVKLDTQKHQSTGGRYGIRGIPTMVAFERGKEKKRQSGAMQSGQIVGWVR 140


>UniRef50_A4A5R1 Cluster: Thioredoxin domain-containing protein;
           n=3; Gammaproteobacteria|Rep: Thioredoxin
           domain-containing protein - Congregibacter litoralis
           KT71
          Length = 291

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/71 (30%), Positives = 41/71 (57%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 447
           LAKV+A  +Q +A+ +GVR  PT+   R+G P+D   G Q++  +  + +K  P   +  
Sbjct: 65  LAKVNADDQQMIAQQFGVRSLPTVMVMRDGQPVDGFAGAQSEQAVREMLEKHLPSPYD-A 123

Query: 448 SAEQAKELIDA 480
           + ++A  L+ +
Sbjct: 124 ALQEANALLQS 134



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 19/63 (30%), Positives = 32/63 (50%)
 Frame = +2

Query: 77  ALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           A+ D   T  N+   + A +    ++   ++++F+A WC  CK L P   K AT+ A   
Sbjct: 4   AMPDTPETIVNIDESNAARYLIEESSQRPVVIDFWADWCEPCKVLMPLLEKLATEYAGGF 63

Query: 257 LLS 265
           LL+
Sbjct: 64  LLA 66


>UniRef50_Q1HR86 Cluster: Thiol-disulfide isomerase; n=4;
           Culicidae|Rep: Thiol-disulfide isomerase - Aedes aegypti
           (Yellowfever mosquito)
          Length = 322

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query: 29  IEMRV-LIFTAIALLGLA--LGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGH 199
           +++RV  I T + +LG    +G     +  V+ L ++N++ ++T  E  LVEFYAPWC  
Sbjct: 2   MQLRVGRIATLLVVLGAIGWIGPIRAAKSQVIELDESNWDRMLT--EEWLVEFYAPWCPA 59

Query: 200 CKSLAPEYAKAAT 238
           CK+LAP +   +T
Sbjct: 60  CKNLAPVWDDLST 72



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 17/53 (32%), Positives = 28/53 (52%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           IK AKVD T    L+  + V   PT+    NG    Y G R  + +++++++K
Sbjct: 79  IKTAKVDVTTSPGLSGRFFVTALPTIFHVLNGEFRQYKGPRDLNSLMTFIEEK 131


>UniRef50_Q6BKX9 Cluster: Debaryomyces hansenii chromosome F of
           strain CBS767 of Debaryomyces hansenii; n=1;
           Debaryomyces hansenii|Rep: Debaryomyces hansenii
           chromosome F of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 392

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +2

Query: 110 VLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           VL ++   F + VIT+ +Y LV+FYA WC HCK++ P Y + +     E
Sbjct: 21  VLQVNDQKFKDVVITSGKYTLVKFYADWCRHCKNMLPAYEEVSRLFENE 69



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 2/61 (3%)
 Frame = +2

Query: 80  LGDEVPTEENVLVLSKANFETVITTTEYI--LVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           LG     +  VL L+  NF+  +   +    +V F A WCGHCK+L P + K A  +   
Sbjct: 137 LGKPDGEKSQVLELNDLNFQEKVLDNDKATTIVAFTALWCGHCKTLLPIWEKLANDVYVN 196

Query: 254 D 256
           D
Sbjct: 197 D 197


>UniRef50_Q2KFP4 Cluster: Putative uncharacterized protein; n=4;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Magnaporthe grisea 70-15
          Length = 1340

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 16/52 (30%), Positives = 33/52 (63%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           V V S A +  +++++  ++ +FYA WCG CK +AP +   +TK ++ + ++
Sbjct: 3   VHVTSAAQWRQILSSSSVVITDFYADWCGPCKMIAPTFESLSTKYSKPNRIT 54


>UniRef50_Q11P71 Cluster: Thioredoxin; n=1; Cytophaga hutchinsonii
           ATCC 33406|Rep: Thioredoxin - Cytophaga hutchinsonii
           (strain ATCC 33406 / NCIMB 9469)
          Length = 229

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 15/40 (37%), Positives = 26/40 (65%)
 Frame = +2

Query: 134 FETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           FE ++ T +Y+L++FYA WCG CK + P     A  ++++
Sbjct: 138 FEALLVTDKYVLIDFYATWCGPCKMMEPALEDIAATMSDK 177


>UniRef50_Q0M233 Cluster: Thioredoxin-related; n=1; Caulobacter sp.
           K31|Rep: Thioredoxin-related - Caulobacter sp. K31
          Length = 153

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 22/50 (44%), Positives = 34/50 (68%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLSN*RKLTQLKNRISPRA 313
           ILV+ +APWCG C+S+AP++A AA +L E D+     +L +L +   P+A
Sbjct: 58  ILVDVWAPWCGPCRSMAPQFAAAAARL-EPDV-----RLLKLNSEAEPQA 101



 Score = 34.3 bits (75), Expect = 4.2
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISW 408
           ++L K+++  E   A + GV G P L  +R+G+ I  S G   A  I++W
Sbjct: 88  VRLLKLNSEAEPQAAGALGVSGIPALLLYRDGAVIARSAGLMSAAQIVAW 137


>UniRef50_A3HLB9 Cluster: Thioredoxin; n=20; Bacteria|Rep:
           Thioredoxin - Pseudomonas putida (strain GB-1)
          Length = 359

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDII-SWLKKKTGPPAVEV 444
           LAK++   EQ +   +G+R  PT+  F++G P+D   G Q +  I + L+     PA   
Sbjct: 130 LAKINCDVEQQVVAQFGIRSLPTVVLFKDGQPVDGFAGAQPESAIRAMLEPHVQMPAAPA 189

Query: 445 TS-AEQAKEL 471
            S  EQAK L
Sbjct: 190 ASPLEQAKAL 199



 Score = 35.9 bits (79), Expect = 1.4
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
 Frame = +2

Query: 128 ANFETVITTTEY---ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           A F+ ++    +   +LV+F+A WC  CK+L P  AK A     E LL+
Sbjct: 83  ATFQQLVIENSFHKPVLVDFWAEWCAPCKALMPLLAKIAEGYQGELLLA 131


>UniRef50_Q5CKS0 Cluster: Transmembrane protein 17; n=2;
           Cryptosporidium|Rep: Transmembrane protein 17 -
           Cryptosporidium hominis
          Length = 366

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 19/56 (33%), Positives = 33/56 (58%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           R  + +AK+D ++ Q L   +G+   P+ +FFRNG    Y+G R A+ I +++  K
Sbjct: 117 RESLNVAKIDVSKNQQLINRFGIVAVPSFRFFRNGKMYTYTGMRNAEVIKAFIWNK 172


>UniRef50_UPI0000499AC2 Cluster: protein disulfide isomerase; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: protein disulfide
           isomerase - Entamoeba histolytica HM-1:IMSS
          Length = 379

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 16/26 (61%), Positives = 21/26 (80%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKL 244
           ++  YAPWCGHCK LAPE+A AA ++
Sbjct: 42  ILMLYAPWCGHCKHLAPEFASAAKEV 67



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 30/82 (36%), Positives = 43/82 (52%), Gaps = 6/82 (7%)
 Frame = +1

Query: 271 AKVDATQEQDLAESYGVRGYPTLKFF------RNGSPIDYSGGRQADDIISWLKKKTGPP 432
           A VD  + +D+  +YGV+G+PT+K F      +  +P DY+G R+A   IS       P 
Sbjct: 74  AAVDCEEHRDICGNYGVQGFPTVKLFDAQQGHQRRTPRDYNGPREA-RAISGTMYSMIPD 132

Query: 433 AVEVTSAEQAKELIDANTVIVF 498
            VE    E  K   D N+VI+F
Sbjct: 133 WVETIPTELNK---DENSVILF 151


>UniRef50_Q4RUD3 Cluster: Chromosome 1 SCAF14995, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 1 SCAF14995, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 1104

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           + +++L+  + E+V + +T  I+ EFYA WCGHC + +P Y   A  + E
Sbjct: 50  DQIILLNAKSVESVLVNSTAAIVAEFYASWCGHCVAFSPVYKTLARDIKE 99



 Score = 33.1 bits (72), Expect = 9.8
 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%)
 Frame = +1

Query: 262 IKLAKVD--ATQEQDLAESYGVRGYPTLKFF 348
           + LA VD  A + + +   YGV+GYPT+KFF
Sbjct: 104 VDLAAVDCAAMETRQVCLDYGVKGYPTIKFF 134


>UniRef50_Q3YR36 Cluster: Thioredoxin; n=3; canis group|Rep:
           Thioredoxin - Ehrlichia canis (strain Jake)
          Length = 110

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/48 (45%), Positives = 33/48 (68%), Gaps = 3/48 (6%)
 Frame = +2

Query: 119 LSKANFET-VITTTE--YILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +S ++F + VI+  E   ILV+F+APWCG CK+L P+  K A + AE+
Sbjct: 9   ISDSDFHSKVISCNEDILILVDFWAPWCGPCKTLEPQLEKLAQQYAEQ 56



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWL 411
           +K+ K+     QD+A  YGV   PT   F+NG  +    G     II+ L
Sbjct: 57  VKIYKLSIEDNQDVAIQYGVSAVPTTLMFKNGKKLSQVIGADIAKIINEL 106


>UniRef50_Q5CE99 Cluster: Protein disulphide isomerase; n=2;
           Cryptosporidium|Rep: Protein disulphide isomerase -
           Cryptosporidium hominis
          Length = 133

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 3/50 (6%)
 Frame = +2

Query: 95  PTEEN--VLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           P+++N  V +L    F E V  +T  +LV FY PWCGHCK+  P Y + A
Sbjct: 12  PSKQNGPVFILVGNTFKEIVYDSTRDVLVLFYTPWCGHCKTFDPIYNEVA 61


>UniRef50_Q1HFX5 Cluster: Dynein light chain 3-likeB; n=2;
           Tetrahymena thermophila|Rep: Dynein light chain 3-likeB
           - Tetrahymena thermophila
          Length = 110

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           + S   FE ++   EY+LV+F+A WCG CK LA ++
Sbjct: 8   ITSTKQFEDILEKNEYVLVDFFASWCGPCKILAEQF 43


>UniRef50_Q6FSC0 Cluster: Candida glabrata strain CBS138 chromosome
           H complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome H complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 533

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           P   N++  + + F T +     ++VEF+ PWC H K L P  ++AAT
Sbjct: 25  PDSSNIIKANISQFATHVKENPIVMVEFFTPWCTHSKMLQPRLSEAAT 72



 Score = 39.9 bits (89), Expect = 0.085
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI---DYSGGRQADDIISWLKKKTGPP 432
           I + +VD TQ   L +   +  YPTLK ++N   +   +Y G +  ++I ++L      P
Sbjct: 79  IPILQVDCTQYGVLCDQQMIDFYPTLKVYKNHRLVGAENYKGSQAGNEIANYLLNLKNNP 138

Query: 433 AVEVTSAEQAKEL 471
              +TSA++ +++
Sbjct: 139 VTNITSAQEVEKM 151



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 10/86 (11%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS-----PIDYSGGRQADDIISWLKK 417
           +  I  A+VD+T   D+ + + V GYPTL  +R GS     PI + G R  ++++ ++K 
Sbjct: 419 KEKIVFAEVDSTAN-DIID-FPVAGYPTLVLYRAGSKPGSQPIIFEGKRSLENVLDFIKS 476

Query: 418 KT-----GPPAVEVTSAEQAKELIDA 480
            +     G   +E    ++AK + DA
Sbjct: 477 HSTSNLDGQALLEKQKQDEAKAIEDA 502



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 2/42 (4%)
 Frame = +2

Query: 98  TEENVL--VLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           T+++VL  +++K + + V    + + V++YAPWC H K+  P
Sbjct: 362 TQDSVLYKLVAKTHNDFVYNNDKDVFVKYYAPWCQHSKAFRP 403


>UniRef50_Q2S0L9 Cluster: Thioredoxin; n=1; Salinibacter ruber DSM
           13855|Rep: Thioredoxin - Salinibacter ruber (strain DSM
           13855)
          Length = 307

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGPPAVEV 444
           L KV+       A+ YGVRG P +K F  G    +++G +    + SWL +    P+ E 
Sbjct: 89  LVKVNVDDHPSAAQEYGVRGIPAVKLFVEGDIEAEFAGVKPKPQLESWLDEHL--PSEEK 146

Query: 445 TSAEQAKELIDANT 486
           +  E+AKE ++A +
Sbjct: 147 SRIEEAKEALEAGS 160



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 11/18 (61%), Positives = 16/18 (88%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAP 217
           +LV+F+APWCG C+ L+P
Sbjct: 58  VLVDFWAPWCGPCQQLSP 75


>UniRef50_Q6IVR6 Cluster: Predicted thiol-disulfide
           isomerase/thioredoxin; n=8; Bacteria|Rep: Predicted
           thiol-disulfide isomerase/thioredoxin - uncultured gamma
           proteobacterium eBACHOT4E07
          Length = 108

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 7/97 (7%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP------EYAKAATKLAEEDLLSN 268
           V+V +K +F+  +  TE  +LV+F+A WCG CK LAP      E  K   K+ + D+ +N
Sbjct: 5   VVVENKDDFQNEVINTEGPVLVDFWAEWCGPCKQLAPLVEDASEEFKDKIKVCKMDVDAN 64

Query: 269 *RKLTQLKNRISPRATVYEDTRLSNSSGMAVLSTIQV 379
                +   R  P   ++E+  L  +  +  LS +Q+
Sbjct: 65  RETAAEYGIRSIPTLMIFENGELVGTE-IGALSKLQL 100


>UniRef50_A1RFF7 Cluster: Thioredoxin; n=27;
           Gammaproteobacteria|Rep: Thioredoxin - Shewanella sp.
           (strain W3-18-1)
          Length = 178

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 19/40 (47%), Positives = 29/40 (72%), Gaps = 1/40 (2%)
 Frame = +2

Query: 119 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAA 235
           L+ ANF   +T +E  ++V+F+A WCG CKS AP +++AA
Sbjct: 78  LTSANFTNHVTKSELPLVVDFWASWCGPCKSFAPIFSEAA 117


>UniRef50_P91442 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 574

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEY----ILVEFYAPWCGHCKSLAPEYAKAA 235
           E++VL L +A F   I   +      LVEFY+ WCGHC++ AP Y   A
Sbjct: 33  EDSVLQLDEATFNDTIFGAQSGAAGYLVEFYSDWCGHCRAFAPTYKNLA 81


>UniRef50_UPI0000498F30 Cluster: thioredoxin; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: thioredoxin - Entamoeba
           histolytica HM-1:IMSS
          Length = 144

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
 Frame = +1

Query: 250 RRSP-IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQA 390
           R +P IK  KVD  Q  D+A+ YGVR  PT   F+NG   D +SG  +A
Sbjct: 46  RTNPSIKFVKVDVDQGTDIAQRYGVRSMPTFILFKNGQEYDRFSGANRA 94



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 16/38 (42%), Positives = 25/38 (65%)
 Frame = +2

Query: 122 SKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           S ++F   I+T   +LV+F+A WCG CK +AP + + A
Sbjct: 8   SLSSFNKFISTHSNVLVDFFATWCGPCKMIAPYFEELA 45


>UniRef50_Q5E6R8 Cluster: Thioredoxin; n=11; Vibrionales|Rep:
           Thioredoxin - Vibrio fischeri (strain ATCC 700601 /
           ES114)
          Length = 284

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 23/72 (31%), Positives = 40/72 (55%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + LA ++  ++Q LA+ +GV+  PT+  F+NG  +D  GG Q  + I  +  K   P+ E
Sbjct: 56  VTLALLNCQEQQGLAQQFGVQTLPTIALFKNGQAVDGMGGPQTIEAIQGMLSK-HLPSQE 114

Query: 442 VTSAEQAKELID 477
                QA +L++
Sbjct: 115 ELQLGQAFKLVE 126


>UniRef50_Q57W47 Cluster: Disulfide isomerase, putative; n=1;
           Trypanosoma brucei|Rep: Disulfide isomerase, putative -
           Trypanosoma brucei
          Length = 589

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 16/28 (57%), Positives = 22/28 (78%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           L+ F+APWCGHCK+  P+YA A  +LA+
Sbjct: 72  LIFFFAPWCGHCKAALPKYADANLQLAK 99


>UniRef50_Q4DPR6 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 536

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 16/28 (57%), Positives = 21/28 (75%)
 Frame = +2

Query: 176 FYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           FYAPWC HCKSL P++A A+  L + D+
Sbjct: 69  FYAPWCAHCKSLLPQFANASRLLNQIDM 96


>UniRef50_Q6FLL8 Cluster: Similar to sp|P40557 Saccharomyces
           cerevisiae YIL005w; n=1; Candida glabrata|Rep: Similar
           to sp|P40557 Saccharomyces cerevisiae YIL005w - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 668

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 20/50 (40%), Positives = 30/50 (60%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLSN 268
           LS  +F ++I      L+EFY+P+C +C  LAP + K   K  E +LL+N
Sbjct: 28  LSSNDFYSLIKDGNLHLIEFYSPYCSYCNHLAPTWKKTWEKAQEINLLAN 77


>UniRef50_Q1DXY9 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 476

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 16/23 (69%), Positives = 18/23 (78%)
 Frame = +2

Query: 176 FYAPWCGHCKSLAPEYAKAATKL 244
           FYAPWCGHC++L P Y KAA  L
Sbjct: 4   FYAPWCGHCQNLKPAYEKAAKSL 26


>UniRef50_A7TFE6 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 550

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           ++E +L L+  NF+  I     +L EFYAPW  H K+++     AA +L + D++
Sbjct: 28  SDEIILQLNDNNFDDAINNNRLLLAEFYAPWSIHAKTMSTRLLAAAKELKKIDIV 82



 Score = 42.7 bits (96), Expect = 0.012
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKK 420
           ++  I + ++D T+  +L   Y +  YP +K F N +   PI+YSG   A  IIS +  +
Sbjct: 77  KKIDIVVGQIDCTESIELCAKYNIDAYPLMKIFNNKNLTHPIEYSGNSNAPIIISTV-LR 135

Query: 421 TGPPAVEVTSAEQ 459
             P AV+  + EQ
Sbjct: 136 NDPRAVKDVTMEQ 148


>UniRef50_A1D496 Cluster: Disulfide isomerase, putative; n=6;
           Pezizomycotina|Rep: Disulfide isomerase, putative -
           Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 493

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 16/23 (69%), Positives = 18/23 (78%)
 Frame = +2

Query: 176 FYAPWCGHCKSLAPEYAKAATKL 244
           FYAPWCGHC++L P Y KAA  L
Sbjct: 66  FYAPWCGHCQNLKPAYEKAAKNL 88



 Score = 33.9 bits (74), Expect = 5.6
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPA 435
           IK+ ++   +E +  E +GV+ +PTL     G   PI Y G  +   I+ +L +   P A
Sbjct: 202 IKVGQI-RNKESNAVEKFGVKEFPTLVLVPGGDKEPIIYDGELKKQAIVKFLSQVAAPNA 260

Query: 436 VEVTSAEQAK 465
               ++  AK
Sbjct: 261 DSAPASTNAK 270


>UniRef50_UPI0000499F4F Cluster: protein disulfide isomerase; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: protein disulfide
           isomerase - Entamoeba histolytica HM-1:IMSS
          Length = 329

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAK 229
           E  VL L+ +NF  V+   T+ ++V+FY PWC  CKS+  +Y +
Sbjct: 120 ESRVLELTASNFSAVVDDETKNVVVKFYVPWCNICKSIQSKYER 163



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +2

Query: 152 TTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           T     V+FYAPWC HC +L P +   A
Sbjct: 27  TKNMSFVKFYAPWCSHCIALQPVFEALA 54



 Score = 33.5 bits (73), Expect = 7.4
 Identities = 19/90 (21%), Positives = 46/90 (51%), Gaps = 5/90 (5%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLK-KKTG 426
           +S +   +++  + ++     G+R +P L+ + NG  I +Y G R   ++  +++ +K G
Sbjct: 58  KSKMNFIEINCVKYEEFCLDKGIRSFPELRMYENGIKISEYEGPRDLTNLGRFIRGEKIG 117

Query: 427 PP---AVEVTSAEQAKELIDANTVIVFGFF 507
            P    +E+T++  +  + D    +V  F+
Sbjct: 118 KPESRVLELTASNFSAVVDDETKNVVVKFY 147


>UniRef50_Q6NEA2 Cluster: Thioredoxin; n=3; Corynebacterium|Rep:
           Thioredoxin - Corynebacterium diphtheriae
          Length = 107

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLLS 265
           N + L++  F++++  ++  +LV+F+A WCG CK L P   + A +L +E L++
Sbjct: 3   NAIALTQDTFKSIVIDSDKPVLVDFWAQWCGPCKKLGPIIDEIAEELGDEVLVA 56


>UniRef50_Q604D2 Cluster: Thioredoxin family protein; n=1;
           Methylococcus capsulatus|Rep: Thioredoxin family protein
           - Methylococcus capsulatus
          Length = 271

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 1/84 (1%)
 Frame = +1

Query: 241 AG*RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKK 417
           AG      +L KV+  +  ++A  YGVRG P +K F +G+  D ++G      +  WL++
Sbjct: 44  AGRLAGRFELVKVNTEEHPEIARRYGVRGIPNVKLFVDGTVADEFTGTLPESALEDWLQR 103

Query: 418 KTGPPAVEVTSAEQAKELIDANTV 489
               P+      EQA+ LI A  V
Sbjct: 104 AL--PSPYQARLEQAEALISAGRV 125



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           +LV+F+APWC  C++L P     A +LA
Sbjct: 21  VLVDFWAPWCAPCRALTPVLEAVAGRLA 48


>UniRef50_Q5LLP8 Cluster: Thioredoxin; n=4; Proteobacteria|Rep:
           Thioredoxin - Silicibacter pomeroyi
          Length = 106

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 26/98 (26%), Positives = 52/98 (53%), Gaps = 8/98 (8%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAAT------KLAEEDLLS 265
           + + ++ A F+  +  ++  ++V+F+A WCG CK + P   + AT      K+A+ D+ S
Sbjct: 2   STVAVTDATFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELATEYAGKVKIAKVDVDS 61

Query: 266 N*RKLTQLKNRISPRATVYEDTR-LSNSSGMAVLSTIQ 376
           N      +  R  P   +++D + +SN +G A  + +Q
Sbjct: 62  NPNAAAAMGVRGIPALFIFKDGQVVSNRAGAAPKAALQ 99



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG 381
           +K+AKVD     + A + GVRG P L  F++G  +    G
Sbjct: 52  VKIAKVDVDSNPNAAAAMGVRGIPALFIFKDGQVVSNRAG 91


>UniRef50_Q3JDH4 Cluster: Thioredoxin domain-containing protein;
           n=2; Gammaproteobacteria|Rep: Thioredoxin
           domain-containing protein - Nitrosococcus oceani (strain
           ATCC 19707 / NCIMB 11848)
          Length = 287

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 21/45 (46%), Positives = 27/45 (60%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDII 402
           LAKV+A + Q L   YGVRG PTLK FR+   ++   G Q +  I
Sbjct: 60  LAKVNADEAQSLTHQYGVRGLPTLKLFRHSEVVEELVGVQPESAI 104



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 4/44 (9%)
 Frame = +2

Query: 98  TEEN-VLVLSKANFETVITTTEY---ILVEFYAPWCGHCKSLAP 217
           +E N +L +++ANF   + T  Y   +LV+F+A WC  C+ L P
Sbjct: 2   SENNYILDITEANFAEQVLTKSYQTPVLVDFWAAWCQPCQMLMP 45


>UniRef50_A4VH22 Cluster: Thioredoxin 2; n=1; Pseudomonas stutzeri
           A1501|Rep: Thioredoxin 2 - Pseudomonas stutzeri (strain
           A1501)
          Length = 145

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 7/85 (8%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA------TKLAEEDLLSN*RKL 280
           L ++ F   I     +LV+ +A WCG C+S AP +A+AA       +LA+ D  +N +  
Sbjct: 44  LQQSQFANQIKGDLPLLVDVWASWCGPCRSFAPTFAQAARQLQGRCRLAKLDSEANAQLS 103

Query: 281 TQLKNRISPRATVYEDTR-LSNSSG 352
           TQL  R  P   ++ D R ++  SG
Sbjct: 104 TQLGIRSIPSLILFRDGREVARQSG 128



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +1

Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKK 420
           +LAK+D+     L+   G+R  P+L  FR+G  +   SG      +++WL ++
Sbjct: 90  RLAKLDSEANAQLSTQLGIRSIPSLILFRDGREVARQSGAMPLPQLLAWLAQQ 142


>UniRef50_Q54UW6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 994

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 16/42 (38%), Positives = 29/42 (69%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKA 232
           ++L L++ NF+ VI   +++ V FYAPWCG  +++  E+ +A
Sbjct: 362 SILELTENNFDRVIKENQFVFVLFYAPWCGRSQAMMGEFYEA 403



 Score = 36.7 bits (81), Expect = 0.79
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           + N +V +  N   + +  +  L+ F APWCG+CK++   Y +AA  L+ +
Sbjct: 772 QSNNIVYNNFNSTVLESKDKNSLIYFNAPWCGYCKTMNIYYREAAKILSTQ 822


>UniRef50_Q4L0D7 Cluster: Thioredoxin; n=1; Chlamys farreri|Rep:
           Thioredoxin - Chlamys farreri
          Length = 108

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +2

Query: 122 SKANFETVITTTEYILVEFYAPWCGHCKSLAP---EYAKAAT 238
           +KA+F+  + T + ++++F+A WCG CK +AP   E AKA T
Sbjct: 12  TKADFDECLQTDKLVVIDFFADWCGPCKQIAPAIEELAKANT 53


>UniRef50_Q1JT82 Cluster: Thioredoxin, putative; n=1; Toxoplasma
           gondii RH|Rep: Thioredoxin, putative - Toxoplasma gondii
           RH
          Length = 106

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 16/34 (47%), Positives = 25/34 (73%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           V ++A F+++I   E +LV+FYA WCG C+ +AP
Sbjct: 6   VTTEAQFKSLIEENEMVLVDFYAVWCGPCRQVAP 39



 Score = 37.1 bits (82), Expect = 0.60
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417
           +K  K+D  +  D+AE   +   PT K F+ G  +D   G  A+ +   +KK
Sbjct: 53  VKFVKIDVDELADVAEREEINAMPTFKLFKQGKAVDTVLGANAERVEEMVKK 104


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 850,475,590
Number of Sequences: 1657284
Number of extensions: 16608280
Number of successful extensions: 47004
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 43958
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46871
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 80342087756
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -